254780171

254780171

ABC transporter membrane spanning protein (amino acid)

GeneID in NCBI database:8209148Locus tag:CLIBASIA_00270
Protein GI in NCBI database:254780171Protein Accession:YP_003064584.1
Gene range:+(52654, 53850)Protein Length:398aa
Gene description:ABC transporter membrane spanning protein (amino acid)
COG prediction:[E] ABC-type amino acid transport system, permease component
KEGG prediction:aapQ; ABC transporter membrane spanning protein (amino acid); K09970 general L-amino acid transport system permease protein
SEED prediction:Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED8 TM-Helix
HMMTOP8 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK
ccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHcccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHEEEcHHHHHHHccHHHHHHHHHHHccHHHHHHccHHHHHHHcHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVynnmeksnlslgigflseragfeidqgivpytsdssyATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVlsvlpipdhsivlpfgmflnnrglsfptltmdtnaKIFVFSFVLGIVLSLFATRLSRHFhektgkalplLYISTFLIFGLPTLVLIALKYQlhfdkpvlgqfnfiggstvspeFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVllpqamrsiippltsqYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK
miknarktvtRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK
MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK
*******************YDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIAL****
MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK
*****RKT*TRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIAL****
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK
MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK
MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target398 ABC transporter membrane spanning protein (amino acid)
254780172386 general L-amino acid transport system permease pro 6e-14
254780172386 general L-amino acid transport system permease pro 0.003
254781113226 amino acid ABC transporter (permease) [Candidatus 2e-11
>gi|254780172|ref|YP_003064585.1| general L-amino acid transport system permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 386 Back     alignment
 Score = 70.1 bits (170), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 57/82 (69%)

Query: 271 IALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQ 330
           + +S + +A+IAE++R GL ++ +GQ EAA +LGL++ +  RL+++PQ ++ +IP + + 
Sbjct: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313

Query: 331 YLNLLKNSSLAVAVGFADLVSV 352
           ++ L K+SSL   +   DL+ +
Sbjct: 314 FIGLFKDSSLISIINMFDLLGI 335

>gi|254780172|ref|YP_003064585.1| general L-amino acid transport system permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 386 Back     alignment
 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 87  TAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIF 146
           T++  G + T  ++F G+I +  +G L+  GR S   ++ + C  ++E+FR +P + V+F
Sbjct: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230

Query: 147 FLYKSVLSVLPIPD 160
               S++  L +PD
Sbjct: 231 M--ASIMLPLFLPD 242

>gi|254781113|ref|YP_003065526.1| amino acid ABC transporter (permease) [Candidatus Liberibacter asiaticus str. psy62] Length = 226 Back     alignment
 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 112/217 (51%), Gaps = 40/217 (18%)

Query: 177 SFPTL-------TMDTNAKIFVFSFVLGIVLSLFATRLSR-------HFHEKTGKALPLL 222
           SFP L       T+      FV S ++G  +++     S        HF+    +  PLL
Sbjct: 12  SFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLL 71

Query: 223 YISTFLIF-GLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFI 281
            +  F+IF GLP + ++       FD                  F+++ I+L+   +A+I
Sbjct: 72  -VQLFVIFYGLPHIGIV-------FDS-----------------FVAIIISLTLNFSAYI 106

Query: 282 AEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLA 341
           +EI+RS +I++P+GQ +A+ A+GLT ++  R ++LPQ + +   PL+S+++++LK++S+A
Sbjct: 107 SEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVA 166

Query: 342 VAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLS 378
             +   ++      I++ T Q + I     F+YL L+
Sbjct: 167 STITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILT 203

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target398 ABC transporter membrane spanning protein (amino acid)
315122674398 ABC transporter membrane spanning protein (amino acid) 1 1e-175
222148881398 ABC transporter membrane spanning protein (amino acid) 1 1e-113
325292971398 General L-amino acid transport system permease protein 1 1e-111
159184824398 ABC transporter, membrane spanning protein (amino acid) 1 1e-110
116251959400 general L-amino acid transport system permease [Rhizobi 1 1e-108
241204487400 polar amino acid ABC transcriptional regulator inner me 1 1e-106
227821879397 putative amino-acid ABC transporter membrane protein [S 1 1e-106
239831566408 amino acid ABC transporter, permease protein, 3-TM regi 1 1e-103
86357518406 general L-amino acid ABC transporter, permease protein 1 1e-103
153009883397 polar amino acid ABC transporter inner membrane subunit 1 1e-103
>gi|315122674|ref|YP_004063163.1| ABC transporter membrane spanning protein (amino acid) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 398 Back     alignment and organism information
 Score =  620 bits (1600), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 301/398 (75%), Positives = 347/398 (87%)

Query: 1   MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCVNNVYNNMEKSNLSLG 60
           M+KN +      F  MKFLYD+R+ +I +Q ++  ++T++ LW VNNV++NM KSNLSLG
Sbjct: 1   MMKNIKSMFNHNFCEMKFLYDVRIRSILIQAVILSIVTMVILWLVNNVHHNMVKSNLSLG 60

Query: 61  IGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGRLS 120
           IGFL ERAGFEIDQGI+PYTSDSSYA AI+VGF NTF +AF+G+IPATIIG LVG GRLS
Sbjct: 61  IGFLKERAGFEIDQGIIPYTSDSSYAMAIVVGFSNTFMVAFAGIIPATIIGVLVGTGRLS 120

Query: 121 ANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSIVLPFGMFLNNRGLSFPT 180
           +NKLV+WICRVYVEVFRNIPPLVVIFF Y+SVLS+LPIP+HSI LP G+FLNNRG SFPT
Sbjct: 121 SNKLVSWICRVYVEVFRNIPPLVVIFFWYRSVLSILPIPEHSISLPLGIFLNNRGFSFPT 180

Query: 181 LTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIAL 240
           L MD NAKI +FSFVLGI LS+F+ +LSR FH KTG+ LPL Y++  LI GLP LVL+AL
Sbjct: 181 LIMDINAKIVLFSFVLGIALSIFSAKLSRQFHMKTGQTLPLFYVAVLLILGLPMLVLLAL 240

Query: 241 KYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAA 300
            +QL+FDKPVLG+FNF GG T+ PEFMSLYIALSCYTA+FIAEI+R GLI+V RGQMEAA
Sbjct: 241 NFQLYFDKPVLGKFNFTGGCTIGPEFMSLYIALSCYTASFIAEIIRLGLISVSRGQMEAA 300

Query: 301 IALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQT 360
           IALGLT  KATRLV+LPQAMR IIPPLTSQYLNLLKNSSLAVAVGFADLVSVGG+IINQT
Sbjct: 301 IALGLTPGKATRLVILPQAMRIIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGSIINQT 360

Query: 361 GQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK 398
           GQAIEIILIWMFIYLSLSIMI+LFMN LN K+ALKE++
Sbjct: 361 GQAIEIILIWMFIYLSLSIMISLFMNWLNTKVALKERR 398


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148881|ref|YP_002549838.1| ABC transporter membrane spanning protein (amino acid) [Agrobacterium vitis S4] Length = 398 Back     alignment and organism information
>gi|325292971|ref|YP_004278835.1| General L-amino acid transport system permease protein aapQ [Agrobacterium sp. H13-3] Length = 398 Back     alignment and organism information
>gi|159184824|ref|NP_354576.2| ABC transporter, membrane spanning protein (amino acid) [Agrobacterium tumefaciens str. C58] Length = 398 Back     alignment and organism information
>gi|116251959|ref|YP_767797.1| general L-amino acid transport system permease [Rhizobium leguminosarum bv. viciae 3841] Length = 400 Back     alignment and organism information
>gi|241204487|ref|YP_002975583.1| polar amino acid ABC transcriptional regulator inner membrane protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 400 Back     alignment and organism information
>gi|227821879|ref|YP_002825849.1| putative amino-acid ABC transporter membrane protein [Sinorhizobium fredii NGR234] Length = 397 Back     alignment and organism information
>gi|239831566|ref|ZP_04679895.1| amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family [Ochrobactrum intermedium LMG 3301] Length = 408 Back     alignment and organism information
>gi|86357518|ref|YP_469410.1| general L-amino acid ABC transporter, permease protein [Rhizobium etli CFN 42] Length = 406 Back     alignment and organism information
>gi|153009883|ref|YP_001371098.1| polar amino acid ABC transporter inner membrane subunit [Ochrobactrum anthropi ATCC 49188] Length = 397 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target398 ABC transporter membrane spanning protein (amino acid)
COG0765222 COG0765, HisM, ABC-type amino acid transport system, pe 4e-31
COG4215230 COG4215, ArtQ, ABC-type arginine transport system, perm 2e-18
COG4160228 COG4160, ArtM, ABC-type arginine/histidine transport sy 6e-18
TIGR03003212 TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC tra 2e-16
PRK09494219 PRK09494, glnP, glutamine ABC transporter permease prot 2e-16
PRK15100220 PRK15100, PRK15100, amino acid ABC transporter permease 2e-16
PRK11123238 PRK11123, PRK11123, arginine transporter permease subun 5e-12
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 6e-09
PRK11122222 PRK11122, artM, arginine transporter permease subunit A 1e-04
PRK15107224 PRK15107, PRK15107, glutamate/aspartate transport syste 8e-18
TIGR03004214 TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC tra 2e-13
PRK15069234 PRK15069, PRK15069, histidine/lysine/arginine/ornithine 6e-06
pfam00528183 pfam00528, BPD_transp_1, Binding-protein-dependent tran 1e-04
TIGR0172699 TIGR01726, HEQRo_perm_3TM, amine acid ABC transporter, 6e-11
COG0765222 COG0765, HisM, ABC-type amino acid transport system, pe 2e-10
COG4215230 COG4215, ArtQ, ABC-type arginine transport system, perm 2e-06
COG4160228 COG4160, ArtM, ABC-type arginine/histidine transport sy 1e-05
PRK15100220 PRK15100, PRK15100, amino acid ABC transporter permease 4e-05
TIGR03004214 TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC tra 4e-05
TIGR03003212 TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC tra 6e-05
PRK15107224 PRK15107, PRK15107, glutamate/aspartate transport syste 1e-04
PRK09494219 PRK09494, glnP, glutamine ABC transporter permease prot 0.001
PRK15135228 PRK15135, PRK15135, histidine/lysine/arginine/ornithine 0.002
PRK15135228 PRK15135, PRK15135, histidine/lysine/arginine/ornithine 7e-08
COG2011222 COG2011, AbcD, ABC-type metal ion transport system, per 3e-06
PRK10782217 PRK10782, PRK10782, DL-methionine transporter permease 4e-05
TIGR02138295 TIGR02138, phosphate_pstC, phosphate ABC transporter, p 6e-04
COG0573310 COG0573, PstC, ABC-type phosphate transport system, per 0.003
COG4597397 COG4597, BatB, ABC-type amino acid transport system, pe 1e-112
>gnl|CDD|31108 COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33942 COG4215, ArtQ, ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33906 COG4160, ArtM, ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132048 TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC transporter, permease protein EhuD Back     alignment and domain information
>gnl|CDD|181907 PRK09494, glnP, glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>gnl|CDD|185055 PRK15100, PRK15100, amino acid ABC transporter permease; Provisional Back     alignment and domain information
>gnl|CDD|182979 PRK11123, PRK11123, arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|182978 PRK11122, artM, arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>gnl|CDD|185062 PRK15107, PRK15107, glutamate/aspartate transport system permease GltK; Provisional Back     alignment and domain information
>gnl|CDD|132049 TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC transporter, permease protein EhuC Back     alignment and domain information
>gnl|CDD|185029 PRK15069, PRK15069, histidine/lysine/arginine/ornithine ABC transporter permease HisM; Provisional Back     alignment and domain information
>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>gnl|CDD|130787 TIGR01726, HEQRo_perm_3TM, amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family Back     alignment and domain information
>gnl|CDD|31108 COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33942 COG4215, ArtQ, ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33906 COG4160, ArtM, ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185055 PRK15100, PRK15100, amino acid ABC transporter permease; Provisional Back     alignment and domain information
>gnl|CDD|132049 TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC transporter, permease protein EhuC Back     alignment and domain information
>gnl|CDD|132048 TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC transporter, permease protein EhuD Back     alignment and domain information
>gnl|CDD|185062 PRK15107, PRK15107, glutamate/aspartate transport system permease GltK; Provisional Back     alignment and domain information
>gnl|CDD|181907 PRK09494, glnP, glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>gnl|CDD|185089 PRK15135, PRK15135, histidine/lysine/arginine/ornithine ABC transporter permease HisQ; Provisional Back     alignment and domain information
>gnl|CDD|185089 PRK15135, PRK15135, histidine/lysine/arginine/ornithine ABC transporter permease HisQ; Provisional Back     alignment and domain information
>gnl|CDD|32194 COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182726 PRK10782, PRK10782, DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>gnl|CDD|162724 TIGR02138, phosphate_pstC, phosphate ABC transporter, permease protein PstC Back     alignment and domain information
>gnl|CDD|30918 COG0573, PstC, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|34232 COG4597, BatB, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 398 ABC transporter membrane spanning protein (amino acid)
COG4597397 BatB ABC-type amino acid transport system, permease com 100.0
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 99.73
PRK10160275 taurine transporter subunit; Provisional 99.63
COG0573310 PstC ABC-type phosphate transport system, permease comp 99.52
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 99.41
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 99.33
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 96.13
COG0765222 HisM ABC-type amino acid transport system, permease com 100.0
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 100.0
PRK09494219 glnP glutamine ABC transporter permease protein; Review 100.0
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 100.0
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 100.0
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 100.0
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 100.0
COG4215230 ArtQ ABC-type arginine transport system, permease compo 100.0
PRK10782217 DL-methionine transporter permease subunit; Provisional 100.0
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 99.65
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.64
PRK09421229 modB molybdate ABC transporter permease protein; Review 99.61
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.59
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 99.58
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 99.57
PRK10683317 putrescine transporter subunit: membrane component of A 99.45
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.25
COG1175295 UgpA ABC-type sugar transport systems, permease compone 99.19
PRK10914339 dipeptide transporter permease DppB; Provisional 99.16
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.05
PRK10352314 nickel transporter permease NikB; Provisional 99.02
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 98.91
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 98.85
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 98.36
TIGR0172699 HEQRo_perm_3TM amino acid ABC transporter, permease pro 99.95
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 99.71
COG0581292 PstA ABC-type phosphate transport system, permease comp 99.47
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 99.39
CHL00187235 cysT sulfate transport protein; Provisional 99.18
PRK10913300 dipeptide transporter; Provisional 99.17
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.09
PRK10999520 malF maltose transporter membrane protein; Provisional 98.86
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 99.65
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 99.61
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.57
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 99.56
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 99.51
PRK10592281 putrescine transporter subunit: membrane component of A 99.43
COG1178 540 ThiP ABC-type Fe3+ transport system, permease component 99.41
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.38
PRK09433536 thiP thiamine transporter membrane protein; Reviewed 99.37
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 99.37
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 99.33
PRK09433 536 thiP thiamine transporter membrane protein; Reviewed 99.22
COG1178540 ThiP ABC-type Fe3+ transport system, permease component 99.21
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 99.17
COG0555274 CysU ABC-type sulfate transport system, permease compon 98.94
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 98.83
COG4149225 ModC ABC-type molybdate transport system, permease comp 98.34
COG4176290 ProW ABC-type proline/glycine betaine transport system, 98.21
COG4209309 LplB ABC-type polysaccharide transport system, permease 97.77
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 97.24
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 97.15
COG4132282 ABC-type uncharacterized transport system, permease com 96.5
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 99.45
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 99.03
TIGR03262 546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.31
PRK10998296 malG maltose transporter permease; Provisional 99.05
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 98.75
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 98.44
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 98.4
COG0395281 UgpE ABC-type sugar transport system, permease componen 97.92
COG3833282 MalG ABC-type maltose transport systems, permease compo 97.11
COG4986523 ABC-type anion transport system, duplicated permease co 95.6
pfam03649250 UPF0014 Uncharacterized protein family (UPF0014). 93.86
PRK10952354 glycine betaine transporter membrane protein; Provision 99.06
COG4208287 CysW ABC-type sulfate transport system, permease compon 96.94
COG4590733 ABC-type uncharacterized transport system, permease com 96.71
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 96.33
COG4239341 ABC-type uncharacterized transport system, permease com 95.57
TIGR02789315 nickel_nikB nickel ABC transporter, permease subunit Ni 91.76
>COG4597 BatB ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02138 phosphate_pstC phosphate ABC transporter, permease protein PstC; InterPro: IPR011864 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>TIGR03003 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, permease protein EhuD; InterPro: IPR014341 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4160 ArtM ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03004 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, permease protein EhuC; InterPro: IPR014342 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4215 ArtQ ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09881 ATP-dependent peptide transporter membrane subunit; Provisional Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10914 dipeptide transporter permease DppB; Provisional Back     alignment and domain information
>PRK09471 oppB oligopeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10352 nickel transporter permease NikB; Provisional Back     alignment and domain information
>COG1173 DppC ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR01726 HEQRo_perm_3TM amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family; InterPro: IPR010065 This entry represents one of several classes of multiple membrane spanning regions found in the inner membrane component of binding-protein-dependent transport systems Back     alignment and domain information
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>CHL00187 cysT sulfate transport protein; Provisional Back     alignment and domain information
>PRK10913 dipeptide transporter; Provisional Back     alignment and domain information
>PRK10417 nikC nickel transporter permease NikC; Provisional Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>pfam00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>COG4132 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PRK11268 pstA phosphate transporter permease subunit; Provisional Back     alignment and domain information
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam03649 UPF0014 Uncharacterized protein family (UPF0014) Back     alignment and domain information
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4239 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target398 ABC transporter membrane spanning protein (amino acid)
3dhw_A217 D-methionine transport system permease protein METI; AB 1e-07
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 1e-06
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Length = 217 Back     alignment and structure
 Score = 53.2 bits (127), Expect = 1e-07
 Identities = 39/203 (19%), Positives = 78/203 (38%), Gaps = 12/203 (5%)

Query: 190 FVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKP 249
             F FV+G+ + +              K    +     +   +P ++L+           
Sbjct: 24  GFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIV 83

Query: 250 VLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRK 309
                             +  + L+   A FIA +V + L+ +P G +EA+ A+G T  +
Sbjct: 84  GTS-----------IGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQ 132

Query: 310 ATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILI 369
             R VLLP+A+  ++   T   + L+  S++  AVG   L  +G         A  +  +
Sbjct: 133 IVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATVMNTV 192

Query: 370 WMFIYLSLSIMIALFMNRLNAKI 392
            + + + L  +I    +R+   +
Sbjct: 193 -LVLLVILVYLIQFAGDRIVRAV 214


>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Length = 295 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target398 ABC transporter membrane spanning protein (amino acid)
3dhw_A217 D-methionine transport system permease protein METI; AB 99.94
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 99.86
2onk_C284 Molybdate/tungstate ABC transporter, permease protein; 99.84
2r6g_F514 Maltose transport system permease protein MALF; ABC tra 99.7
2r6g_G296 Maltose transport system permease protein MALG; ABC tra 99.33
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Back     alignment and structure
Probab=99.94  E-value=2.3e-26  Score=178.05  Aligned_cols=206  Identities=23%  Similarity=0.332  Sum_probs=162.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6526999999999999999999999999999999996-------264246787799999999501469999999999873
Q gi|254780171|r   82 DSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGR-------LSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLS  154 (398)
Q Consensus        82 ~~sy~~a~~vGl~NTl~va~~givlatiLG~~iGi~R-------lS~N~ll~~la~~YVE~~RN~PLLlql~fwy~~v~~  154 (398)
                      +|+..+-++-|+.||+++++.+.++++++|+.+|+..       ...+..+.+....+++++|++|.++.+++..... .
T Consensus         2 s~~~~~l~l~~~~~Tl~~a~~~~~~~~~ig~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~~~~~~~~~~~-~   80 (217)
T 3dhw_A            2 SEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFT-R   80 (217)
T ss_dssp             ----CHHHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHH-H
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-H
T ss_conf             878999999999999999999999999999999999999864443200899999999999999999999999999999-9


Q ss_pred             HCCCHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCHHHH
Q ss_conf             01210344410372035201000354535567004688778899999999999999864311223320455421010355
Q gi|254780171|r  155 VLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPT  234 (398)
Q Consensus       155 ~lP~~~~~~~~~~~~flsnRGL~iP~p~~~~g~~~~l~~lilaiila~~l~~~a~~~~~~tg~~~~~~~~~~~~~~~~p~  234 (398)
                      ..                                                                              
T Consensus        81 ~~------------------------------------------------------------------------------   82 (217)
T 3dhw_A           81 VI------------------------------------------------------------------------------   82 (217)
T ss_dssp             HT------------------------------------------------------------------------------
T ss_pred             HH------------------------------------------------------------------------------
T ss_conf             99------------------------------------------------------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             89997654443322100131112682148789999999999977879999999998346367899989689989988898
Q gi|254780171|r  235 LVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLV  314 (398)
Q Consensus       235 l~~~~~~~~~~~~~p~l~~f~~~gG~~l~p~f~a~~iaL~l~taAyiaEivR~gI~sVpkGQ~EAA~aLGls~~q~~r~V  314 (398)
                                       .      |..  ..+.+.++++++++..|+.+.+|+|++++|++|.|||+++|.|++|++|+|
T Consensus        83 -----------------~------~~~--~~~~~~ii~~~~~~~~~~~~~~~~~l~~i~~~~~eAA~~lGas~~q~f~~v  137 (217)
T 3dhw_A           83 -----------------V------GTS--IGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKV  137 (217)
T ss_dssp             -----------------T------CCS--SSHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHT
T ss_pred             -----------------H------HHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHH
T ss_conf             -----------------8------612--369999999999867999999999998589899999871898989996974


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             768999997410478999999754999999999999999999831377589999999999999999999999996787
Q gi|254780171|r  315 LLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKI  392 (398)
Q Consensus       315 IlPQAlR~~iP~l~nq~i~l~K~SSLa~~Ig~~dl~~~~~~~~~~t~~~~e~~~i~~~~Yl~isl~iS~~~n~~~rr~  392 (398)
                      ++||+.+.+++++.+.++..+|+++++..+|.+|+...+.....+.++.-. .......+.++...+....++++||+
T Consensus       138 ilP~~~p~ii~~~~~~~~~~i~~~~i~~~ig~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~~~~  214 (217)
T 3dhw_A          138 LLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATV-MNTVLVLLVILVYLIQFAGDRIVRAV  214 (217)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHCCSTTCCHHHHHHHHHHHSSCCTTH-HHHHHHHHHHHHHHHHHHCC------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             199789999999999999999999999999887999999999998600899-99999999999999999999999975



>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Back     alignment and structure
>2onk_C Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: f.58.1.1 Back     alignment and structure
>2r6g_F Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: e.70.1.1 f.58.1.1 PDB: 3fh6_F Back     alignment and structure
>2r6g_G Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: f.58.1.1 PDB: 3fh6_G Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 398 ABC transporter membrane spanning protein (amino acid)
d3dhwa1203 f.58.1.1 (A:6-208) D-methionine transport system permea 2e-08
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Length = 203 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
 Score = 54.3 bits (130), Expect = 2e-08
 Identities = 36/194 (18%), Positives = 74/194 (38%), Gaps = 11/194 (5%)

Query: 190 FVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKP 249
             F FV+G+ + +              K    +     +   +P ++L+           
Sbjct: 19  GFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIV 78

Query: 250 VLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRK 309
                             +  + L+   A FIA +V + L+ +P G +EA+ A+G T  +
Sbjct: 79  GTS-----------IGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQ 127

Query: 310 ATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILI 369
             R VLLP+A+  ++   T   + L+  S++  AVG   L  +G         A  +  +
Sbjct: 128 IVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATVMNTV 187

Query: 370 WMFIYLSLSIMIAL 383
            + + + + ++   
Sbjct: 188 LVLLVILVYLIQFA 201


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target398 ABC transporter membrane spanning protein (amino acid)
d3dhwa1203 D-methionine transport system permease protein MetI {Es 99.92
d2onkc1252 Molybdate/tungstate transport system permease protein W 99.73
d3d31c1248 Sulfate/molybdate ABC transporter, permease protein {Me 99.67
d2r6gf2244 Maltose transport system permease protein MalF {Escheri 99.54
d2r6gg1290 Maltose transport system permease protein MalG {Escheri 99.38
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
Probab=99.92  E-value=3.8e-24  Score=163.11  Aligned_cols=190  Identities=25%  Similarity=0.357  Sum_probs=155.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             9999999999999999999999999999999-------626424678779999999950146999999999987301210
Q gi|254780171|r   87 TAILVGFVNTFWLAFSGMIPATIIGTLVGAG-------RLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIP  159 (398)
Q Consensus        87 ~a~~vGl~NTl~va~~givlatiLG~~iGi~-------RlS~N~ll~~la~~YVE~~RN~PLLlql~fwy~~v~~~lP~~  159 (398)
                      +.++.|+.||+.+++.+.++|+++|+.+|+.       +...++.+.+....+++++|.+|..+++++.+.... ..   
T Consensus         2 ~lll~~~~~tl~is~~~~~i~~ilg~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~v~~~~~~~~~~-~~---   77 (203)
T d3dhwa1           2 WLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTR-VI---   77 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHH-HT---
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HH---
T ss_conf             88999999999999999999999999999999998744432008999999999999999999999999998635-54---


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCHHHHHHHHH
Q ss_conf             34441037203520100035453556700468877889999999999999986431122332045542101035589997
Q gi|254780171|r  160 DHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIA  239 (398)
Q Consensus       160 ~~~~~~~~~~flsnRGL~iP~p~~~~g~~~~l~~lilaiila~~l~~~a~~~~~~tg~~~~~~~~~~~~~~~~p~l~~~~  239 (398)
                                                                                                      
T Consensus        78 --------------------------------------------------------------------------------   77 (203)
T d3dhwa1          78 --------------------------------------------------------------------------------   77 (203)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             65444332210013111268214878999999999997787999999999834636789998968998998889876899
Q gi|254780171|r  240 LKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQA  319 (398)
Q Consensus       240 ~~~~~~~~~p~l~~f~~~gG~~l~p~f~a~~iaL~l~taAyiaEivR~gI~sVpkGQ~EAA~aLGls~~q~~r~VIlPQA  319 (398)
                                        .|..  ..+.+.++++++++.+|+++++|+|++++|++|.|||+++|.|++|++|+|++||+
T Consensus        78 ------------------~~~~--~~~~~~i~~~~~~~~p~~~~~~~~~l~~i~~~~~Eaa~~lGas~~q~~~~vilP~~  137 (203)
T d3dhwa1          78 ------------------VGTS--IGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEA  137 (203)
T ss_dssp             ------------------TCCS--SSHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHH
T ss_pred             ------------------HCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             ------------------0454--11999999999986489999999888843620689998869944424188409976


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99974104789999997549999999999999999998313775899999999999999999
Q gi|254780171|r  320 MRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMI  381 (398)
Q Consensus       320 lR~~iP~l~nq~i~l~K~SSLa~~Ig~~dl~~~~~~~~~~t~~~~e~~~i~~~~Yl~isl~i  381 (398)
                      .+.+++...+++...+|+++++..+|.+|+.....+..++.++..+....+.. .+++...+
T Consensus       138 ~p~i~~~~~~~~~~~i~~~~~~~~ig~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~i~v~li  198 (203)
T d3dhwa1         138 LPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATVMNTVLVL-LVILVYLI  198 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCCSTTCCHHHHHHHHHHHSSCCTTHHHHHHHH-HHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH-HHHHHHHH
T ss_conf             99999999999999999999999997759999999999874028999999999-99999999



>d2onkc1 f.58.1.1 (C:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2r6gf2 f.58.1.1 (F:261-504) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r6gg1 f.58.1.1 (G:7-296) Maltose transport system permease protein MalG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 398 ABC transporter membrane spanning protein (amino a
3dhw_A_217 (A:) D-methionine transport system permease protei 1e-13
2r6g_F_269-326_360-453152 (F:269-326,F:360-453) Maltose transport system per 2e-07
3d31_C_295 (C:) Sulfate/molybdate ABC transporter, permease p 5e-07
2onk_C_69-249181 (C:69-249) Molybdate/tungstate ABC transporter, pe 5e-05
2r6g_G_73-244172 (G:73-244) Maltose transport system permease prote 0.004
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12}Length = 217 Back     alignment and structure
 Score = 72.3 bits (177), Expect = 1e-13
 Identities = 37/205 (18%), Positives = 76/205 (37%), Gaps = 14/205 (6%)

Query: 190 FVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPTLVLIALKYQLHFDKP 249
             F FV+G+ + +              K    +     +   +P ++L+           
Sbjct: 24  GFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMI------- 76

Query: 250 VLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRK 309
                        S    +  + L+   A FIA +V + L+ +P G +EA+ A+G T  +
Sbjct: 77  ----PFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQ 132

Query: 310 ATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQ---AIEI 366
             R VLLP+A+  ++   T   + L+  S++  AVG   L  +G               +
Sbjct: 133 IVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATVMNTV 192

Query: 367 ILIWMFIYLSLSIMIALFMNRLNAK 391
           +++ + +   +       +  +  K
Sbjct: 193 LVLLVILVYLIQFAGDRIVRAVTRK 217


>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 152 Back     alignment and structure
>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans}Length = 295 Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus}Length = 181 Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 172 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target398 ABC transporter membrane spanning protein (amino acid)
3dhw_A_217 D-methionine transport system permease protein MET 99.94
3d31_C_295 Sulfate/molybdate ABC transporter, permease protei 99.88
2onk_C_69-249181 Molybdate/tungstate ABC transporter, permease prot 99.73
2r6g_F_269-326_360-453152 Maltose transport system permease protein MALF; AB 99.55
2r6g_G_73-244172 Maltose transport system permease protein MALG; AB 99.52
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} Back     alignment and structure
Probab=99.94  E-value=5.3e-26  Score=176.77  Aligned_cols=206  Identities=22%  Similarity=0.316  Sum_probs=173.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6526999999999999999999999999999999996-------264246787799999999501469999999999873
Q gi|254780171|r   82 DSSYATAILVGFVNTFWLAFSGMIPATIIGTLVGAGR-------LSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLS  154 (398)
Q Consensus        82 ~~sy~~a~~vGl~NTl~va~~givlatiLG~~iGi~R-------lS~N~ll~~la~~YVE~~RN~PLLlql~fwy~~v~~  154 (398)
                      +++..+.++.++.||+++++.+.++++++|+.+|+.-       .-.+..+..+.....+.++.+|.++++.+.+.....
T Consensus         2 s~~~~~~l~~~l~~tl~~~~~~~~i~~vig~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (217)
T 3dhw_A            2 SEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRV   81 (217)
T ss_dssp             ----CHHHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87899999999999999999999999999999999999987344320189999999999999999999999999986455


Q ss_pred             HCCCHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCHHHH
Q ss_conf             01210344410372035201000354535567004688778899999999999999864311223320455421010355
Q gi|254780171|r  155 VLPIPDHSIVLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLLYISTFLIFGLPT  234 (398)
Q Consensus       155 ~lP~~~~~~~~~~~~flsnRGL~iP~p~~~~g~~~~l~~lilaiila~~l~~~a~~~~~~tg~~~~~~~~~~~~~~~~p~  234 (398)
                      ..+                                                                             
T Consensus        82 ~~~-----------------------------------------------------------------------------   84 (217)
T 3dhw_A           82 IVG-----------------------------------------------------------------------------   84 (217)
T ss_dssp             TTC-----------------------------------------------------------------------------
T ss_pred             HCC-----------------------------------------------------------------------------
T ss_conf             204-----------------------------------------------------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             89997654443322100131112682148789999999999977879999999998346367899989689989988898
Q gi|254780171|r  235 LVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLV  314 (398)
Q Consensus       235 l~~~~~~~~~~~~~p~l~~f~~~gG~~l~p~f~a~~iaL~l~taAyiaEivR~gI~sVpkGQ~EAA~aLGls~~q~~r~V  314 (398)
                                               .  ...+.+.++++++++.+|+.+++|++++++|++|.|||+++|+|++|++++|
T Consensus        85 -------------------------~--~~~~~~~ii~~~~~~~~~i~~~~~~~l~~i~~~~~eaA~~lG~s~~q~~~~v  137 (217)
T 3dhw_A           85 -------------------------T--SIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKV  137 (217)
T ss_dssp             -------------------------C--SSSHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHT
T ss_pred             -------------------------C--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCHHHHHHHH
T ss_conf             -------------------------5--3018899898899724689899998888615027788860698742142673


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7689999974104789999997549999999999999999998313775---8999999999999999999999999678
Q gi|254780171|r  315 LLPQAMRSIIPPLTSQYLNLLKNSSLAVAVGFADLVSVGGTIINQTGQA---IEIILIWMFIYLSLSIMIALFMNRLNAK  391 (398)
Q Consensus       315 IlPQAlR~~iP~l~nq~i~l~K~SSLa~~Ig~~dl~~~~~~~~~~t~~~---~e~~~i~~~~Yl~isl~iS~~~n~~~rr  391 (398)
                      ++||+++.++|++.+.+...+|+++.+..+|.+|+...+.....++++.   .....+.++.++++++....+.+++|||
T Consensus       138 ~lP~~~p~i~~~~~~~~~~~~~~~~~~~~ig~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~l~~~l~~~~~rR  217 (217)
T 3dhw_A          138 LLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK  217 (217)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHCCSTTCCHHHHHHHHHHHSSCCTTHHHHHHHHHHHHHHHHHHHCC---------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             09976999999999999999999999999987599999999999750189999999999999999999999999985699



>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure