254780178

254780178

queuine tRNA-ribosyltransferase

GeneID in NCBI database:8209158Locus tag:CLIBASIA_00305
Protein GI in NCBI database:254780178Protein Accession:YP_003064591.1
Gene range:-(58960, 60096)Protein Length:378aa
Gene description:queuine tRNA-ribosyltransferase
COG prediction:[J] Queuine/archaeosine tRNA-ribosyltransferase
KEGG prediction:tgt; queuine tRNA-ribosyltransferase (EC:2.4.2.29); K00773 queuine tRNA-ribosyltransferase [EC:2.4.2.29]
SEED prediction:tRNA-guanine transglycosylase (EC 2.4.2.29)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Queuosine-Archaeosine Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MDKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIPPIFT
cccccEEEEEccccccEEEEEEEccEEEEcccccccccHHHcccccHHHHHHccccEEEccEEEEcccccHHHHHHHccHHHHHcccccEEEccccccccHHHHcccccccccEEEEcccccEEEEcHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHccccEEEccHHHHcccccEEEEccccEEEEHHHHHccccccccccccHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccc
cccccEEEEEEEEccEEEEEEEEccEEEEEcEEEcEEcccccccccHHHHHHcccccEEEcHHHHHHcccHHHHHHcccHHHHHcccccEEEcccHHHHHHHcEEEEEccccEEEEccccccEEEEcHHHHHHHHHHHcccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHEEEEEcccccHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHccccccEEEccEccHHHHHHHHHccccEEEccHHHHHHHHcEEccccccEEcccHHHcccccccccccccHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccc
mdknfhfnlkavsgsarlgeiitprgviktpafmpvgtagtvKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWfkpiltdsggfQVMSLSKLcsideqgvrfrshidgslyrvspeeSVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAfgnqpgkalfgivqggdninlrSFSAERLKELdlkgyaigglavgepQEVMLHILSNvlpilpverphylmgvgtpddILKSVSYgvdmfdcvmptragrhglaftrfgkinlrnarhiddmrpldaeshCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTqenwkkgdippift
MDKNFHFNLkavsgsarlgeiitprgviktpafmpVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQtqenwkkgdippift
MDKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIPPIFT
***NFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLV****QPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGD*PPI**
MDKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIPPIFT
*DKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIPPIFT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIPPIFT
MDKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIPPIFT
MDKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIPPIFT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
315122777377 queuine tRNA-ribosyltransferase [Candidatus Liberibacte 1 0.0
15965339376 queuine tRNA-ribosyltransferase [Sinorhizobium meliloti 1 1e-165
218661100376 queuine tRNA-ribosyltransferase [Rhizobium etli IE4771] 1 1e-164
307317197376 queuine tRNA-ribosyltransferase [Sinorhizobium meliloti 1 1e-164
241204663376 queuine tRNA-ribosyltransferase [Rhizobium leguminosaru 1 1e-164
227822133376 queuine tRNA-ribosyltransferase [Sinorhizobium fredii N 1 1e-164
190891763376 queuine tRNA-ribosyltransferase protein [Rhizobium etli 1 1e-164
209549348376 queuine tRNA-ribosyltransferase [Rhizobium leguminosaru 1 1e-164
86357736376 queuine tRNA-ribosyltransferase [Rhizobium etli CFN 42] 1 1e-164
150396486376 queuine tRNA-ribosyltransferase [Sinorhizobium medicae 1 1e-163
>gi|315122777|ref|YP_004063266.1| queuine tRNA-ribosyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 377 Back     alignment and organism information
 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/376 (90%), Positives = 363/376 (96%)

Query: 1   MDKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILG 60
           MDKNF FN+KA SG+ARLGEIITPRG+IKTPAFMPVGT+G VKAMYFDQVRDLGADVILG
Sbjct: 1   MDKNFCFNIKAKSGNARLGEIITPRGIIKTPAFMPVGTSGAVKAMYFDQVRDLGADVILG 60

Query: 61  NAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHID 120
           NAYHLML+PGA+RIARLGGLH+FIRWFKPILTDSGGFQVMSLSKLCSIDEQGV FRSHID
Sbjct: 61  NAYHLMLQPGADRIARLGGLHQFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVSFRSHID 120

Query: 121 GSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQ 180
           GSL+RVSPE+S+ IQNLLGSDIQMQLDECLALPA++KELKRAMELSLRWAERSLVAFGNQ
Sbjct: 121 GSLHRVSPEDSIEIQNLLGSDIQMQLDECLALPADEKELKRAMELSLRWAERSLVAFGNQ 180

Query: 181 PGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPV 240
           PGKALFGIVQGGDNI+LRSFSA RLKELDLKGYAIGGLAVGEPQEVMLHILSN+LPILPV
Sbjct: 181 PGKALFGIVQGGDNISLRSFSAARLKELDLKGYAIGGLAVGEPQEVMLHILSNILPILPV 240

Query: 241 ERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRP 300
           E+PHYLMGVGTPDDILKSVS GVDMFDCVMPTRAGRHGL+FTRFGKINLRNARH DDMRP
Sbjct: 241 EKPHYLMGVGTPDDILKSVSCGVDMFDCVMPTRAGRHGLSFTRFGKINLRNARHTDDMRP 300

Query: 301 LDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDF 360
           LDAES+C ALRDYSRAYLHHLL VNESLAGMILSWANL YYQDLM+EIR+AIA+DCF DF
Sbjct: 301 LDAESNCPALRDYSRAYLHHLLHVNESLAGMILSWANLFYYQDLMREIRNAIAQDCFADF 360

Query: 361 AMQTQENWKKGDIPPI 376
            MQTQENW+KGDIPP+
Sbjct: 361 MMQTQENWRKGDIPPL 376


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965339|ref|NP_385692.1| queuine tRNA-ribosyltransferase [Sinorhizobium meliloti 1021] Length = 376 Back     alignment and organism information
>gi|218661100|ref|ZP_03517030.1| queuine tRNA-ribosyltransferase [Rhizobium etli IE4771] Length = 376 Back     alignment and organism information
>gi|307317197|ref|ZP_07596638.1| queuine tRNA-ribosyltransferase [Sinorhizobium meliloti AK83] Length = 376 Back     alignment and organism information
>gi|241204663|ref|YP_002975759.1| queuine tRNA-ribosyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 376 Back     alignment and organism information
>gi|227822133|ref|YP_002826104.1| queuine tRNA-ribosyltransferase [Sinorhizobium fredii NGR234] Length = 376 Back     alignment and organism information
>gi|190891763|ref|YP_001978305.1| queuine tRNA-ribosyltransferase protein [Rhizobium etli CIAT 652] Length = 376 Back     alignment and organism information
>gi|209549348|ref|YP_002281265.1| queuine tRNA-ribosyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 376 Back     alignment and organism information
>gi|86357736|ref|YP_469628.1| queuine tRNA-ribosyltransferase [Rhizobium etli CFN 42] Length = 376 Back     alignment and organism information
>gi|150396486|ref|YP_001326953.1| queuine tRNA-ribosyltransferase [Sinorhizobium medicae WSM419] Length = 376 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
PRK00112366 PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisi 0.0
TIGR00430368 TIGR00430, Q_tRNA_tgt, tRNA-guanine transglycosylase, q 1e-130
TIGR00449367 TIGR00449, tgt_general, tRNA-guanine transglycosylases, 1e-124
KOG3908396 KOG3908, KOG3908, KOG3908, Queuine-tRNA ribosyltransfer 9e-94
PRK01008372 PRK01008, PRK01008, queuine tRNA-ribosyltransferase; Pr 9e-74
KOG3909414 KOG3909, KOG3909, KOG3909, Queuine-tRNA ribosyltransfer 1e-24
COG0343372 COG0343, Tgt, Queuine/archaeosine tRNA-ribosyltransfera 1e-141
pfam01702238 pfam01702, TGT, Queuine tRNA-ribosyltransferase 2e-88
PRK13534 639 PRK13534, PRK13534, 7-cyano-7-deazaguanine tRNA-ribosyl 2e-24
PRK13533 487 PRK13533, PRK13533, 7-cyano-7-deazaguanine tRNA-ribosyl 4e-22
TIGR00432 540 TIGR00432, arcsn_tRNA_tgt, tRNA-guanine transglycosylas 2e-07
>gnl|CDD|178873 PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129522 TIGR00430, Q_tRNA_tgt, tRNA-guanine transglycosylase, queuosine-34-forming Back     alignment and domain information
>gnl|CDD|129541 TIGR00449, tgt_general, tRNA-guanine transglycosylases, various specificities Back     alignment and domain information
>gnl|CDD|39111 KOG3908, KOG3908, KOG3908, Queuine-tRNA ribosyltransferase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|134464 PRK01008, PRK01008, queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|39112 KOG3909, KOG3909, KOG3909, Queuine-tRNA ribosyltransferase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|30691 COG0343, Tgt, Queuine/archaeosine tRNA-ribosyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145056 pfam01702, TGT, Queuine tRNA-ribosyltransferase Back     alignment and domain information
>gnl|CDD|184121 PRK13534, PRK13534, 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184120 PRK13533, PRK13533, 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|161875 TIGR00432, arcsn_tRNA_tgt, tRNA-guanine transglycosylase, archaeosine-15-forming Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
TIGR00430415 Q_tRNA_tgt queuine tRNA-ribosyltransferase; InterPro: I 100.0
PRK00112366 tgt queuine tRNA-ribosyltransferase; Provisional 100.0
COG0343372 Tgt Queuine/archaeosine tRNA-ribosyltransferase [Transl 100.0
PRK01008372 queuine tRNA-ribosyltransferase; Provisional 100.0
KOG3908396 consensus 100.0
PRK13533 486 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisi 100.0
PRK13534 630 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisi 100.0
TIGR00432 658 arcsn_tRNA_tgt archaeosine tRNA-ribosyltransferase; Int 100.0
TIGR00449375 tgt_general tRNA-guanine transglycosylases, various spe 100.0
KOG3909414 consensus 100.0
pfam01702238 TGT Queuine tRNA-ribosyltransferase. This is a family o 100.0
PRK12330 499 oxaloacetate decarboxylase; Provisional 97.17
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy produ 96.49
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 95.57
COG1549 519 Queuine tRNA-ribosyltransferases, contain PUA domain [T 98.75
PHA01745306 hypothetical protein 98.24
pfam00682237 HMGL-like HMGL-like. This family contains a diverse set 96.29
PRK09282 580 pyruvate carboxylase subunit B; Validated 95.13
PRK12581 468 oxaloacetate decarboxylase; Provisional 93.92
PRK12331 463 oxaloacetate decarboxylase; Provisional 93.17
PRK12999 1147 pyruvate carboxylase; Reviewed 91.63
KOG2368316 consensus 93.31
PRK03170292 dihydrodipicolinate synthase; Provisional 90.17
>TIGR00430 Q_tRNA_tgt queuine tRNA-ribosyltransferase; InterPro: IPR004803 The queuine tRNA-ribosyltransferase (tgt) 2 Back     alignment and domain information
>PRK00112 tgt queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>COG0343 Tgt Queuine/archaeosine tRNA-ribosyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01008 queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>KOG3908 consensus Back     alignment and domain information
>PRK13533 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>PRK13534 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>TIGR00432 arcsn_tRNA_tgt archaeosine tRNA-ribosyltransferase; InterPro: IPR004804 The archaeosine tRNA-guanine transglycosylase (tgt) differs from the tgt of Escherichia coli and other bacteria in the site of action and the modification that results Back     alignment and domain information
>TIGR00449 tgt_general tRNA-guanine transglycosylases, various specificities; InterPro: IPR002616 queuosine at position 34 in bacterial tRNAs and This is a family of queuine, archaeosine and general tRNA-ribosyltransferases 2 Back     alignment and domain information
>KOG3909 consensus Back     alignment and domain information
>pfam01702 TGT Queuine tRNA-ribosyltransferase Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>COG1549 Queuine tRNA-ribosyltransferases, contain PUA domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA01745 hypothetical protein Back     alignment and domain information
>pfam00682 HMGL-like HMGL-like Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>KOG2368 consensus Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
1ozm_A386 Y106f Mutant Of Z. Mobilis Tgt Length = 386 1e-104
1y5v_A385 Trna-Guanine Transglycosylase (Tgt) In Complex With 1e-104
3bl3_A386 Trna Guanine Transglycosylase V233g Mutant Apo Stru 1e-104
2oko_A385 Z. Mobilis Trna Guanine Transglycosylase E235q Muta 1e-103
1enu_A386 A New Target For Shigellosis: Rational Design And C 1e-103
1wkd_A386 Trna-Guanine Transglycosylase Length = 386 1e-103
1efz_A386 Mutagenesis And Crystallographic Studies Of Zymomon 1e-103
2pot_A386 Trna Guanine Transglycosylase (Tgt) E235q Mutant In 1e-103
2nqz_A385 Trna-Guanine Transglycosylase (Tgt) Mutant In Compl 1e-103
1pxg_A382 Crystal Structure Of The Mutated Trna-Guanine Trans 1e-103
2nso_A386 Trna-Gunanine-Transglycosylase (Tgt) Mutant Y106f, 1e-103
1wke_A386 Trna-Guanine Transglycosylase Length = 386 1e-103
1wkf_A386 Trna-Guanine Transglycosylase Length = 386 1e-102
3hfy_A386 Mutant Of Trna-Guanine Transglycosylase (K52m) Leng 1e-102
2ash_A381 Crystal Structure Of Queuine Trna-Ribosyltransferas 3e-94
1iq8_A 582 Crystal Structure Of Archaeosine Trna-Guanine Trans 3e-50
>gi|37927361|pdb|1OZM|A Chain A, Y106f Mutant Of Z. Mobilis Tgt Length = 386 Back     alignment and structure
 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 204/373 (54%), Positives = 263/373 (70%), Gaps = 4/373 (1%)

Query: 4   NFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAY 63
            F F++ A  G AR G I   RGVI+TPAFMPVGTA TVKA+  + VR  GAD+ILGN Y
Sbjct: 13  RFSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTY 72

Query: 64  HLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSL 123
           HLMLRPGAERIA+LGGLH F+ W +PILTDSGGFQVMSLS L    E+GV F+SH+DGS 
Sbjct: 73  HLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVMSLSSLTKQSEEGVTFKSHLDGSR 132

Query: 124 YRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGK 183
           + +SPE S+ IQ+LLGSDI M  DEC   PA       +ME S+RWA+RS  AF ++  +
Sbjct: 133 HMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQ 192

Query: 184 AL----FGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILP 239
           A     FGI QG    NLR  SA+ L E+   GYA+GGLAVGE Q+ M  +L   +P+LP
Sbjct: 193 AENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEGQDEMFRVLDFSVPMLP 252

Query: 240 VERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMR 299
            ++PHYLMGVG PDDI+ +V  G+DMFDCV+PTR+GR+G AFT  G IN+RNAR  +D++
Sbjct: 253 DDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLK 312

Query: 300 PLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVD 359
           PLD+E HC+  + +SRAY+HHL+R  E L  M+++  N+A+YQ LM++IR +I+E  F  
Sbjct: 313 PLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQ 372

Query: 360 FAMQTQENWKKGD 372
           FA   +  +   +
Sbjct: 373 FAQDFRARYFARN 385


>gi|85543957|pdb|1Y5V|A Chain A, Trna-Guanine Transglycosylase (Tgt) In Complex With 6-Amino- 4-(2-Phenylethyl)-1,7-Dihydro-8h-Imidazo[4, 5-G]quinazolin- 8-One Length = 385 Back     alignment and structure
>gi|218681586|pdb|3BL3|A Chain A, Trna Guanine Transglycosylase V233g Mutant Apo Structure Length = 386 Back     alignment and structure
>gi|159794979|pdb|2OKO|A Chain A, Z. Mobilis Trna Guanine Transglycosylase E235q Mutant Apo- Structure At Ph 5.5 Length = 385 Back     alignment and structure
>gi|7767014|pdb|1ENU|A Chain A, A New Target For Shigellosis: Rational Design And Crystallographic Studies Of Inhibitors Of Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>gi|157834209|pdb|1WKD|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>gi|7245534|pdb|1EFZ|A Chain A, Mutagenesis And Crystallographic Studies Of Zymomonas Mobilis Trna-Guanine Transglycosylase To Elucidate The Role Of Serine 103 For Enzymatic Activity Length = 386 Back     alignment and structure
>gi|159795109|pdb|2POT|A Chain A, Trna Guanine Transglycosylase (Tgt) E235q Mutant In Complex With Guanine Length = 386 Back     alignment and structure
>gi|160285676|pdb|2NQZ|A Chain A, Trna-Guanine Transglycosylase (Tgt) Mutant In Complex With 7-Deaza-7-Aminomethyl-Guanine Length = 385 Back     alignment and structure
>gi|34809800|pdb|1PXG|A Chain A, Crystal Structure Of The Mutated Trna-Guanine Transglycosylase (Tgt) D280e Complexed With Preq1 Length = 382 Back     alignment and structure
>gi|161760908|pdb|2NSO|A Chain A, Trna-Gunanine-Transglycosylase (Tgt) Mutant Y106f, C158v, A232s, V233g- Apo-Structure Length = 386 Back     alignment and structure
>gi|157834210|pdb|1WKE|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>gi|157834211|pdb|1WKF|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>gi|256032677|pdb|3HFY|A Chain A, Mutant Of Trna-Guanine Transglycosylase (K52m) Length = 386 Back     alignment and structure
>gi|75766322|pdb|2ASH|A Chain A, Crystal Structure Of Queuine Trna-Ribosyltransferase (Ec 2.4.2.29) (Trna-Guanine (Tm1561) From Thermotoga Maritima At 1.90 A Resolution Length = 381 Back     alignment and structure
gi|21465634|pdb|1IQ8|A Chain A, Crystal Structure Of Archaeosine Trna-Guanine Transglycosylase From Pyrococcus Horikoshii Length = 582 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
3bld_A386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltr 1e-125
1iq8_A 582 Archaeosine tRNA-guanine transglycosylase; (alpha/beta) 6e-97
2ash_A381 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, 5e-94
>3bld_A Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing, zinc; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Length = 386 Back     alignment and structure
 Score =  442 bits (1137), Expect = e-125
 Identities = 204/370 (55%), Positives = 262/370 (70%), Gaps = 4/370 (1%)

Query: 5   FHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYH 64
           F F++ A  G AR G I   RGVI+TPAFMPVGTA TVKA+  + VR  GAD+ILGN YH
Sbjct: 14  FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYH 73

Query: 65  LMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLY 124
           LMLRPGAERIA+LGGLH F+ W +PILTDSGGFQVMSLS L    E+GV F+SH+DGS +
Sbjct: 74  LMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVMSLSSLTKQSEEGVTFKSHLDGSRH 133

Query: 125 RVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPGKA 184
            +SPE S+ IQ+LLGSDI M  DEC   PA       +ME S+RWA+RS  AF ++  +A
Sbjct: 134 MLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQA 193

Query: 185 ----LFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPV 240
               LFGI QG    NLR  SA+ L E+   GYA+GGLA GE Q+ M  +L   +P+LP 
Sbjct: 194 ENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAGGEGQDEMFRVLDFSVPMLPD 253

Query: 241 ERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRP 300
           ++PHYLMGVG PDDI+ +V  G+DMFDCV+PTR+GR+G AFT  G IN+RNAR  +D++P
Sbjct: 254 DKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKP 313

Query: 301 LDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDF 360
           LD+E HC+  + +SRAY+HHL+R  E L  M+++  N+A+YQ LM++IR +I+E  F  F
Sbjct: 314 LDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQF 373

Query: 361 AMQTQENWKK 370
           A   +  +  
Sbjct: 374 AQDFRARYFA 383


>1iq8_A Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} SCOP: b.122.1.1 c.1.20.1 d.17.6.1 PDB: 1it7_A* 1it8_A* 1j2b_A Length = 582 Back     alignment and structure
>2ash_A Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, structural genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Length = 381 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
2ash_A381 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, 100.0
3bld_A386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltr 100.0
1iq8_A 582 Archaeosine tRNA-guanine transglycosylase; (alpha/beta) 100.0
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamylated l 94.27
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carboxyltr 92.88
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family 92.74
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine bios 91.05
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-acid b 90.15
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, 91.46
>2ash_A Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, structural genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=0  Score=899.15  Aligned_cols=370  Identities=43%  Similarity=0.746  Sum_probs=363.3

Q ss_pred             CCCEEEEEEECCCCEEEEEEECCEEEECCCEEECCCCCCCCCCCHHHHHHCCCCEEEEEHHHHHHCCCHHHHHHCCCCHH
Q ss_conf             87049999764993279998788754058574106868568868899986099899932266573876899865274201
Q gi|254780178|r    3 KNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHK   82 (378)
Q Consensus         3 ~~~~F~i~~~~~~aR~G~L~t~~g~i~TP~flpv~t~g~v~~lt~~~l~~~g~~~il~Ntyhl~~~pg~~~i~~~gGlh~   82 (378)
                      ..|+|+|++++++||+|+|.|+||+|+||+||||+|+|+||+|+||+|+++|++++++||||++++||.+++++.||||+
T Consensus        11 ~~m~F~i~~~~~~AR~G~L~~~~g~i~TP~fmpv~t~g~v~~ltpd~l~~~g~~~il~Ntyhl~~~pg~~~~~~~gGlh~   90 (381)
T 2ash_A           11 HHMEFEVKKTFGKARLGVMKLHHGAVETPVFMPVGTNASVKLLTPRDLEEAGAEIILSNTFHLMLKPGVEIIKLHRGLHN   90 (381)
T ss_dssp             --CEEEEEEEETTEEEEEEEETTEEEEESEEEEEESSSSCTTCCHHHHHHHTCSCEEECCHHHHHTTCHHHHHHTTSHHH
T ss_pred             CCEEEEEEEEECCEEEEEEEECCEEEECCEEEEECCCCCCCCCCHHHHHHHCCCEEEECHHHHHHCCCHHHHHHHCCHHH
T ss_conf             51599998605872158999799776599577604778588469999997189889502466651886056676388555


Q ss_pred             HCCCCCCEEECCCCCCCCHHHHCCCCCCCCEEEECCCCCCEEEECHHHHHHHHHHCCCCEEEEEHHHCCCCCCHHHHHHH
Q ss_conf             10157722411454321012210223333102101445415871299999998732897799601213322115899999
Q gi|254780178|r   83 FIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRA  162 (378)
Q Consensus        83 fl~~~~~ilTDSGgfQv~sl~~~~~~~~~Gv~f~s~~dG~~~~ltpe~~i~~q~~lg~DI~~~LD~~~~~~~~~k~~~~s  162 (378)
                      ||+|++++||||||||++|+++. +++++||.|+|++||+++.+|||++|++|+.|||||+|+||+|++++++++++++|
T Consensus        91 f~~~~~~iltdSggfq~~sl~~~-~~~~~gv~f~s~~~g~~~~ltpe~~~~~q~~lg~DI~~~ld~~~~~~~~~~~~~~s  169 (381)
T 2ash_A           91 FMGWKRPILTDSGGFQVFSLPKI-RIDDEGVVFRSPIDGSKVFLNPEISMEVQIALGSDICMVFDHCPVPDADYEEVKEA  169 (381)
T ss_dssp             HHTCCSCEEECCCHHHHHTSTTC-EECSSCEEEECTTTCCEEEECHHHHHHHHHHHTCSEEECCCCCCC--CCHHHHHHH
T ss_pred             HHHCCCCEEECCCCCCCCCCCCC-CCCCCEEEEECCCCCCEEECCHHHHHHHHHHHCCCEEEECCCCCCCCCCHHHHHHH
T ss_conf             76447861213576654324776-53677159843678925766899999999970998899998579997678999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCHHH
Q ss_conf             99889999999885135888605540234443668999988764222346766413567516789989998985077033
Q gi|254780178|r  163 MELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVER  242 (378)
Q Consensus       163 v~rT~~w~~~~~~~~~~~~~~~lfgiVqGG~~~dLR~~Sa~~l~~~~~~G~aIgGl~~ge~~~~~~~ii~~~~~~LP~~k  242 (378)
                      ++||++|++||++++.+ ++|+||||||||.++|||++|++++.+++|+||+|||++++++++++.+++..+.+.||++|
T Consensus       170 ~~rT~rw~~~~~~~~~~-~~q~lfgiVqGG~~~dLR~~sa~~l~~~~~~G~aigGl~~~e~~~~~~~~v~~~~~~LP~~k  248 (381)
T 2ash_A          170 TERTYRWALRSKKAFKT-ENQALFGIVQGGIYPDLRRESALQLTSIGFDGYAIGGLSIGEERSLTLEMTEVTVEFLPEDK  248 (381)
T ss_dssp             HHHHHHHHHHHHHHCCC-SSCEEEEEECCTTCHHHHHHHHHHHHTTCCSEEEECSCSSSSCHHHHHHHHHHHHTTSCTTS
T ss_pred             HHHHHHHHHHHHHHCCC-CCCEEEEEECCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCCCCCC
T ss_conf             99999999865543046-61227754537678899999999986179887998765567651012233100355577540


Q ss_pred             HEECCCCHHHHHHHHHHHCCCCEEEECCEEECCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHCCCCHHHHHHHH
Q ss_conf             10025410189999998538983662000002332002456210021012322368855986698133688989998868
Q gi|254780178|r  243 PHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLL  322 (378)
Q Consensus       243 Pr~l~G~G~P~~i~~~v~~GvDlFD~~~ptr~Ar~G~~~t~~g~i~l~~~~~~~d~~pi~~~C~C~~C~~ytraYl~HL~  322 (378)
                      ||||||+|+|++|+.+|++|||||||++|+|+||+|+|||.+|.+||++++|++|++||+++|+||||++|||||||||+
T Consensus       249 Pr~l~GvG~P~~il~~V~~GvD~FD~~~ptr~Ar~G~alt~~g~~~l~~~~~~~D~~Pl~~~C~C~tC~~~traYlhHL~  328 (381)
T 2ash_A          249 PRYFMGGGSPELILELVDRGVDMFDSVFPTRIARHGTALTWNGKLNLKASYNKRSLEPVDERCGCYTCKNFTRSYIHHLF  328 (381)
T ss_dssp             CEEECSCCCHHHHHHHHTTTCCEEEESHHHHHHHTTEEEETTEEEETTSGGGTTCCSCSCTTCCSHHHHHCCHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHCCCCEEECCCCHHHHHCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHH
T ss_conf             15326899999999999749885430551034427845634785444441002478997989899143704999998674


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             5785089999999999999999999999998599899999999985327998
Q gi|254780178|r  323 RVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIP  374 (378)
Q Consensus       323 ~~~E~l~~~Ll~iHNl~~~~~~~~~iR~aI~~g~f~~~~~~~~~~~~~~~~~  374 (378)
                      +++||||++||++|||++|.+||++||+||++|+|++|+++|+++|++++++
T Consensus       329 ~~~E~l~~~LltiHNl~~~~~~~~~iR~aI~~g~f~~~~~~f~~~y~~~~~~  380 (381)
T 2ash_A          329 DRGEVLGQILLTIHNINFMISLMKEVRRSIESGTFKELKSKVVEVYSSGGVN  380 (381)
T ss_dssp             HTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHTC-----
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCC
T ss_conf             1781789999999999999999999999998599999999999997528988



>3bld_A Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing, zinc; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Back     alignment and structure
>1iq8_A Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} SCOP: b.122.1.1 c.1.20.1 d.17.6.1 PDB: 1it7_A* 1it8_A* 1j2b_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transferase; HET: KCX; 1.90A {Propionibacterium freudenreichiisubsp} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, biotin enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase, lysine biosynthesis; 1.50A {Hahella chejuensis} Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: MSE; 1.80A {Campylobacter jejuni} PDB: 3ler_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
d1r5ya_372 c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Z 2e-94
d1iq8a1355 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycos 5e-71
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Length = 372 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: tRNA-guanine transglycosylase
family: tRNA-guanine transglycosylase
domain: Queosine tRNA-guanine transglycosylase
species: Zymomonas mobilis [TaxId: 542]
 Score =  339 bits (870), Expect = 2e-94
 Identities = 204/368 (55%), Positives = 262/368 (71%), Gaps = 4/368 (1%)

Query: 5   FHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYH 64
           F F++ A  G AR G I   RGVI+TPAFMPVGTA TVKA+  + VR  GAD+ILGN YH
Sbjct: 4   FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYH 63

Query: 65  LMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLY 124
           LMLRPGAERIA+LGGLH F+ W +PILTDSGG+QVMSLS L    E+GV F+SH+DGS +
Sbjct: 64  LMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRH 123

Query: 125 RVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQP--- 181
            +SPE S+ IQ+LLGSDI M  DEC   PA       +ME S+RWA+RS  AF ++    
Sbjct: 124 MLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQA 183

Query: 182 -GKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPV 240
              ALFGI QG    NLR  SA+ L E+   GYA+GGLAVGE Q+ M  +L   +P+LP 
Sbjct: 184 ENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEGQDEMFRVLDFSVPMLPD 243

Query: 241 ERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRP 300
           ++PHYLMGVG PDDI+ +V  G+DMFDCV+PTR+GR+G AFT  G IN+RNAR  +D++P
Sbjct: 244 DKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKP 303

Query: 301 LDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDF 360
           LD+E HC+  + +SRAY+HHL+R  E L  M+++  N+A+YQ LM++IR +I+E  F  F
Sbjct: 304 LDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQF 363

Query: 361 AMQTQENW 368
           A   +  +
Sbjct: 364 AQDFRARY 371


>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 355 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
d1r5ya_372 Queosine tRNA-guanine transglycosylase {Zymomonas mobil 100.0
d1iq8a1355 Archaeosine tRNA-guanine transglycosylase, N-terminal d 100.0
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: tRNA-guanine transglycosylase
family: tRNA-guanine transglycosylase
domain: Queosine tRNA-guanine transglycosylase
species: Zymomonas mobilis [TaxId: 542]
Probab=100.00  E-value=0  Score=881.47  Aligned_cols=368  Identities=55%  Similarity=0.932  Sum_probs=361.1

Q ss_pred             CCCCEEEEEEECCCCEEEEEEECCEEEECCCEEECCCCCCCCCCCHHHHHHCCCCEEEEEHHHHHHCCCHHHHHHCCCCH
Q ss_conf             88704999976499327999878875405857410686856886889998609989993226657387689986527420
Q gi|254780178|r    2 DKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLH   81 (378)
Q Consensus         2 ~~~~~F~i~~~~~~aR~G~L~t~~g~i~TP~flpv~t~g~v~~lt~~~l~~~g~~~il~Ntyhl~~~pg~~~i~~~gGlh   81 (378)
                      +.+|+|+|+++|++||+|+|.|+||+|+||+||||+|+|+||||+||+|+++|++++++||||++++||.+.+++.||||
T Consensus         1 ~~~~~Fei~~~d~~AR~G~L~~~~g~i~TP~fmpv~t~g~v~~ltpd~l~~~g~~~il~Ntyhl~~~pg~~~i~~~gglh   80 (372)
T d1r5ya_           1 RPRFSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLH   80 (372)
T ss_dssp             CCSCEEEEEEEETTEEEEEEEETTEEEEESEEECBCTTSSCTTCCHHHHHHTTCSCEEEEHHHHHHTTCHHHHHHTTCHH
T ss_pred             CCCEEEEEEECCCCEEEEEEEECCEEEECCEEEECCCCCCCCCCCHHHHHHCCCCEEECHHHHHHHCCCCHHHHHCCCHH
T ss_conf             99607999965585004899979977679978754778808847999999728988833188887587617877426513


Q ss_pred             HHCCCCCCEEECCCCCCCCHHHHCCCCCCCCEEEECCCCCCEEEECHHHHHHHHHHCCCCEEEEEHHHCCCCCCHHHHHH
Q ss_conf             11015772241145432101221022333310210144541587129999999873289779960121332211589999
Q gi|254780178|r   82 KFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKR  161 (378)
Q Consensus        82 ~fl~~~~~ilTDSGgfQv~sl~~~~~~~~~Gv~f~s~~dG~~~~ltpe~~i~~q~~lg~DI~~~LD~~~~~~~~~k~~~~  161 (378)
                      +||+|++++||||||||++|++++.+++++||+|+|++||+++.+|||++|++|+.|||||+|+||+|++++++++++++
T Consensus        81 ~f~~~~~~iltdsGg~q~~sl~~~~~~~~~gv~f~s~~~g~~~~ltpe~~i~~q~~ig~DI~~~Ldd~~~~~~~~~~~~~  160 (372)
T d1r5ya_          81 SFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAAS  160 (372)
T ss_dssp             HHHTCCSCEEEECSHHHHC-CC-CCEEETTEEEC---------CBCHHHHHHHHHHHTCSEEECCCCCCCSSCCHHHHHH
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCEEEECHHHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHH
T ss_conf             34204565200247654323223455577885353226872111000779999985088467522446653101678899


Q ss_pred             HHHHHHHHHHHHHHHHCCC----CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             9998899999998851358----886055402344436689999887642223467664135675167899899989850
Q gi|254780178|r  162 AMELSLRWAERSLVAFGNQ----PGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPI  237 (378)
Q Consensus       162 sv~rT~~w~~~~~~~~~~~----~~~~lfgiVqGG~~~dLR~~Sa~~l~~~~~~G~aIgGl~~ge~~~~~~~ii~~~~~~  237 (378)
                      +++||++|+++|++++...    .+|.+|||||||.++|||++|++++.+++|+||+|||++++++++++.++++.+.+.
T Consensus       161 ~~~rt~~w~~~~~~~~~~~~~~~~~~~lfgivqGg~~~dlR~~s~~~l~~~~~~G~aiGgl~~~~~~~~~~~~v~~~~~~  240 (372)
T d1r5ya_         161 SMERSMRWAKRSRDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEGQDEMFRVLDFSVPM  240 (372)
T ss_dssp             HHHHHHHHHHHHHHHHHTSHHHHHHCEEEEEECCTTCHHHHHHHHHHHHHHCCSEEEECSCSSSSCHHHHHHHHHHHGGG
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             99999999999999875055667666321131541265688889999986213732122445675067788899850200


Q ss_pred             CCHHHHEECCCCHHHHHHHHHHHCCCCEEEECCEEECCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHCCCCHHH
Q ss_conf             77033100254101899999985389836620000023320024562100210123223688559866981336889899
Q gi|254780178|r  238 LPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAY  317 (378)
Q Consensus       238 LP~~kPr~l~G~G~P~~i~~~v~~GvDlFD~~~ptr~Ar~G~~~t~~g~i~l~~~~~~~d~~pi~~~C~C~~C~~ytraY  317 (378)
                      ||++|||||||+|+|++|+.+|++|||||||++|+|+||+|+|||++|.+||++++|++|++||+++|+||+|++|||||
T Consensus       241 Lp~~kPr~l~Gvg~P~~il~~V~~GvD~FD~~~p~r~Ar~G~alt~~g~~~l~~~~~~~d~~Pl~~~C~C~~C~~~sraY  320 (372)
T d1r5ya_         241 LPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAY  320 (372)
T ss_dssp             SCTTSCEEETTCCSHHHHHHHHTTTCCEEECSHHHHHHHTTEECCTTCCEETTSGGGTTCCSCSSSSCCSHHHHHCCHHH
T ss_pred             CCCCCCEEECCCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCEEECCCCEEECCCCCCCCCCCCCCCCCCHHHCCCCHHH
T ss_conf             12011022047898789888360589954543113111136157259832321232335689869898992325159999


Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             9886857850899999999999999999999999985998999999999853
Q gi|254780178|r  318 LHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWK  369 (378)
Q Consensus       318 l~HL~~~~E~l~~~Ll~iHNl~~~~~~~~~iR~aI~~g~f~~~~~~~~~~~~  369 (378)
                      ||||++++||+|++||++|||++|.+||++||+||++|+|++|+++|+++|+
T Consensus       321 l~HL~~~~E~l~~~Ll~iHNl~~~~~~~~~iR~aI~~g~f~~~~~~f~~~y~  372 (372)
T d1r5ya_         321 IHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF  372 (372)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHC
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHC
T ss_conf             9877638836899999999999999999999999985999999999999649



>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 378 queuine tRNA-ribosyltransferase [Candidatus Liberi
2ash_A_1-102_135-381349 (A:1-102,A:135-381) Queuine tRNA-ribosyltransferas 1e-116
3bld_A_386 (A:) Queuine tRNA-ribosyltransferase; TGT, PREQ1, 1e-112
1iq8_A_1-358358 (A:1-358) Archaeosine tRNA-guanine transglycosylas 2e-86
2ash_A_103-13432 (A:103-134) Queuine tRNA-ribosyltransferase; TM156 6e-09
>2ash_A (A:1-102,A:135-381) Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, structural genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima}Length = 349 Back     alignment and structure
 Score =  412 bits (1059), Expect = e-116
 Identities = 141/372 (37%), Positives = 200/372 (53%), Gaps = 34/372 (9%)

Query: 3   KNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNA 62
            +  F +K   G ARLG +    G ++TP FMPVGT  +VK +    + + GA++IL N 
Sbjct: 11  HHMEFEVKKTFGKARLGVMKLHHGAVETPVFMPVGTNASVKLLTPRDLEEAGAEIILSNT 70

Query: 63  YHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGS 122
           +HLML+PG E I    GLH F+ W +PILTDS                            
Sbjct: 71  FHLMLKPGVEIIKLHRGLHNFMGWKRPILTDS---------------------------- 102

Query: 123 LYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAMELSLRWAERSLVAFGNQPG 182
                PE S+ +Q  LGSDI M  D C    A+ +E+K A E + RWA RS  AF     
Sbjct: 103 -----PEISMEVQIALGSDICMVFDHCPVPDADYEEVKEATERTYRWALRSKKAF-KTEN 156

Query: 183 KALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPILPVER 242
           +ALFGIVQGG   +LR  SA +L  +   GYAIGGL++GE + + L +    +  LP ++
Sbjct: 157 QALFGIVQGGIYPDLRRESALQLTSIGFDGYAIGGLSIGEERSLTLEMTEVTVEFLPEDK 216

Query: 243 PHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLD 302
           P Y MG G+P+ IL+ V  GVDMFD V PTR  RHG A T  GK+NL+ + +   + P+D
Sbjct: 217 PRYFMGGGSPELILELVDRGVDMFDSVFPTRIARHGTALTWNGKLNLKASYNKRSLEPVD 276

Query: 303 AESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAM 362
               C   ++++R+Y+HHL    E L  ++L+  N+ +   LMKE+R +I    F +   
Sbjct: 277 ERCGCYTCKNFTRSYIHHLFDRGEVLGQILLTIHNINFMISLMKEVRRSIESGTFKELKS 336

Query: 363 QTQENWKKGDIP 374
           +  E +  G + 
Sbjct: 337 KVVEVYSSGGVN 348


>3bld_A (A:) Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing, zinc; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ...Length = 386 Back     alignment and structure
>1iq8_A (A:1-358) Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii}Length = 358 Back     alignment and structure
>2ash_A (A:103-134) Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, structural genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima}Length = 32 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target378 queuine tRNA-ribosyltransferase [Candidatus Liberibacte
3bld_A_386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glyco 100.0
2ash_A_1-102_135-381349 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guan 100.0
1iq8_A_1-358358 Archaeosine tRNA-guanine transglycosylase; (alpha/ 100.0
2ash_A_103-13432 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guan 98.21
1rqb_A_1-308_422-472359 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 92.91
2ztj_A_1-277277 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 91.29
1nvm_A_1-273273 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 90.19
>3bld_A (A:) Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing, zinc; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Back     alignment and structure
Probab=100.00  E-value=0  Score=795.06  Aligned_cols=371  Identities=55%  Similarity=0.920  Sum_probs=363.0

Q ss_pred             CCCCEEEEEEECCCCEEEEEEECCEEEECCCEEECCCCCCCCCCCHHHHHHCCCCEEEEEHHHHHHCCCHHHHHHCCCCH
Q ss_conf             88704999976499327999878875405857410686856886889998609989993226657387689986527420
Q gi|254780178|r    2 DKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAMYFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLH   81 (378)
Q Consensus         2 ~~~~~F~i~~~~~~aR~G~L~t~~g~i~TP~flpv~t~g~v~~lt~~~l~~~g~~~il~Ntyhl~~~pg~~~i~~~gGlh   81 (378)
                      ...|+|++++++++||+|+|.++||+|+||+||||+++|+|||||||++++++.+++++|+||++++|+.+.+++.||+|
T Consensus        11 ~m~~~f~i~~~~~~aR~G~l~~~~~~i~TP~fl~vt~~G~vp~Lt~d~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~gl~   90 (386)
T 3bld_A           11 RPRFSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLH   90 (386)
T ss_dssp             CCSCEEEEEEEETTEEEEEEEETTEEEEESEECCEESSSSBTTCCHHHHHHTTCSCEEECHHHHHHTTCHHHHHHTTCHH
T ss_pred             CCCEEEEEEECCCCEEEEEEEECCEEEECCEEEECCCCCCCCCCCHHHHHHCCCCEEECHHHHHHHCCCHHHHHHCCCCH
T ss_conf             89726999966685225899979977448917634787758857999999728988951166775478707777448820


Q ss_pred             HHCCCCCCEEECCCCCCCCHHHHCCCCCCCCEEEECCCCCCEEEECHHHHHHHHHHCCCCEEEEEHHHCCCCCCHHHHHH
Q ss_conf             11015772241145432101221022333310210144541587129999999873289779960121332211589999
Q gi|254780178|r   82 KFIRWFKPILTDSGGFQVMSLSKLCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKR  161 (378)
Q Consensus        82 ~fl~~~~~ilTDSGgfQv~sl~~~~~~~~~Gv~f~s~~dG~~~~ltpe~~i~~q~~lg~DI~~~LD~~~~~~~~~k~~~~  161 (378)
                      +|++|+++++||||+||++|++...+++++||.|+++.+|+++.+|||+|+++|+.|||||+|+||+++++..++|++++
T Consensus        91 ~f~~~~~~~lt~sg~~q~~~~~~~~~~~~~gv~~~~~~~gg~~~lt~e~~~~~~~~i~pDi~v~Ldd~~~~~~~~k~~~~  170 (386)
T 3bld_A           91 SFMGWDRPILTDSGGFQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAAS  170 (386)
T ss_dssp             HHHTCCSCEEECCSHHHHHC------CBTTBCCCCC--------CCHHHHHHHHHHHTCSEEECCCCCCCSSCCHHHHHH
T ss_pred             HHHCCCCCEECCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEECCHHHHHHHHHHHCCCEEEECCCCCCCCCCHHHHHH
T ss_conf             33138876112555555444123566568834883676894165188999999997499888753435788861778999


Q ss_pred             HHHHHHHHHHHHHHHHCCCC----CCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             99988999999988513588----86055402344436689999887642223467664135675167899899989850
Q gi|254780178|r  162 AMELSLRWAERSLVAFGNQP----GKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGEPQEVMLHILSNVLPI  237 (378)
Q Consensus       162 sv~rT~~w~~~~~~~~~~~~----~~~lfgiVqGG~~~dLR~~Sa~~l~~~~~~G~aIgGl~~ge~~~~~~~ii~~~~~~  237 (378)
                      ||+||.+|+++|+++++..+    .+.+||+||||.++|||++|++++.+++++||+|||+.++++.+++.++|.++.+.
T Consensus       171 sv~rT~~w~~~~~~~~~~~~~~~~~~~~~~~iqGg~~~dlr~~s~~~l~~~~~~g~~i~g~~~~~~~~~~~~~i~~~~~~  250 (386)
T 3bld_A          171 SMERSMRWAKRSRDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAGGEGQDEMFRVLDFSVPM  250 (386)
T ss_dssp             HHHHHHHHHHHHHHHHHTSHHHHHHCEEEEEECCTTCHHHHHHHHHHHHHHCCSEEEECSCSSSSCHHHHHHHHHHHGGG
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             99999999999999876122116774051363787789999999999985799877215866676177889998751434


Q ss_pred             CCHHHHEECCCCHHHHHHHHHHHCCCCEEEECCEEECCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHCCCCHHH
Q ss_conf             77033100254101899999985389836620000023320024562100210123223688559866981336889899
Q gi|254780178|r  238 LPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAFTRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAY  317 (378)
Q Consensus       238 LP~~kPr~l~G~G~P~~i~~~v~~GvDlFD~~~ptr~Ar~G~~~t~~g~i~l~~~~~~~d~~pi~~~C~C~~C~~ytraY  317 (378)
                      ||++|||||+|+|+|++|+.+|++|||+|||++|++.||+|+|+|++|.+||++.+|++|++||+++|+||+|++|||||
T Consensus       251 lp~~kp~~l~G~g~P~~il~~v~~GvD~fDs~~p~~~A~~G~alt~~~~~~L~~~~~~~d~~Pi~~~C~C~~C~~~traY  330 (386)
T 3bld_A          251 LPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAY  330 (386)
T ss_dssp             SCTTSCEEETTCCCHHHHHHHHTTTCCEEC----------CEECCTTCCEETTSGGGTTCCSCSSSSCCSHHHHHCCHHH
T ss_pred             CCCCCCEEECCCCCHHHHHHHHHCCCCEECCCCCCHHHHCCCEECCCCCEEECCHHHCCCCCCCCCCCCCHHHCCCCHHH
T ss_conf             66553146458998899999998299731146745254278566269854605364435799869799991226259999


Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCC
Q ss_conf             9886857850899999999999999999999999985998999999999853279
Q gi|254780178|r  318 LHHLLRVNESLAGMILSWANLAYYQDLMKEIRSAIAEDCFVDFAMQTQENWKKGD  372 (378)
Q Consensus       318 l~HL~~~~E~l~~~Ll~iHNl~~~~~~~~~iR~aI~~g~f~~~~~~~~~~~~~~~  372 (378)
                      ||||++++||+|.+||++||+++|.+||+.||++|++|+|++|+++|+++|..++
T Consensus       331 lhHL~~~~E~~~~~LL~~HNl~~~~~~~~~iR~~i~~~~l~~~~~~~~~~~~~~~  385 (386)
T 3bld_A          331 IHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFARN  385 (386)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHC---
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCC
T ss_conf             9777547846899999999999999999999999985999999999999960689



>2ash_A (A:1-102,A:135-381) Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, structural genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Back     alignment and structure
>1iq8_A (A:1-358) Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2ash_A (A:103-134) Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, structural genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Back     alignment and structure
>1rqb_A (A:1-308,A:422-472) Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transferase; HET: KCX; 1.90A {Propionibacterium freudenreichiisubsp} Back     alignment and structure
>2ztj_A (A:1-277) Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid biosynthesis, cytoplasm, lysine biosynthesis; HET: AKG; 1.80A {Thermus thermophilus HB27} PDB: 2ztk_A* Back     alignment and structure
>1nvm_A (A:1-273) HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling, bifunctional enzyme; HET: NAD; 1.70A {Pseudomonas SP} Back     alignment and structure