254780177

254780177

lipoyltransferase

GeneID in NCBI database:8209157Locus tag:CLIBASIA_00300
Protein GI in NCBI database:254780177Protein Accession:YP_003064590.1
Gene range:+(58120, 58893)Protein Length:257aa
Gene description:lipoyltransferase
COG prediction:[H] Lipoate-protein ligase B
KEGG prediction:lipB; lipoyltransferase (EC:2.3.1.181); K03801 lipoyl(octanoyl) transferase [EC:2.3.1.181]
SEED prediction:Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase
Pathway involved in KEGG:Lipoic acid metabolism [PATH:las00785]
Subsystem involved in SEED:Lipoic acid metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEYANINDVISTKQSEKK
cccccccccEEEEEcccccccEEEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEEcccHHcccccccHHHHccccccEEEEEccccEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccEEcccccEEEEccccccccccccccccEEEEEEEEEcccEEEEEEEEccccccHHHccccccccccccEEEHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccc
cccccHHHHccccccccccccHEEEEcccccccHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccHHHccccccccEEEEccccEEEEcccccEEEEEEEEHHHccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccccccccccccHHHHHHHcEEEEccEEEcEEEEcccccccccccccccccccccEEEHHHccccccHHHHHHHHHHHHHHHccccEEEccccccccEcccccccc
mellsrnalntsmfpmenispirwwvmdnpvdyeesQIIMEREIQRISLGNAEELVWLlehpplytsgtsaisddllspkslpvyttgrgggytyhgpgQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGivgerredRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHglslnispdlsyytgivpcgisqhgvTSLKELGYSYSMKYIDTLIRKSfesvfgptilheyanINDVIstkqsekk
mellsrnalntsmfpmenispirWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGtsaisddllspKSLPVYTTGRgggytyhgpgQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTlkilgivgerredrvgiwvvrlnktrdnqllLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILheyanindvistkqsekk
MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVyttgrgggytyhgpgQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEYANINDVISTKQSEKK
******************ISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEY***************
MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEYANINDVI********
******NALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEYANINDV*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEYANINDVISTKQSEKK
MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEYANINDVISTKQSEKK
MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEYANINDVISTKQSEKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target257 lipoyltransferase [Candidatus Liberibacter asiaticus st
315122776232 lipoyltransferase [Candidatus Liberibacter solanacearum 1 1e-103
222086076238 lipoyltransferase [Agrobacterium radiobacter K84] Lengt 1 5e-77
23500333267 lipoate-protein ligase B [Brucella suis 1330] Length = 1 1e-76
306838999252 lipoate-protein ligase B [Brucella sp. NF 2653] Length 1 1e-76
254720424267 lipoyltransferase [Brucella sp. 83/13] Length = 267 1 1e-76
37079867268 RecName: Full=Octanoyltransferase; AltName: Full=Lipoat 1 2e-76
294853614252 octanoyltransferase [Brucella sp. NVSL 07-0026] Length 1 2e-76
148558670267 lipoate-protein ligase B [Brucella ovis ATCC 25840] Len 1 2e-76
225629083267 lipoate-protein ligase B [Brucella ceti str. Cudo] Leng 1 2e-76
254711142267 lipoyltransferase [Brucella pinnipedialis B2/94] Length 1 2e-76
>gi|315122776|ref|YP_004063265.1| lipoyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 232 Back     alignment and organism information
 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 206/230 (89%)

Query: 13  MFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAI 72
           MFP+E++ P+RWWV + P+ YE+ Q+IMERE+QRI+LG +EELVW+LEHPPLYTSGTSA 
Sbjct: 1   MFPVESLPPVRWWVTNYPMSYEKCQMIMEREVQRIALGKSEELVWVLEHPPLYTSGTSAN 60

Query: 73  SDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLK 132
           S DL+SP+  PVY TGRGGGYTYHGPGQRI+Y+MLNLAKR+KDLRCFVAALEEVII TL 
Sbjct: 61  SHDLVSPERFPVYNTGRGGGYTYHGPGQRIVYLMLNLAKRQKDLRCFVAALEEVIICTLN 120

Query: 133 ILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLS 192
            LGI+GERREDR+GIWVVR +KT   +  L E+KIAAIGIRIRKWISFHG SLNISPDLS
Sbjct: 121 KLGIIGERREDRIGIWVVRSDKTIAGKQCLAEDKIAAIGIRIRKWISFHGFSLNISPDLS 180

Query: 193 YYTGIVPCGISQHGVTSLKELGYSYSMKYIDTLIRKSFESVFGPTILHEY 242
           +Y+GI+PCGI+QHGVTSLKELG+ YS +YIDTLIR+SFES+FGPTILHE+
Sbjct: 181 HYSGIIPCGINQHGVTSLKELGHFYSTQYIDTLIRESFESIFGPTILHEF 230


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086076|ref|YP_002544608.1| lipoyltransferase [Agrobacterium radiobacter K84] Length = 238 Back     alignment and organism information
>gi|23500333|ref|NP_699773.1| lipoate-protein ligase B [Brucella suis 1330] Length = 267 Back     alignment and organism information
>gi|306838999|ref|ZP_07471820.1| lipoate-protein ligase B [Brucella sp. NF 2653] Length = 252 Back     alignment and organism information
>gi|254720424|ref|ZP_05182235.1| lipoyltransferase [Brucella sp. 83/13] Length = 267 Back     alignment and organism information
>gi|37079867|sp|Q8UF44|LIPB_AGRT5 RecName: Full=Octanoyltransferase; AltName: Full=Lipoate-protein ligase B; AltName: Full=Lipoyl/octanoyl transferase; AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase Length = 268 Back     alignment and organism information
>gi|294853614|ref|ZP_06794286.1| octanoyltransferase [Brucella sp. NVSL 07-0026] Length = 252 Back     alignment and organism information
>gi|148558670|ref|YP_001257577.1| lipoate-protein ligase B [Brucella ovis ATCC 25840] Length = 267 Back     alignment and organism information
>gi|225629083|ref|ZP_03787116.1| lipoate-protein ligase B [Brucella ceti str. Cudo] Length = 267 Back     alignment and organism information
>gi|254711142|ref|ZP_05172953.1| lipoyltransferase [Brucella pinnipedialis B2/94] Length = 267 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target257 lipoyltransferase [Candidatus Liberibacter asiaticus st
PRK14341213 PRK14341, PRK14341, lipoate-protein ligase B; Provision 8e-98
PRK14347209 PRK14347, PRK14347, lipoate-protein ligase B; Provision 1e-49
PRK14345234 PRK14345, PRK14345, lipoate-protein ligase B; Provision 8e-37
PRK14344223 PRK14344, PRK14344, lipoate-protein ligase B; Provision 1e-33
PRK14349220 PRK14349, PRK14349, lipoate-protein ligase B; Provision 9e-29
KOG0325226 KOG0325, KOG0325, KOG0325, Lipoyltransferase [Energy pr 1e-26
COG0321221 COG0321, LipB, Lipoate-protein ligase B [Coenzyme metab 6e-66
TIGR00214184 TIGR00214, lipB, lipoate-protein ligase B 3e-41
PRK14342213 PRK14342, PRK14342, lipoate-protein ligase B; Provision 4e-36
PRK14348221 PRK14348, PRK14348, lipoate-protein ligase B; Provision 1e-25
PRK14343235 PRK14343, PRK14343, lipoate-protein ligase B; Provision 4e-31
PRK14346230 PRK14346, PRK14346, lipoate-protein ligase B; Provision 8e-30
pfam03099124 pfam03099, BPL_LplA_LipB, Biotin/lipoate A/B protein li 1e-10
>gnl|CDD|184635 PRK14341, PRK14341, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|172823 PRK14347, PRK14347, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|184638 PRK14345, PRK14345, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|172820 PRK14344, PRK14344, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|172825 PRK14349, PRK14349, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|35546 KOG0325, KOG0325, KOG0325, Lipoyltransferase [Energy production and conversion, Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|30669 COG0321, LipB, Lipoate-protein ligase B [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|161768 TIGR00214, lipB, lipoate-protein ligase B Back     alignment and domain information
>gnl|CDD|184636 PRK14342, PRK14342, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|172824 PRK14348, PRK14348, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|184637 PRK14343, PRK14343, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|184639 PRK14346, PRK14346, lipoate-protein ligase B; Provisional Back     alignment and domain information
>gnl|CDD|145963 pfam03099, BPL_LplA_LipB, Biotin/lipoate A/B protein ligase family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 257 lipoyltransferase [Candidatus Liberibacter asiaticus st
PRK00008212 lipB lipoyltransferase; Reviewed 100.0
COG0321221 LipB Lipoate-protein ligase B [Coenzyme metabolism] 100.0
KOG0325226 consensus 100.0
TIGR00214220 lipB lipoyltransferase; InterPro: IPR000544 Lipoate-pro 99.97
PRK03822 338 lplA lipoate-protein ligase A; Provisional 99.17
COG0095248 LplA Lipoate-protein ligase A [Coenzyme metabolism] 99.11
KOG3159336 consensus 97.41
PRK05935190 biotin--protein ligase; Provisional 97.96
COG0340238 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme m 96.94
PRK08330236 biotin--protein ligase; Provisional 96.76
PRK11886319 biotin--protein ligase; Provisional 95.34
pfam03099124 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family. 97.1
KOG0325226 consensus 95.81
>PRK00008 lipB lipoyltransferase; Reviewed Back     alignment and domain information
>COG0321 LipB Lipoate-protein ligase B [Coenzyme metabolism] Back     alignment and domain information
>KOG0325 consensus Back     alignment and domain information
>TIGR00214 lipB lipoyltransferase; InterPro: IPR000544 Lipoate-protein ligase B (gene lipB) is the bacterial enzyme that creates an amide linkage that joins the free carboxyl group of lipoic acid to the epsilon-amino group of a specific lysine residue in lipoate-dependent enzymes Back     alignment and domain information
>PRK03822 lplA lipoate-protein ligase A; Provisional Back     alignment and domain information
>COG0095 LplA Lipoate-protein ligase A [Coenzyme metabolism] Back     alignment and domain information
>KOG3159 consensus Back     alignment and domain information
>PRK05935 biotin--protein ligase; Provisional Back     alignment and domain information
>COG0340 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism] Back     alignment and domain information
>PRK08330 biotin--protein ligase; Provisional Back     alignment and domain information
>PRK11886 biotin--protein ligase; Provisional Back     alignment and domain information
>pfam03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family Back     alignment and domain information
>KOG0325 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target257 lipoyltransferase [Candidatus Liberibacter asiaticus st
2qhs_A237 Structural Basis Of Octanoic Acid Recognition By Li 7e-46
2qht_A210 Structural Basis Of Octanoic Acid Recognition By Li 4e-45
1w66_A232 Structure Of A Lipoate-Protein Ligase B From Mycoba 3e-41
>gi|168988691|pdb|2QHS|A Chain A, Structural Basis Of Octanoic Acid Recognition By Lipoate- Protein Ligase B Length = 237 Back     alignment and structure
 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 74/232 (31%), Positives = 114/232 (49%), Gaps = 24/232 (10%)

Query: 17  ENISPIRWWVMD-NPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDD 75
              S + + V D   V Y E+    +R  + +  GN    + LLEHP + T G  A  ++
Sbjct: 16  PRGSHMEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGEN 75

Query: 76  LLSP------KSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIR 129
           LL P          +Y   RGG  TYHGPGQ + Y +  +    +++R F+  +EE I+R
Sbjct: 76  LLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVG---REVRRFLRQIEEAIVR 132

Query: 130 TLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISP 189
                GI         G+WV              E+K+ AIG+ +++ +SFHG +LN++ 
Sbjct: 133 VAAGYGISAYPTPGYAGVWV-------------GEDKLCAIGVAVKEGVSFHGFALNVNT 179

Query: 190 DLSYYTGIVPCGISQHGVTSLKE-LGYSYSMKYIDTLIRKSFESVFGPTILH 240
           DL+ +T IVPCG+   GVTSL++ LG    M+     +  +F  VFG   + 
Sbjct: 180 DLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPVE 231


>gi|168988692|pdb|2QHT|A Chain A, Structural Basis Of Octanoic Acid Recognition By Lipoate- Protein Ligase B Length = 210 Back     alignment and structure
>gi|85543880|pdb|1W66|A Chain A, Structure Of A Lipoate-Protein Ligase B From Mycobacterium Tuberculosis Length = 232 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target257 lipoyltransferase [Candidatus Liberibacter asiaticus st
2qhs_A237 Lipoyltransferase; globular protein; HET: OCA; 1.50A {T 2e-34
1w66_A232 Lipoyltransferase; lipoate-protein ligase B, lipoic aci 5e-32
2c8m_A262 Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A 2e-18
3a7r_A 337 Lipoate-protein ligase A; adenylate-forming enzyme, lip 7e-14
1vqz_A341 Lipoate-protein ligase, putative; NP_345629.1, structur 3e-10
2p0l_A288 Lipoate-protein ligase A; PFAM, lopoate-protein ligase 9e-06
2p5i_A288 BH3822 protein; PFAM03099, structural genomics, PSI-2, 7e-07
2e5a_A 347 Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10 8e-07
>2qhs_A Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus HB8} PDB: 2qht_A 2qhu_A 2qhv_A Length = 237 Back     alignment and structure
 Score =  141 bits (355), Expect = 2e-34
 Identities = 71/212 (33%), Positives = 106/212 (50%), Gaps = 23/212 (10%)

Query: 31  VDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSP------KSLPV 84
           V Y E+    +R  + +  GN    + LLEHP + T G  A  ++LL P          +
Sbjct: 31  VPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFEL 90

Query: 85  YTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDR 144
           Y   RGG  TYHGPGQ + Y +  +    +++R F+  +EE I+R     GI        
Sbjct: 91  YWVERGGDVTYHGPGQLVGYPIFPV---GREVRRFLRQIEEAIVRVAAGYGISAYPTPGY 147

Query: 145 VGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQ 204
            G+WV               +K+ AIG+ +++ +SFHG +LN++ DL+ +T IVPCG+  
Sbjct: 148 AGVWVGE-------------DKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKG 194

Query: 205 HGVTSL-KELGYSYSMKYIDTLIRKSFESVFG 235
            GVTSL K LG    M+     +  +F  VFG
Sbjct: 195 KGVTSLEKLLGRKVPMEEAKARVVAAFAEVFG 226


>1w66_A Lipoyltransferase; lipoate-protein ligase B, lipoic acid, acyltransferase, mycobacterium tuberculosis structural proteomics project; HET: DKA; 1.08A {Mycobacterium tuberculosis} SCOP: d.104.1.3 Length = 232 Back     alignment and structure
>2c8m_A Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A {Thermoplasma acidophilum} SCOP: d.104.1.3 PDB: 2art_A* 2aru_A* 2c7i_A 2ars_A* Length = 262 Back     alignment and structure
>3a7r_A Lipoate-protein ligase A; adenylate-forming enzyme, lipoic acid, ATP-binding, cytoplasm, nucleotide-binding, transferase, lipoyl; HET: LAQ; 2.05A {Escherichia coli} PDB: 1x2h_A* 3a7a_A* 1x2g_A* Length = 337 Back     alignment and structure
>1vqz_A Lipoate-protein ligase, putative; NP_345629.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.99A {Streptococcus pneumoniae TIGR4} SCOP: d.224.1.3 d.104.1.3 Length = 341 Back     alignment and structure
>2p0l_A Lipoate-protein ligase A; PFAM, lopoate-protein ligase A, structural genomics, protein structure initiative, PSI-2; 2.04A {Streptococcus agalactiae COH1} SCOP: d.104.1.3 Length = 288 Back     alignment and structure
>2p5i_A BH3822 protein; PFAM03099, structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.21A {Bacillus halodurans c-125} SCOP: d.104.1.3 Length = 288 Back     alignment and structure
>2e5a_A Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10A {Bos taurus} Length = 347 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target257 lipoyltransferase [Candidatus Liberibacter asiaticus st
2qhs_A237 Lipoyltransferase; globular protein; HET: OCA; 1.50A {T 100.0
1w66_A232 Lipoyltransferase; lipoate-protein ligase B, lipoic aci 100.0
2c8m_A262 Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A 99.92
2p5i_A288 BH3822 protein; PFAM03099, structural genomics, PSI-2, 99.85
2p0l_A288 Lipoate-protein ligase A; PFAM, lopoate-protein ligase 99.79
3a7r_A 337 Lipoate-protein ligase A; adenylate-forming enzyme, lip 99.79
1vqz_A341 Lipoate-protein ligase, putative; NP_345629.1, structur 99.76
2e5a_A 347 Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10 99.72
2dxu_A235 Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynt 97.03
2eay_A233 Biotin [acetyl-COA-carboxylase] ligase; biotin biosynth 94.02
1bia_A321 BIRA bifunctional protein; transcription regulation; 2. 93.96
2cgh_A268 Biotin ligase; 1.8A {Mycobacterium tuberculosis} PDB: 3 93.37
2ej9_A237 Putative biotin ligase; biotin biosynthesis, monomer, X 92.68
>2qhs_A Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus HB8} PDB: 2qht_A 2qhu_A 2qhv_A Back     alignment and structure
Probab=100.00  E-value=0  Score=480.87  Aligned_cols=209  Identities=33%  Similarity=0.604  Sum_probs=193.5

Q ss_pred             CEEEEE-ECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCEEEECCCCCHHHHC------CCCCCEEEEECCCCEE
Q ss_conf             238998-088858899999999999999739978789998068737743478855610------5478249980566707
Q gi|254780177|r   21 PIRWWV-MDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLL------SPKSLPVYTTGRGGGY   93 (257)
Q Consensus        21 ~ie~~~-~~G~v~Y~~al~~q~~~~~~v~~~~~~d~l~llEH~pVyT~G~~~~~~dll------~~~~ipv~~t~RGG~i   93 (257)
                      ++++++ ..|++||+++|++|+++++++.++..+|+||+||||||||+|++++++|++      ...++||++|+|||++
T Consensus        20 ~~~~~v~dLG~i~Y~~a~~~Q~~l~~~~~~~~~~d~llllEH~pVyT~Gr~~~~~~ll~~~~~l~~~~i~v~~t~RGG~i   99 (237)
T 2qhs_A           20 HMEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDV   99 (237)
T ss_dssp             -CEEEEEEEEECCHHHHHHHHHHHHHHHHTTCSCCEEEEEECSSEEEECTTCCGGGBSSCHHHHHHTTCEEEECCSSSSE
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCEECCCCCCCCCCCCCHHHHHCCCCCEEEECCCCCE
T ss_conf             97179977898688999999999999996699998699980798376777887443458866752479867994799716


Q ss_pred             EEECCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCEEHHEE
Q ss_conf             86078924777651210012038999999999999998862885324588721674166766655565642101000000
Q gi|254780177|r   94 TYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIR  173 (257)
Q Consensus        94 TyHGPGQlV~Ypii~L~~~~~~v~~yv~~lE~~ii~~l~~~gI~~~~~~~~~GVWV~~~~~~~~~~~~~~~~KIasIGi~  173 (257)
                      |||||||||+|||+||++   ++++|++.||+++|++|++|||++.++++.+|||+++             +||||||++
T Consensus       100 TyHGPGQLV~YpIl~L~~---~~~~~v~~le~~ii~~l~~~gi~~~~~~~~~GVwv~~-------------~KIasIGi~  163 (237)
T 2qhs_A          100 TYHGPGQLVGYPIFPVGR---EVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGE-------------DKLCAIGVA  163 (237)
T ss_dssp             EEECTTEEEEEEECCCTT---CHHHHHHHHHHHHHHHHHHTTCCCBCCSSSSSEEETT-------------EEEEEEEEE
T ss_pred             EEECCCCEEEEEHHHHHH---HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCH-------------HHHHHHHHH
T ss_conf             898999667777465553---2999999999999999986266411336777634402-------------159999987


Q ss_pred             CCCCEEEEEEEEEECCCCHHHCCEEECCCCCCCCCCHHH-HCCCCCHHHHHHHHHHHHHHHHCHHHHCHHHCCCH
Q ss_conf             048889988999954991351734105679785212899-18988999999999999998746111023312421
Q gi|254780177|r  174 IRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKE-LGYSYSMKYIDTLIRKSFESVFGPTILHEYANIND  247 (257)
Q Consensus       174 i~~~vT~HG~alNv~~dL~~F~~IvPCGl~~~~vTSl~~-lg~~i~~~ev~~~l~~~f~~~Fg~~~~~~~~~~~d  247 (257)
                      ++|||||||||||||+||++|+.|+|||+++..||||++ +|.+++++++++.++++|++.||...++  .+++|
T Consensus       164 v~r~vt~HG~aLNV~~dL~~F~~IvpCGl~~~~vTSL~~elg~~~~~~ev~~~l~~~f~~~Fg~~~ve--~s~~e  236 (237)
T 2qhs_A          164 VKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPVE--GSVHE  236 (237)
T ss_dssp             EETTEEEEEEEEESSCCGGGGGGBCCCSSCCSEECCHHHHHTSCCCHHHHHHHHHHHHHHHHTCEEC--------
T ss_pred             HCCCEEECCEEEECCCCHHHHCCEEECCCCCCCEEEHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEC--CCCCC
T ss_conf             24755832268971698277073783688998372469976899999999999999999986996003--65567



>1w66_A Lipoyltransferase; lipoate-protein ligase B, lipoic acid, acyltransferase, mycobacterium tuberculosis structural proteomics project; HET: DKA; 1.08A {Mycobacterium tuberculosis} SCOP: d.104.1.3 Back     alignment and structure
>2c8m_A Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A {Thermoplasma acidophilum} SCOP: d.104.1.3 PDB: 2art_A* 2aru_A* 2c7i_A 2ars_A* Back     alignment and structure
>2p5i_A BH3822 protein; PFAM03099, structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.21A {Bacillus halodurans c-125} SCOP: d.104.1.3 Back     alignment and structure
>2p0l_A Lipoate-protein ligase A; PFAM, lopoate-protein ligase A, structural genomics, protein structure initiative, PSI-2; 2.04A {Streptococcus agalactiae COH1} SCOP: d.104.1.3 Back     alignment and structure
>3a7r_A Lipoate-protein ligase A; adenylate-forming enzyme, lipoic acid, ATP-binding, cytoplasm, nucleotide-binding, transferase, lipoyl; HET: LAQ; 2.05A {Escherichia coli} PDB: 1x2h_A* 3a7a_A* 1x2g_A* Back     alignment and structure
>1vqz_A Lipoate-protein ligase, putative; NP_345629.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.99A {Streptococcus pneumoniae TIGR4} SCOP: d.224.1.3 d.104.1.3 Back     alignment and structure
>2e5a_A Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10A {Bos taurus} PDB: 3a7u_A Back     alignment and structure
>2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Back     alignment and structure
>2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>2cgh_A Biotin ligase; 1.8A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A Back     alignment and structure
>2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 257 lipoyltransferase [Candidatus Liberibacter asiaticus st
d1w66a1216 d.104.1.3 (A:1-216) Lipoyltransferase LipB {Mycobacteri 3e-31
d2c8ma1256 d.104.1.3 (A:1-256) Lipoate-protein ligase A {Thermopla 1e-19
d2p0la1269 d.104.1.3 (A:4-272) Lipoate-protein ligase A {Streptoco 1e-14
d2p5ia1265 d.104.1.3 (A:14-278) Hypothetical protein BH3822 {Bacil 5e-11
d1x2ga2246 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain 2e-15
d1vqza2241 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-termina 5e-14
>d1w66a1 d.104.1.3 (A:1-216) Lipoyltransferase LipB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 216 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: LplA-like
domain: Lipoyltransferase LipB
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score =  129 bits (324), Expect = 3e-31
 Identities = 67/231 (29%), Positives = 110/231 (47%), Gaps = 21/231 (9%)

Query: 9   LNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSG 68
           + + +  ++    +R       VDY  +  +          G A+ L  LLEHP +YT+G
Sbjct: 5   IRSKLSAID----VRQL---GTVDYRTAWQLQRELADARVAGGADTL-LLLEHPAVYTAG 56

Query: 69  TSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFVAALEEVII 128
               + +     + PV  T RGG  T+HGPGQ + Y ++ L     D+  +V  LEE +I
Sbjct: 57  RRTETHERPIDGT-PVVDTDRGGKITWHGPGQLVGYPIIGL-AEPLDVVNYVRRLEESLI 114

Query: 129 RTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISFHGLSLNIS 188
           +    LG+   R + R G+W+      +          +AAIG+R+ +  + HG +LN  
Sbjct: 115 QVCADLGLHAGRVDGRSGVWLPGRPARK----------VAAIGVRVSRATTLHGFALNCD 164

Query: 189 PDLSYYTGIVPCGISQHGVTSL-KELGYSYSMKYIDTLIRKSFESVFGPTI 238
            DL+ +T IVPCGIS   VTSL  ELG + ++  +   +  +  +     +
Sbjct: 165 CDLAAFTAIVPCGISDAAVTSLSAELGRTVTVDEVRATVAAAVCAALDGVL 215


>d2c8ma1 d.104.1.3 (A:1-256) Lipoate-protein ligase A {Thermoplasma acidophilum [TaxId: 2303]} Length = 256 Back     information, alignment and structure
>d2p0la1 d.104.1.3 (A:4-272) Lipoate-protein ligase A {Streptococcus agalactiae [TaxId: 1311]} Length = 269 Back     information, alignment and structure
>d2p5ia1 d.104.1.3 (A:14-278) Hypothetical protein BH3822 {Bacillus halodurans [TaxId: 86665]} Length = 265 Back     information, alignment and structure
>d1x2ga2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 246 Back     information, alignment and structure
>d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 241 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target257 lipoyltransferase [Candidatus Liberibacter asiaticus st
d1w66a1216 Lipoyltransferase LipB {Mycobacterium tuberculosis [Tax 100.0
d2p0la1269 Lipoate-protein ligase A {Streptococcus agalactiae [Tax 99.93
d2c8ma1256 Lipoate-protein ligase A {Thermoplasma acidophilum [Tax 99.92
d2p5ia1265 Hypothetical protein BH3822 {Bacillus halodurans [TaxId 99.9
d1x2ga2246 Two-domain LplA, N-terminal domain {Escherichia coli [T 99.9
d1vqza2241 LplA-like protein SP1160, N-terminal domain {Streptococ 99.89
d2zgwa2188 Biotin--[acetyl-CoA-carboxylase] ligase catalytic domai 97.89
d1biaa3207 Biotin repressor/biotin holoenzyme synthetase, catalyti 96.39
>d1w66a1 d.104.1.3 (A:1-216) Lipoyltransferase LipB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: LplA-like
domain: Lipoyltransferase LipB
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00  E-value=0  Score=474.73  Aligned_cols=207  Identities=33%  Similarity=0.543  Sum_probs=190.6

Q ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCEEEECCCCCHHHHCCCCCCEEEEECCCCEEEEE
Q ss_conf             78972389980888588999999999999997399787899980687377434788556105478249980566707860
Q gi|254780177|r   17 ENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYH   96 (257)
Q Consensus        17 ~~~~~ie~~~~~G~v~Y~~al~~q~~~~~~v~~~~~~d~l~llEH~pVyT~G~~~~~~dll~~~~ipv~~t~RGG~iTyH   96 (257)
                      ..+.+|+++ ..|++||+++|++|+++++++.++. +|+|||||||||||+|++++.++++. .++||++|+|||++|||
T Consensus         7 ~~~~~i~i~-~LG~v~Y~~a~~~q~~~~~~~~~~~-~d~llllEH~pVyT~G~~~~~~~~~~-~~i~v~~tdRGG~vTyH   83 (216)
T d1w66a1           7 SKLSAIDVR-QLGTVDYRTAWQLQRELADARVAGG-ADTLLLLEHPAVYTAGRRTETHERPI-DGTPVVDTDRGGKITWH   83 (216)
T ss_dssp             SCCSCCEEE-EEEECCHHHHHHHHHHHHHHHHTTC-CCEEEEEECCSEEEECTTCCGGGSCT-TCCCCEECSSSSSEEEE
T ss_pred             HCCCCEEEE-ECCCCCHHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCEEECCCCCCCCCCC-CCCCEEECCCCCEEEEE
T ss_conf             218943798-8896088999999999999984799-88599994588356056676654544-11002442788527774


Q ss_pred             CCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCEEHHEECCC
Q ss_conf             78924777651210012038999999999999998862885324588721674166766655565642101000000048
Q gi|254780177|r   97 GPGQRIIYIMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRK  176 (257)
Q Consensus        97 GPGQlV~Ypii~L~~~~~~v~~yv~~lE~~ii~~l~~~gI~~~~~~~~~GVWV~~~~~~~~~~~~~~~~KIasIGi~i~~  176 (257)
                      ||||||+|||+||++ ..++++|++.||+++|++|++|||++.+++++|||||++.          .++||||||++++|
T Consensus        84 GPGQlV~Ypil~l~~-~~~~~~~v~~le~~ii~~l~~~gi~~~~~~~~~GVwv~~~----------~~~KIasiGv~v~~  152 (216)
T d1w66a1          84 GPGQLVGYPIIGLAE-PLDVVNYVRRLEESLIQVCADLGLHAGRVDGRSGVWLPGR----------PARKVAAIGVRVSR  152 (216)
T ss_dssp             CTTEEEEEEECBBCS-SCCHHHHHHHHHHHHHHHHHHTTCCCEEETTEEEEEECSS----------SCEEEEEEEEEEET
T ss_pred             CCCCEEEEEEECCCC-CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECC----------HHHHHHHHHHHHCC
T ss_conf             377456677761211-2213566777889999998751442112246775012110----------15678899977503


Q ss_pred             CEEEEEEEEEECCCCHHHCCEEECCCCCCCCCCHH-HHCCCCCHHHHHHHHHHHHHHHHCHH
Q ss_conf             88998899995499135173410567978521289-91898899999999999999874611
Q gi|254780177|r  177 WISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLK-ELGYSYSMKYIDTLIRKSFESVFGPT  237 (257)
Q Consensus       177 ~vT~HG~alNv~~dL~~F~~IvPCGl~~~~vTSl~-~lg~~i~~~ev~~~l~~~f~~~Fg~~  237 (257)
                      ||||||||||||+||++|+.|+|||+++..||||+ ++|.+++++|+++.++++|.+.|...
T Consensus       153 ~vt~HG~alNv~~dL~~f~~I~pCGl~~~~vtSl~~~lg~~v~~~ev~~~l~~~~~~~f~~~  214 (216)
T d1w66a1         153 ATTLHGFALNCDCDLAAFTAIVPCGISDAAVTSLSAELGRTVTVDEVRATVAAAVCAALDGV  214 (216)
T ss_dssp             TEEEEEEEEESSCCCGGGGGSCGGGCSSSEECCHHHHHTSCCCHHHHHHHHHHHHHHHHTTC
T ss_pred             CEEECCEEEECCCCHHHCCEEECCCCCCCCEEEEHHHHCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             62521357852577554690785799999266417996899989999999999999986111



>d2p0la1 d.104.1.3 (A:4-272) Lipoate-protein ligase A {Streptococcus agalactiae [TaxId: 1311]} Back     information, alignment and structure
>d2c8ma1 d.104.1.3 (A:1-256) Lipoate-protein ligase A {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2p5ia1 d.104.1.3 (A:14-278) Hypothetical protein BH3822 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1x2ga2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2zgwa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1biaa3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 257 lipoyltransferase [Candidatus Liberibacter asiatic
2p5i_A_288 (A:) BH3822 protein; PFAM03099, structural genomic 1e-36
2p0l_A_288 (A:) Lipoate-protein ligase A; PFAM, lopoate-prote 1e-35
1w66_A_232 (A:) Lipoyltransferase; lipoate-protein ligase B, 2e-34
2c8m_A_262 (A:) Lipoate-protein ligase A; lipoylation; HET: L 4e-33
2e5a_A_1-246246 (A:1-246) Lipoyltransferase 1; lipoyl-AMP, ligase; 8e-33
2qhs_A_237 (A:) Lipoyltransferase; globular protein; HET: OCA 1e-31
3a7r_A_1-244244 (A:1-244) Lipoate-protein ligase A; adenylate-form 2e-29
2dxu_A_1-187187 (A:1-187) Biotin--[acetyl-COA-carboxylase] ligase; 3e-20
1vqz_A_1-49_92-251209 (A:1-49,A:92-251) Lipoate-protein ligase, putative 1e-06
2ej9_A_1-191191 (A:1-191) Putative biotin ligase; biotin biosynthe 2e-05
>2p5i_A (A:) BH3822 protein; PFAM03099, structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.21A {Bacillus halodurans c-125}Length = 288 Back     alignment and structure
 Score =  147 bits (372), Expect = 1e-36
 Identities = 25/276 (9%), Positives = 60/276 (21%), Gaps = 36/276 (13%)

Query: 8   ALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTS 67
           +L       +    +            +S    +     I    +   +    H      
Sbjct: 4   SLLLQQHLSQPWRFLDHTSFGPTFQALQSFAYDDTLCTSIGKSQSPPTLRAWVHHNTVVL 63

Query: 68  GTSAISDDLLSP-------KSLPVYTTGRGGGYTYHGPGQRIIYIMLNLAKRRKDLRCFV 120
           G        +             V     GG       G   + ++L   ++   +    
Sbjct: 64  GIQDSRLPQIKAGIEALKGFQHDVIVRNSGGLAVVLDSGILNLSLVLKE-EKGFSIDDGY 122

Query: 121 AALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLIEEKIAAIGIRIRKWISF 180
               E+I    +      E RE          + + D +      K A I  R  +    
Sbjct: 123 ELXYELICSXFQDHREQIEAREIVGSYCPGSYDLSIDGK------KFAGISQRRIRGGVA 176

Query: 181 HGLSLNISPDLSYYTG----IVPCGISQHGVTSLK-------------ELGYSYSMKYID 223
             + L +S   +             ++      +               LG  +++  + 
Sbjct: 177 VQIYLCVSGSGAERAKXIRTFYDKAVAGQPTKFVYPRIKPETXASLSELLGQPHNVSDVL 236

Query: 224 TLIRKSFESVFGPTILH-----EYANINDVISTKQS 254
                + +      +       E+       +    
Sbjct: 237 LKALXTLQQHGASLLTESLSADEWLLYEQHFARISE 272


>2p0l_A (A:) Lipoate-protein ligase A; PFAM, lopoate-protein ligase A, structural genomics, protein structure initiative, PSI-2; 2.04A {Streptococcus agalactiae COH1}Length = 288 Back     alignment and structure
>1w66_A (A:) Lipoyltransferase; lipoate-protein ligase B, lipoic acid, acyltransferase, mycobacterium tuberculosis structural proteomics project; HET: DKA; 1.08A {Mycobacterium tuberculosis}Length = 232 Back     alignment and structure
>2c8m_A (A:) Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A {Thermoplasma acidophilum}Length = 262 Back     alignment and structure
>2e5a_A (A:1-246) Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10A {Bos taurus}Length = 246 Back     alignment and structure
>2qhs_A (A:) Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus HB8} PDB: 2qht_A 2qhu_A 2qhv_ALength = 237 Back     alignment and structure
>3a7r_A (A:1-244) Lipoate-protein ligase A; adenylate-forming enzyme, lipoic acid, ATP-binding, cytoplasm, nucleotide-binding, transferase, lipoyl; HET: LAQ; 2.05A {Escherichia coli} PDB: 1x2h_A* 3a7a_A* 1x2g_A*Length = 244 Back     alignment and structure
>2dxu_A (A:1-187) Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ...Length = 187 Back     alignment and structure
>1vqz_A (A:1-49,A:92-251) Lipoate-protein ligase, putative; NP_345629.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.99A {Streptococcus pneumoniae TIGR4}Length = 209 Back     alignment and structure
>2ej9_A (A:1-191) Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii}Length = 191 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target257 lipoyltransferase [Candidatus Liberibacter asiaticus st
2p0l_A_288 Lipoate-protein ligase A; PFAM, lopoate-protein li 100.0
2p5i_A_288 BH3822 protein; PFAM03099, structural genomics, PS 100.0
2e5a_A_1-246246 Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 100.0
1w66_A_232 Lipoyltransferase; lipoate-protein ligase B, lipoi 100.0
3a7r_A_1-244244 Lipoate-protein ligase A; adenylate-forming enzyme 100.0
2c8m_A_262 Lipoate-protein ligase A; lipoylation; HET: LPA; 1 100.0
2qhs_A_237 Lipoyltransferase; globular protein; HET: OCA; 1.5 99.97
2dxu_A_1-187187 Biotin--[acetyl-COA-carboxylase] ligase; biotin bi 99.83
1vqz_A_1-49_92-251209 Lipoate-protein ligase, putative; NP_345629.1, str 98.81
2ej9_A_1-191191 Putative biotin ligase; biotin biosynthesis, monom 98.76
3bfm_A_1-191191 Biotin protein ligase-like protein of unknown func 96.58
2cgh_A_1-221221 Biotin ligase; 1.8A {Mycobacterium tuberculosis} ( 96.3
2eay_A_1-185185 Biotin [acetyl-COA-carboxylase] ligase; biotin bio 95.71
1bia_A_65-271207 BIRA bifunctional protein; transcription regulatio 93.97
>2p0l_A (A:) Lipoate-protein ligase A; PFAM, lopoate-protein ligase A, structural genomics, protein structure initiative, PSI-2; 2.04A {Streptococcus agalactiae COH1} Back     alignment and structure
Probab=100.00  E-value=9e-35  Score=245.88  Aligned_cols=227  Identities=13%  Similarity=0.032  Sum_probs=198.5

Q ss_pred             HHCCCCCCCCCEEEEE-ECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCEEEECCCCCHHH-------HCCCCCC
Q ss_conf             1003557897238998-0888588999999999999997399787899980687377434788556-------1054782
Q gi|254780177|r   11 TSMFPMENISPIRWWV-MDNPVDYEESQIIMEREIQRISLGNAEELVWLLEHPPLYTSGTSAISDD-------LLSPKSL   82 (257)
Q Consensus        11 ~~~~p~~~~~~ie~~~-~~G~v~Y~~al~~q~~~~~~v~~~~~~d~l~llEH~pVyT~G~~~~~~d-------ll~~~~i   82 (257)
                      .|.-.++.++...|++ ..|..||...+++++.+.+.+.+++.+++|++.||+|++|+|++.+.++       .+...++
T Consensus         3 ~~~~~~~~~~~~~~~~i~~~~~~~~~~la~d~~ll~~~~~~~~~~~l~~~~~~p~v~lG~~q~~~~~~~~~~~~~~~~gi   82 (288)
T 2p0l_A            3 LEWQDLAQLPVSIFKDYVTDAQDAEKPFIWTEVFLREINRSNQEIILHIWPXTKTVILGXLDRELPHLELAKKEIISRGY   82 (288)
T ss_dssp             -CGGGGTTSCEEEEECCBCSGGGTTHHHHHHHHHHHHHHHSCSCEEEEECCBSSEEEECTTGGGCTTHHHHHHHHHTTTC
T ss_pred             CCHHHHHCCCHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCEEEECCCCCCCCHHHHHHHHHHHCCC
T ss_conf             53776743857888544687546546668999999985157899789996389989989876768119999999998699


Q ss_pred             EEEEECCCCEEEEECCCCEEEEEEECCCC-CCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCC
Q ss_conf             49980566707860789247776512100-12038999999999999998862885324588721674166766655565
Q gi|254780177|r   83 PVYTTGRGGGYTYHGPGQRIIYIMLNLAK-RRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLL  161 (257)
Q Consensus        83 pv~~t~RGG~iTyHGPGQlV~Ypii~L~~-~~~~v~~yv~~lE~~ii~~l~~~gI~~~~~~~~~GVWV~~~~~~~~~~~~  161 (257)
                      ||++..+||++|||+|||++.|+|++... .+.+++.++..++++++++|+.+|+++...+...|+|+.+++      ..
T Consensus        83 ~vvrR~tGGgaV~hd~G~l~~~~i~~~~~~~~~~~~~~~~~~~~~i~~~L~~lGi~a~~~~~~~~~~~~~~d------i~  156 (288)
T 2p0l_A           83 EPVVRNFGGLAVVADEGILNFSLVIPDVFERKLSISDGYLIXVDFIRSIFSDFYQPIEHFEVETSYCPGKFD------LS  156 (288)
T ss_dssp             EEEECTTCCSCEEESTTEEEEEEEEESCC---CCHHHHHHHHHHHHHHHTTTSCSCCEECCCTTSSSCCTTC------EE
T ss_pred             CEEEECCCCCEEEECCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCC------EE
T ss_conf             489964898648977995699999626654678989999999999999999719751773255665788665------78


Q ss_pred             CCCCCCEEHHEECCCCEEEEEEEEEECCCCHH----HCCEEECCCCCCCC------------CCHHH-HCCCCCHHHHHH
Q ss_conf             64210100000004888998899995499135----17341056797852------------12899-189889999999
Q gi|254780177|r  162 LIEEKIAAIGIRIRKWISFHGLSLNISPDLSY----YTGIVPCGISQHGV------------TSLKE-LGYSYSMKYIDT  224 (257)
Q Consensus       162 ~~~~KIasIGi~i~~~vT~HG~alNv~~dL~~----F~~IvPCGl~~~~v------------TSl~~-lg~~i~~~ev~~  224 (257)
                      ...+||+++|.++++++++||.+||+++|++.    |+.|.||++.++.+            ||+.+ ++.+++++++.+
T Consensus       157 ~~g~KI~G~aq~~~~~~~l~~gsl~~~~d~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~v~~  236 (288)
T 2p0l_A          157 INGKKFAGLAQRRIKNGIAVSIYLSVCGDQKGRSQXISDFYKIGLGDTGSPIAYPNVDPEIXANLSDLLDCPXTVEDVID  236 (288)
T ss_dssp             ETTEEEEEEEEEEETTEEEEEEEEECSSCHHHHHHHHHHHHHHHHTTTCCSSCCCCCCTTSBCCHHHHTTCCCCHHHHHH
T ss_pred             ECCEEEEEEEEEEECCEEEEEEEEEEECCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHEEHHHHCCCCCCHHHHHH
T ss_conf             88887899899983893999999999788789889998877640254455434677555552219997399999999999


Q ss_pred             HHHHHHHHHHCHHHHCHHH
Q ss_conf             9999999874611102331
Q gi|254780177|r  225 LIRKSFESVFGPTILHEYA  243 (257)
Q Consensus       225 ~l~~~f~~~Fg~~~~~~~~  243 (257)
                      .+.+.|.+.|+.....+++
T Consensus       237 ~l~~~~~~~~~~~~~~~l~  255 (288)
T 2p0l_A          237 RXLISLKQVGFNDRLLXIR  255 (288)
T ss_dssp             HHHHHHHHHTCCEEECCCC
T ss_pred             HHHHHHHHHCCCCCCCCCC
T ss_conf             9999999865877622069



>2p5i_A (A:) BH3822 protein; PFAM03099, structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.21A {Bacillus halodurans c-125} Back     alignment and structure
>2e5a_A (A:1-246) Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10A {Bos taurus} Back     alignment and structure
>1w66_A (A:) Lipoyltransferase; lipoate-protein ligase B, lipoic acid, acyltransferase, mycobacterium tuberculosis structural proteomics project; HET: DKA; 1.08A {Mycobacterium tuberculosis} Back     alignment and structure
>3a7r_A (A:1-244) Lipoate-protein ligase A; adenylate-forming enzyme, lipoic acid, ATP-binding, cytoplasm, nucleotide-binding, transferase, lipoyl; HET: LAQ; 2.05A {Escherichia coli} PDB: 1x2h_A* 3a7a_A* 1x2g_A* Back     alignment and structure
>2c8m_A (A:) Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A {Thermoplasma acidophilum} Back     alignment and structure
>2qhs_A (A:) Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus HB8} PDB: 2qht_A 2qhu_A 2qhv_A Back     alignment and structure
>2dxu_A (A:1-187) Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Back     alignment and structure
>1vqz_A (A:1-49,A:92-251) Lipoate-protein ligase, putative; NP_345629.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.99A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>2ej9_A (A:1-191) Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bfm_A (A:1-191) Biotin protein ligase-like protein of unknown function; YP_612389.1, structural genomics, joint center for structural genomics, JCSG; HET: 2PE; 1.70A {Silicibacter SP} Back     alignment and structure
>2cgh_A (A:1-221) Biotin ligase; 1.8A {Mycobacterium tuberculosis} Back     alignment and structure
>2eay_A (A:1-185) Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Back     alignment and structure
>1bia_A (A:65-271) BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} Back     alignment and structure