254780190

254780190

fumarate hydratase

GeneID in NCBI database:8209170Locus tag:CLIBASIA_00375
Protein GI in NCBI database:254780190Protein Accession:YP_003064603.1
Gene range:+(76170, 77561)Protein Length:463aa
Gene description:fumarate hydratase
COG prediction:[C] Fumarase
KEGG prediction:fumC; fumarate hydratase (EC:4.2.1.2); K01679 fumarate hydratase, class II [EC:4.2.1.2]
SEED prediction:Fumarate hydratase class II (EC 4.2.1.2)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Subsystem involved in SEED:TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---
MTNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIYPH
ccccEEEEEccccccccHHHcccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccHHcccccHHHHccHHHHHHHHHHHHHHHHHcccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccHHHHHHHHHHHHHccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHccHHHHcccc
cccEcEEEEccEEEEccccccccHHHHHHHHHccccccEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHcccEcccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccccccccccccccccHHHHHHHHHHHHHccccEEcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccEccEcccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcEEcHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHccHHHccccc
mtntrneqdsfgtmkvqedryWGAQAQRSLenfkigeekqPLVIIRALGIIKQAAARVNIelgkldpkIGEAIVKASEEVingklddhfplvvwqtgsgtqsnmnVNEVISNRAIEILggvmgskspvhpndhvnlcqssndtypTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGrthtqdatpltlgqefsGYATQVKNSIKRIEMTLDGLYELaqggtavgtglntpvGFAEKVAQNIRditglpfitapnkfEALACHDAIAFCHGAINTSATALFKIAndirflgsgprsglgelmlpenepgssimpgkvnptqcEAITQVCAHIFGNHAAITFansqghfelnvykpmiAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKkahhnsttlKEEAIASGLisateydlivkpekmiyph
mtntrneqdsfgtmkvqedrYWGAQAQRSLEnfkigeekqPLVIIRALGIIKQAAARVnielgkldpKIGEAIVKASEEVINGKLDDHFPLVVWQTGsgtqsnmnVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRThtqdatpltlgqefsgYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGlisateydlivkpekmiyph
MTNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIYPH
***TRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMI***
**********FGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIYPH
*TNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIY**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIYPH
MTNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIYPH
MTNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIYPH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target463 fumarate hydratase [Candidatus Liberibacter asiaticus s
254780974435 adenylosuccinate lyase [Candidatus Liberibacter as 2e-09
254780370473 argininosuccinate lyase [Candidatus Liberibacter a 2e-08
>gi|254780974|ref|YP_003065387.1| adenylosuccinate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 435 Back     alignment
 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 103/246 (41%), Gaps = 16/246 (6%)

Query: 93  VWQTGSGTQSN----MNVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAI 148
           +W+ G     N    M ++ +I +  I  L  +     P     H  +  +S+D   T  
Sbjct: 48  IWEKGRNAVFNVDRIMELDSIIKHDVIAFLTHLAEIIGPDARFIHQGM--TSSDILDTCF 105

Query: 149 HIACAERIVHRLLPTLRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQV 208
            I    R    LL  +  L  +L K+  +++D + IGR+H   A P T G + +    + 
Sbjct: 106 SIQLM-RSTDILLEDIDQLLESLKKRAFEYKDTLTIGRSHGIHAEPTTFGLKLAMAYAEF 164

Query: 209 KNSIKRIEMTLDGLYELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEAL 268
             S KR+    + +   A  G+ VGT  N        V Q++ D  GL   T P   + +
Sbjct: 165 SRSRKRLLTAREEIAVCAISGS-VGTFSN----IHPYVEQHVADAMGLK--TDPISSQVI 217

Query: 269 ACHDAIAFCHGAINTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPT 328
           A  D  A     +   A+++ ++A +IR L       + E   P  + GSS MP K NP 
Sbjct: 218 A-RDRHAMYFSVLGVIASSIERVATEIRHLQRTEILEVEEFFHP-GQKGSSSMPHKRNPI 275

Query: 329 QCEAIT 334
             E +T
Sbjct: 276 LTENLT 281

>gi|254780370|ref|YP_003064783.1| argininosuccinate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 473 Back     alignment
 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 128/335 (38%), Gaps = 49/335 (14%)

Query: 110 ISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHV 169
           I  R   ++G + G          ++  +S ND     + +   E+ +  +   L+ L  
Sbjct: 97  IEARLTSLIGSIAGK---------MHTARSRNDQVALDLRLWIKEKTLE-ITNDLKKLLT 146

Query: 170 ALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGG 229
            L  K  +  + I  G TH Q A P+T G     Y       I R   +++ L E   G 
Sbjct: 147 ILLDKAEEHHNTIMPGFTHLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGA 206

Query: 230 TAVGTGLNTPV---------GFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGA 280
            A+  G + P+         GF E    +I  ++   FI        L C    A C   
Sbjct: 207 AALA-GTSFPIDRHFTAKELGFREPTRNSIDSVSDRDFI--------LECLSHSAIC--- 254

Query: 281 INTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHI 340
               A  + ++A +I  L S P+     L       GSSIMP K NP   E +      I
Sbjct: 255 ----AMHMSRLAEEI-ILWSTPQFNFVRLS-DAFSTGSSIMPQKRNPDGAELVRAKTGRI 308

Query: 341 FGNHAAITFANSQGHFELNVYKPMI-----AYNVLQSIQLLSDSIDSFTINCIEGIQARK 395
             N A ++         L   K M       ++ L+++Q++  +I +     IE +   K
Sbjct: 309 --NGALLSLLTIMKGLPLAYSKDMQEDKEPVFDALETLQIIILAISAM----IEDLTVNK 362

Query: 396 ENIQLSLNRSLMLVTALTSKIGYDNASMIAKKAHH 430
           + +Q +  +S    T L   +   +A +  ++AH+
Sbjct: 363 DRLQEAATKSHSTATDLADWL-VSHAGLPFREAHY 396

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target463 fumarate hydratase [Candidatus Liberibacter asiaticus s
315122761463 fumarate hydratase [Candidatus Liberibacter solanacearu 1 0.0
327189300463 fumarate hydratase protein, class II [Rhizobium etli CN 1 0.0
222086218463 fumarate hydratase, class II [Agrobacterium radiobacter 1 0.0
190892062463 fumarate hydratase protein, class II [Rhizobium etli CI 1 0.0
150396785482 fumarate hydratase [Sinorhizobium medicae WSM419] Lengt 1 0.0
209549609463 fumarate hydratase [Rhizobium leguminosarum bv. trifoli 1 0.0
195970163473 fumarate hydratase [Sinorhizobium meliloti 1021] Length 1 0.0
86357998463 fumarate hydratase [Rhizobium etli CFN 42] Length = 463 1 0.0
307318579497 fumarate hydratase, class II [Sinorhizobium meliloti AK 1 0.0
39931618463 RecName: Full=Fumarate hydratase class II; Short=Fumara 1 0.0
>gi|315122761|ref|YP_004063250.1| fumarate hydratase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 463 Back     alignment and organism information
 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/463 (90%), Positives = 446/463 (96%)

Query: 1   MTNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNI 60
           M+NTRNEQDSFGT++VQ+D YWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVN+
Sbjct: 1   MSNTRNEQDSFGTIEVQKDCYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNM 60

Query: 61  ELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGG 120
           ELGKLDPKIG AI+KASEEVI+GKLD HFPLVVWQTGSGTQSNMNVNEVISNRAIEILGG
Sbjct: 61  ELGKLDPKIGNAIIKASEEVISGKLDAHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGG 120

Query: 121 VMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQD 180
            MGSK+PVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLH ALTKKI++FQD
Sbjct: 121 TMGSKNPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHSALTKKINEFQD 180

Query: 181 IIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPV 240
           IIKIGRTHTQDATPLTLGQEFSGYA QVKNSIKRIE+TL+GLYELAQGGTAVGTGLN+PV
Sbjct: 181 IIKIGRTHTQDATPLTLGQEFSGYAAQVKNSIKRIEITLNGLYELAQGGTAVGTGLNSPV 240

Query: 241 GFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGS 300
           GFAEK+A NIR+ITGLPFITAPNKFEALA HDA+ FCHGAINT+AT+LFKIANDIRFLGS
Sbjct: 241 GFAEKIALNIRNITGLPFITAPNKFEALATHDAVTFCHGAINTTATSLFKIANDIRFLGS 300

Query: 301 GPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNV 360
           GPRSGLGEL LPENEPGSSIMPGKVNPTQCEA+TQVCAHIFGNHAAITFANSQGHFELNV
Sbjct: 301 GPRSGLGELALPENEPGSSIMPGKVNPTQCEALTQVCAHIFGNHAAITFANSQGHFELNV 360

Query: 361 YKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDN 420
           YKPMIAYNVLQSIQLLSDSI+SFT NC+  IQAR +NI+ SLNRSLMLVTALTSKIGYDN
Sbjct: 361 YKPMIAYNVLQSIQLLSDSIESFTNNCVLDIQARIDNIKNSLNRSLMLVTALTSKIGYDN 420

Query: 421 ASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIYPH 463
           A+MIAKKAHHN+TTLKEEAIASGLISA EYD IVKPEKM+YP+
Sbjct: 421 ATMIAKKAHHNNTTLKEEAIASGLISAEEYDTIVKPEKMLYPY 463


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327189300|gb|EGE56468.1| fumarate hydratase protein, class II [Rhizobium etli CNPAF512] Length = 463 Back     alignment and organism information
>gi|222086218|ref|YP_002544750.1| fumarate hydratase, class II [Agrobacterium radiobacter K84] Length = 463 Back     alignment and organism information
>gi|190892062|ref|YP_001978604.1| fumarate hydratase protein, class II [Rhizobium etli CIAT 652] Length = 463 Back     alignment and organism information
>gi|150396785|ref|YP_001327252.1| fumarate hydratase [Sinorhizobium medicae WSM419] Length = 482 Back     alignment and organism information
>gi|209549609|ref|YP_002281526.1| fumarate hydratase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 463 Back     alignment and organism information
>gi|195970163|ref|NP_385965.3| fumarate hydratase [Sinorhizobium meliloti 1021] Length = 473 Back     alignment and organism information
>gi|86357998|ref|YP_469890.1| fumarate hydratase [Rhizobium etli CFN 42] Length = 463 Back     alignment and organism information
>gi|307318579|ref|ZP_07598013.1| fumarate hydratase, class II [Sinorhizobium meliloti AK83] Length = 497 Back     alignment and organism information
>gi|39931618|sp|Q92PB6|FUMC_RHIME RecName: Full=Fumarate hydratase class II; Short=Fumarase C Length = 463 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target463 fumarate hydratase [Candidatus Liberibacter asiaticus s
cd01596450 cd01596, Aspartase_like, aspartase (L-aspartate ammonia 0.0
COG0114462 COG0114, FumC, Fumarase [Energy production and conversi 0.0
KOG1317487 KOG1317, KOG1317, KOG1317, Fumarase [Energy production 0.0
PRK00485464 PRK00485, fumC, fumarate hydratase; Reviewed 0.0
TIGR00979458 TIGR00979, fumC_II, fumarate hydratase, class II 0.0
PLN00134458 PLN00134, PLN00134, fumarate hydratase; Provisional 0.0
PRK12273472 PRK12273, aspA, aspartate ammonia-lyase; Provisional 1e-161
PRK12425464 PRK12425, PRK12425, fumarate hydratase; Provisional 1e-160
cd01357450 cd01357, Aspartase, Aspartase 1e-155
PRK13353473 PRK13353, PRK13353, aspartate ammonia-lyase; Provisiona 1e-152
COG1027471 COG1027, AspA, Aspartate ammonia-lyase [Amino acid tran 1e-138
TIGR00839468 TIGR00839, aspA, aspartate ammonia-lyase 1e-121
PRK14515479 PRK14515, PRK14515, aspartate ammonia-lyase; Provisiona 1e-109
COG0165459 COG0165, ArgH, Argininosuccinate lyase [Amino acid tran 8e-18
cd01362455 cd01362, Fumarase_classII, Class II fumarases 0.0
pfam00206312 pfam00206, Lyase_1, Lyase 1e-102
cd01334325 cd01334, Lyase_I, Lyase class I family; a group of prot 2e-96
PLN02646474 PLN02646, PLN02646, argininosuccinate lyase 1e-05
cd01594231 cd01594, Lyase_I_like, Lyase class I_like superfamily: 2e-47
TIGR00928435 TIGR00928, purB, adenylosuccinate lyase 2e-18
COG0015438 COG0015, PurB, Adenylosuccinate lyase [Nucleotide trans 7e-23
PRK08540449 PRK08540, PRK08540, adenylosuccinate lyase; Reviewed 4e-13
PRK12308 614 PRK12308, PRK12308, bifunctional argininosuccinate lyas 2e-11
KOG1316464 KOG1316, KOG1316, KOG1316, Argininosuccinate lyase [Ami 9e-08
PRK04833455 PRK04833, PRK04833, argininosuccinate lyase; Provisiona 1e-07
cd01595381 cd01595, Adenylsuccinate_lyase_like, Adenylsuccinate ly 5e-21
cd01597437 cd01597, pCLME, prokaryotic 3-carboxy-cis,cis-muconate 9e-12
cd03302436 cd03302, Adenylsuccinate_lyase_2, Adenylsuccinate lyase 9e-08
PRK00855459 PRK00855, PRK00855, argininosuccinate lyase; Provisiona 6e-04
pfam1041555 pfam10415, FumaraseC_C, Fumarase C C-terminus 4e-17
cd01360387 cd01360, Adenylsuccinate_lyase_1, Adenylsuccinate lyase 8e-15
PRK06390451 PRK06390, PRK06390, adenylosuccinate lyase; Provisional 4e-13
TIGR02426338 TIGR02426, protocat_pcaB, 3-carboxy-cis,cis-muconate cy 2e-09
cd01598425 cd01598, PurB, PurB_like adenylosuccinases (adenylsucci 1e-08
PRK09285456 PRK09285, PRK09285, adenylosuccinate lyase; Provisional 4e-08
PLN02848458 PLN02848, PLN02848, adenylosuccinate lyase 1e-05
PRK09053452 PRK09053, PRK09053, 3-carboxy-cis,cis-muconate cycloiso 4e-05
PRK08470442 PRK08470, PRK08470, adenylosuccinate lyase; Provisional 4e-05
TIGR00838455 TIGR00838, argH, argininosuccinate lyase 2e-13
cd01359435 cd01359, Argininosuccinate_lyase, Argininosuccinate lya 8e-09
PRK02186887 PRK02186, PRK02186, argininosuccinate lyase; Provisiona 5e-06
KOG2700481 KOG2700, KOG2700, KOG2700, Adenylosuccinate lyase [Nucl 9e-06
PRK08937216 PRK08937, PRK08937, adenylosuccinate lyase; Provisional 2e-05
>gnl|CDD|176468 cd01596, Aspartase_like, aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes Back     alignment and domain information
>gnl|CDD|30463 COG0114, FumC, Fumarase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36531 KOG1317, KOG1317, KOG1317, Fumarase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179045 PRK00485, fumC, fumarate hydratase; Reviewed Back     alignment and domain information
>gnl|CDD|130052 TIGR00979, fumC_II, fumarate hydratase, class II Back     alignment and domain information
>gnl|CDD|177743 PLN00134, PLN00134, fumarate hydratase; Provisional Back     alignment and domain information
>gnl|CDD|183393 PRK12273, aspA, aspartate ammonia-lyase; Provisional Back     alignment and domain information
>gnl|CDD|171490 PRK12425, PRK12425, fumarate hydratase; Provisional Back     alignment and domain information
>gnl|CDD|176462 cd01357, Aspartase, Aspartase Back     alignment and domain information
>gnl|CDD|183992 PRK13353, PRK13353, aspartate ammonia-lyase; Provisional Back     alignment and domain information
>gnl|CDD|31230 COG1027, AspA, Aspartate ammonia-lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162062 TIGR00839, aspA, aspartate ammonia-lyase Back     alignment and domain information
>gnl|CDD|184723 PRK14515, PRK14515, aspartate ammonia-lyase; Provisional Back     alignment and domain information
>gnl|CDD|30514 COG0165, ArgH, Argininosuccinate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|176465 cd01362, Fumarase_classII, Class II fumarases Back     alignment and domain information
>gnl|CDD|143963 pfam00206, Lyase_1, Lyase Back     alignment and domain information
>gnl|CDD|176461 cd01334, Lyase_I, Lyase class I family; a group of proteins which catalyze similar beta-elimination reactions Back     alignment and domain information
>gnl|CDD|178252 PLN02646, PLN02646, argininosuccinate lyase Back     alignment and domain information
>gnl|CDD|176466 cd01594, Lyase_I_like, Lyase class I_like superfamily: contains the lyase class I family, histidine ammonia-lyase and phenylalanine ammonia-lyase, which catalyze similar beta-elimination reactions Back     alignment and domain information
>gnl|CDD|162114 TIGR00928, purB, adenylosuccinate lyase Back     alignment and domain information
>gnl|CDD|30365 COG0015, PurB, Adenylosuccinate lyase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181463 PRK08540, PRK08540, adenylosuccinate lyase; Reviewed Back     alignment and domain information
>gnl|CDD|183425 PRK12308, PRK12308, bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>gnl|CDD|36530 KOG1316, KOG1316, KOG1316, Argininosuccinate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179883 PRK04833, PRK04833, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|176467 cd01595, Adenylsuccinate_lyase_like, Adenylsuccinate lyase (ASL)_like Back     alignment and domain information
>gnl|CDD|176469 cd01597, pCLME, prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like Back     alignment and domain information
>gnl|CDD|176471 cd03302, Adenylsuccinate_lyase_2, Adenylsuccinate lyase (ASL)_subgroup 2 Back     alignment and domain information
>gnl|CDD|179143 PRK00855, PRK00855, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|150996 pfam10415, FumaraseC_C, Fumarase C C-terminus Back     alignment and domain information
>gnl|CDD|176464 cd01360, Adenylsuccinate_lyase_1, Adenylsuccinate lyase (ASL)_subgroup 1 Back     alignment and domain information
>gnl|CDD|180551 PRK06390, PRK06390, adenylosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|162853 TIGR02426, protocat_pcaB, 3-carboxy-cis,cis-muconate cycloisomerase Back     alignment and domain information
>gnl|CDD|176470 cd01598, PurB, PurB_like adenylosuccinases (adenylsuccinate lyase, ASL) Back     alignment and domain information
>gnl|CDD|181757 PRK09285, PRK09285, adenylosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|178440 PLN02848, PLN02848, adenylosuccinate lyase Back     alignment and domain information
>gnl|CDD|181627 PRK09053, PRK09053, 3-carboxy-cis,cis-muconate cycloisomerase; Provisional Back     alignment and domain information
>gnl|CDD|181437 PRK08470, PRK08470, adenylosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|129918 TIGR00838, argH, argininosuccinate lyase Back     alignment and domain information
>gnl|CDD|176463 cd01359, Argininosuccinate_lyase, Argininosuccinate lyase (argininosuccinase, ASAL) Back     alignment and domain information
>gnl|CDD|167327 PRK02186, PRK02186, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|37911 KOG2700, KOG2700, KOG2700, Adenylosuccinate lyase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181586 PRK08937, PRK08937, adenylosuccinate lyase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 463 fumarate hydratase [Candidatus Liberibacter asiaticus s
TIGR00979459 fumC_II fumarate hydratase, class II; InterPro: IPR0056 100.0
PRK12273471 aspA aspartate ammonia-lyase; Provisional 100.0
PRK12425464 fumarate hydratase; Provisional 100.0
PRK00485462 fumC fumarate hydratase; Reviewed 100.0
PRK13353473 aspartate ammonia-lyase; Provisional 100.0
COG0114462 FumC Fumarase [Energy production and conversion] 100.0
TIGR00839469 aspA aspartate ammonia-lyase; InterPro: IPR004708 A num 100.0
cd01362455 Fumarase_classII Class II fumarases. This group contain 100.0
cd01357450 Aspartatase Aspartase_like. This group contains protein 100.0
cd01596450 Aspartatase_like Aspartase_like. This group contains pr 100.0
COG1027471 AspA Aspartate ammonia-lyase [Amino acid transport and 100.0
KOG1317487 consensus 100.0
cd01597437 pCLME pCLME: prokaryotic 3-carboxy-cis,cis-muconate cyc 100.0
PRK09053452 3-carboxy-cis,cis-muconate cycloisomerase; Provisional 100.0
PRK08540449 adenylosuccinate lyase; Reviewed 100.0
TIGR00838469 argH argininosuccinate lyase; InterPro: IPR009049 This 100.0
PRK00855459 argininosuccinate lyase; Provisional 100.0
PRK04833455 argininosuccinate lyase; Provisional 100.0
PRK08937425 adenylosuccinate lyase; Provisional 100.0
PRK06390451 adenylosuccinate lyase; Provisional 100.0
COG0165459 ArgH Argininosuccinate lyase [Amino acid transport and 100.0
PRK12308 614 bifunctional argininosuccinate lyase/N-acetylglutamate 100.0
COG0015438 PurB Adenylosuccinate lyase [Nucleotide transport and m 100.0
PRK02186892 argininosuccinate lyase; Provisional 100.0
KOG1316464 consensus 100.0
pfam00206312 Lyase_1 Lyase. 100.0
cd01359435 Argininosuccinate_lyase Argininosuccinate lyase (argini 100.0
PRK07380431 adenylosuccinate lyase; Provisional 100.0
PRK07492433 adenylosuccinate lyase; Provisional 100.0
PRK06705502 argininosuccinate lyase; Provisional 100.0
PRK08470442 adenylosuccinate lyase; Provisional 100.0
TIGR00928469 purB adenylosuccinate lyase; InterPro: IPR004769 A numb 100.0
cd03302436 Adenylsuccinate_lyase_2 Adenylsuccinate lyase_2: Adenyl 100.0
PRK06389434 argininosuccinate lyase; Provisional 100.0
cd01598425 PurB PurB: PurB_like adenylosuccinases (adenylsuccinate 100.0
KOG2700481 consensus 100.0
cd01334330 Lyase_I Lyase class I family of the Lyase_I superfamily 100.0
TIGR02426351 protocat_pcaB 3-carboxy-cis,cis-muconate cycloisomerase 100.0
PRK05975353 3-carboxy-cis,cis-muconate cycloisomerase; Provisional 100.0
cd01595381 Adenylsuccinate_lyase_like Adenylsuccinate lyase_like ( 100.0
cd01360387 Adenylsuccinate_lyase_1 Adenylsuccinate lyase_1: Adenyl 100.0
PRK09285456 adenylosuccinate lyase; Provisional 100.0
cd01594231 Lyase_I_like Lyase class I_like. Lyase class I_like sup 100.0
pfam1041555 FumaraseC_C Fumarase C C-terminus. Fumarase C catalyses 99.54
pfam1039781 ADSL_C Adenylosuccinate lyase C-terminus. This is the C 97.71
KOG2700481 consensus 94.81
>TIGR00979 fumC_II fumarate hydratase, class II; InterPro: IPR005677 Fumarase C catalyzes the stereospecific interconversion of fumarate to L-malate as part of the metabolic citric acid or Kreb's cycle Back     alignment and domain information
>PRK12273 aspA aspartate ammonia-lyase; Provisional Back     alignment and domain information
>PRK12425 fumarate hydratase; Provisional Back     alignment and domain information
>PRK00485 fumC fumarate hydratase; Reviewed Back     alignment and domain information
>PRK13353 aspartate ammonia-lyase; Provisional Back     alignment and domain information
>COG0114 FumC Fumarase [Energy production and conversion] Back     alignment and domain information
>TIGR00839 aspA aspartate ammonia-lyase; InterPro: IPR004708 A number of enzymes, belonging to the lyase class, for which fumarate is a substrate have been shown , to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes Back     alignment and domain information
>cd01362 Fumarase_classII Class II fumarases Back     alignment and domain information
>cd01357 Aspartatase Aspartase_like Back     alignment and domain information
>cd01596 Aspartatase_like Aspartase_like Back     alignment and domain information
>COG1027 AspA Aspartate ammonia-lyase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1317 consensus Back     alignment and domain information
>cd01597 pCLME pCLME: prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like This group contains proteins similar to pCLME, a member of the Lyase class I family Back     alignment and domain information
>PRK09053 3-carboxy-cis,cis-muconate cycloisomerase; Provisional Back     alignment and domain information
>PRK08540 adenylosuccinate lyase; Reviewed Back     alignment and domain information
>TIGR00838 argH argininosuccinate lyase; InterPro: IPR009049 This entry represents argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens Back     alignment and domain information
>PRK00855 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK04833 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK08937 adenylosuccinate lyase; Provisional Back     alignment and domain information
>PRK06390 adenylosuccinate lyase; Provisional Back     alignment and domain information
>COG0165 ArgH Argininosuccinate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>COG0015 PurB Adenylosuccinate lyase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>KOG1316 consensus Back     alignment and domain information
>pfam00206 Lyase_1 Lyase Back     alignment and domain information
>cd01359 Argininosuccinate_lyase Argininosuccinate lyase (argininosuccinase, ASAL) Back     alignment and domain information
>PRK07380 adenylosuccinate lyase; Provisional Back     alignment and domain information
>PRK07492 adenylosuccinate lyase; Provisional Back     alignment and domain information
>PRK06705 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK08470 adenylosuccinate lyase; Provisional Back     alignment and domain information
>TIGR00928 purB adenylosuccinate lyase; InterPro: IPR004769 A number of enzymes, belonging to the lyase class, for which fumarate is a substrate have been shown , to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes Back     alignment and domain information
>cd03302 Adenylsuccinate_lyase_2 Adenylsuccinate lyase_2: Adenylsuccinate lyase (ASL)_subgroup 2 Back     alignment and domain information
>PRK06389 argininosuccinate lyase; Provisional Back     alignment and domain information
>cd01598 PurB PurB: PurB_like adenylosuccinases (adenylsuccinate lyase, ASL) Back     alignment and domain information
>KOG2700 consensus Back     alignment and domain information
>cd01334 Lyase_I Lyase class I family of the Lyase_I superfamily Back     alignment and domain information
>TIGR02426 protocat_pcaB 3-carboxy-cis,cis-muconate cycloisomerase; InterPro: IPR012789 Proteins in this entry are 3-carboxy-cis,cis-muconate cycloisomerases, which catalyse the second step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA Back     alignment and domain information
>PRK05975 3-carboxy-cis,cis-muconate cycloisomerase; Provisional Back     alignment and domain information
>cd01595 Adenylsuccinate_lyase_like Adenylsuccinate lyase_like (ASL_like): This subgroup contains proteins similar to ASL and prokaryotic-type 3-carboxy-cis,cis-muconate cycloisomerase (pCMLE) Back     alignment and domain information
>cd01360 Adenylsuccinate_lyase_1 Adenylsuccinate lyase_1: Adenylsuccinate lyase (ASL)_subgroup 1 Back     alignment and domain information
>PRK09285 adenylosuccinate lyase; Provisional Back     alignment and domain information
>cd01594 Lyase_I_like Lyase class I_like Back     alignment and domain information
>pfam10415 FumaraseC_C Fumarase C C-terminus Back     alignment and domain information
>pfam10397 ADSL_C Adenylosuccinate lyase C-terminus Back     alignment and domain information
>KOG2700 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target463 fumarate hydratase [Candidatus Liberibacter asiaticus s
1yfm_A488 Recombinant Yeast Fumarase Length = 488 1e-155
3e04_A490 Crystal Structure Of Human Fumarate Hydratase Lengt 1e-154
1vdk_A466 Crystal Structure Of Fumarase From Thermus Thermoph 1e-150
1kq7_A467 E315q Mutant Form Of Fumarase C From E.Coli Length 1e-150
1fuo_A467 Fumarase C With Bound Citrate Length = 467 1e-150
1fur_A467 Fumarase Mutant H188n With Bound Substrate L-Malate 1e-150
2fus_A467 Mutations Of Fumarase That Distinguish Between The 1e-149
1fup_A472 Fumarase With Bound Pyromellitic Acid Length = 472 1e-149
3gtd_A482 2.4 Angstrom Crystal Structure Of Fumarate Hydratas 1e-149
1j3u_A468 Crystal Structure Of Aspartase From Bacillus Sp. Ym 1e-144
1jsw_A478 Native L-Aspartate Ammonia Lyase Length = 478 1e-134
3qbp_A478 Crystal Structure Of Fumarase Fum From Mycobacteriu 1e-125
3oce_A474 Crystal Structure Of Fumarate Lyase:delta Crystalli 1e-124
3no9_A475 Crystal Structure Of Apo Fumarate Hydratase From My 1e-123
3ocf_A478 Crystal Structure Of Fumarate Lyase:delta Crystalli 1e-123
2e9f_B454 Crystal Structure Of T.Th.Hb8 Argininosuccinate Lya 5e-39
2e9f_A462 Crystal Structure Of T.Th.Hb8 Argininosuccinate Lya 7e-39
1re5_A450 Crystal Structure Of 3-Carboxy-Cis,Cis-Muconate Lac 2e-37
1q5n_A454 Crystal Structure Of Beta-Carboxy-Cis,Cis-Muconate 5e-37
1f1o_A431 Structural Studies Of Adenylosuccinate Lyases Lengt 3e-32
2x75_A431 Staphylococcus Aureus Adenylosuccinate Lyase Length 6e-32
1aos_A464 Human Argininosuccinate Lyase Length = 464 5e-31
1k62_A464 Crystal Structure Of The Human Argininosuccinate Ly 9e-31
1dcn_A447 Inactive Mutant H162n Of Delta 2 Crystallin With Bo 1e-30
1tjv_A474 Crystal Structure Of T161d Duck Delta 2 Crystallin 2e-30
1hy1_A468 Crystal Structure Of Wild Type Duck Delta 2 Crystal 2e-30
1tju_A474 Crystal Structure Of T161s Duck Delta 2 Crystallin 2e-30
2pfm_A444 Crystal Structure Of Adenylosuccinate Lyase (Purb) 7e-30
1auw_A468 H91n Delta 2 Crystallin From Duck Length = 468 1e-29
1xwo_A465 Crystal Structrue Of Goose Delta Crystallin Length 1e-29
1u15_A472 Crystal Structure Of A Duck-Delta-Crystallin-1 Doub 7e-29
1k7w_A468 Crystal Structure Of S283a Duck Delta 2 Crystallin 8e-29
1hy0_A466 Crystal Structure Of Wild Type Duck Delta 1 Crystal 1e-27
1i0a_A466 Crystal Structure Of Wild Type Turkey Delta 1 Cryst 5e-24
1dof_A403 The Crystal Structure Of Adenylosuccinate Lyase Fro 3e-05
1tj7_A457 Structure Determination And Refinement At 2.44 A Re 7e-37
1c3c_A429 T. Maritima Adenylosuccinate Lyase Length = 429 1e-29
1c3u_A431 T. Maritima Adenylosuccinate Lyase Length = 431 1e-29
3c8t_A451 Crystal Structure Of Fumarate Lyase From Mesorhizob 5e-29
2vd6_A503 Human Adenylosuccinate Lyase In Complex With Its Su 5e-15
2j91_A503 Crystal Structure Of Human Adenylosuccinate Lyase I 5e-15
2fel_A359 3-Carboxy-Cis,Cis-Muconate Lactonizing Enzyme From 2e-13
2ptq_A462 Crystal Structure Of Escherichia Coli Adenylosuccin 4e-11
2ptr_A462 Crystal Structure Of Escherichia Coli Adenylosuccin 5e-11
2pts_A462 Crystal Structure Of Wild Type Escherichia Coli Ade 3e-10
1yis_A478 Structural Genomics Of Caenorhabditis Elegans: Aden 1e-06
2qga_B465 Plasmodium Vivax Adenylosuccinate Lyase Pv003765 Wi 7e-13
2hvg_A482 Crystal Structure Of Adenylosuccinate Lyase From Pl 6e-12
3gzh_A482 Crystal Structure Of Phosphate-Bound Adenylosuccina 2e-11
3bhg_A459 Crystal Structure Of Adenylosuccinate Lyase From Le 3e-07
>gi|157834306|pdb|1YFM|A Chain A, Recombinant Yeast Fumarase Length = 488 Back     alignment and structure
 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 287/463 (61%), Positives = 350/463 (75%), Gaps = 3/463 (0%)

Query: 2   TNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGE--EKQPLVIIRALGIIKQAAARVN 59
           ++ R E D+FG + V  D+YWGAQ QRS +NFKIG   E+ PL ++ A G++K++AA VN
Sbjct: 26  SSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVN 85

Query: 60  IELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILG 119
             LG LDPKI +AI +A++EV +GKLDDHFPLVV+QTGSGTQSNMN NEVISNRAIEILG
Sbjct: 86  ESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILG 145

Query: 120 GVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQ 179
           G +GSK  VHPN+H N  QSSNDT+PT +HIA + +I + L+P L NL  AL  K  +F 
Sbjct: 146 GKIGSKQ-VHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFD 204

Query: 180 DIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTP 239
            I+KIGRTH QDATPLTLGQEFSGY  QV+N I+R+  +L  L  LAQGGTAVGTGLNT 
Sbjct: 205 HIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTK 264

Query: 240 VGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLG 299
            GF  K+A+ I   TGL F TAPN+FEALA HDAI  C GA+NT A +LFKIA DIR+LG
Sbjct: 265 PGFDVKIAEQISKETGLKFQTAPNRFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLG 324

Query: 300 SGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELN 359
           SGPR G  ELMLPENEPGSSIMPGKVNPTQ EA+TQVC  + GN+AAITFA SQG FELN
Sbjct: 325 SGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELN 384

Query: 360 VYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYD 419
           V+KP++  N+L SI+L++D+  SF ++C+EGI+A +  I   L +SLMLVTAL  KIGYD
Sbjct: 385 VFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYD 444

Query: 420 NASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMIYP 462
            AS +AK AH    TLKE A+  G+++  E+D  V PE M+ P
Sbjct: 445 AASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGP 487


>gi|196049942|pdb|3E04|A Chain A, Crystal Structure Of Human Fumarate Hydratase Length = 490 Back     alignment and structure
>gi|48425891|pdb|1VDK|A Chain A, Crystal Structure Of Fumarase From Thermus Thermophilus Hb8 Length = 466 Back     alignment and structure
>gi|23200276|pdb|1KQ7|A Chain A, E315q Mutant Form Of Fumarase C From E.Coli Length = 467 Back     alignment and structure
gi|1942160|pdb|1FUO|A Chain A, Fumarase C With Bound Citrate Length = 467 Back     alignment and structure
>gi|2392342|pdb|1FUR|A Chain A, Fumarase Mutant H188n With Bound Substrate L-Malate At Putative Activator Site Length = 467 Back     alignment and structure
>gi|2392682|pdb|2FUS|A Chain A, Mutations Of Fumarase That Distinguish Between The Active Site And A Nearby Dicarboxylic Acid Binding Site Length = 467 Back     alignment and structure
>gi|1942162|pdb|1FUP|A Chain A, Fumarase With Bound Pyromellitic Acid Length = 472 Back     alignment and structure
>gi|254221004|pdb|3GTD|A Chain A, 2.4 Angstrom Crystal Structure Of Fumarate Hydratase From Rickettsia Prowazekii Length = 482 Back     alignment and structure
>gi|30749354|pdb|1J3U|A Chain A, Crystal Structure Of Aspartase From Bacillus Sp. Ym55-1 Length = 468 Back     alignment and structure
gi|2392396|pdb|1JSW|A Chain A, Native L-Aspartate Ammonia Lyase Length = 478 Back     alignment and structure
>gi|320089966|pdb|3QBP|A Chain A, Crystal Structure Of Fumarase Fum From Mycobacterium Marinum Length = 478 Back     alignment and structure
>gi|303325214|pdb|3OCE|A Chain A, Crystal Structure Of Fumarate Lyase:delta Crystallin From Brucella Melitensis Bound To Cobalt Length = 474 Back     alignment and structure
>gi|300508783|pdb|3NO9|A Chain A, Crystal Structure Of Apo Fumarate Hydratase From Mycobacterium Tuberculosis Length = 475 Back     alignment and structure
>gi|303325218|pdb|3OCF|A Chain A, Crystal Structure Of Fumarate Lyase:delta Crystallin From Brucella Melitensis In Native Form Length = 478 Back     alignment and structure
gi|157834857|pdb|2E9F|A Chain A, Crystal Structure Of T.Th.Hb8 Argininosuccinate Lyase Complexed With L-Arginine Length = 462 Back     alignment and structure
>gi|49258707|pdb|1RE5|A Chain A, Crystal Structure Of 3-Carboxy-Cis,Cis-Muconate Lactonizing Enzyme From Pseudomonas Putida Length = 450 Back     alignment and structure
>gi|34810579|pdb|1Q5N|A Chain A, Crystal Structure Of Beta-Carboxy-Cis,Cis-Muconate Cycloisomerase (Cmle) From Acinetobacter Calcoaceticus Sp. Adp1 Length = 454 Back     alignment and structure
gi|13096694|pdb|1F1O|A Chain A, Structural Studies Of Adenylosuccinate Lyases Length = 431 Back     alignment and structure
gi|290789885|pdb|2X75|A Chain A, Staphylococcus Aureus Adenylosuccinate Lyase Length = 431 Back     alignment and structure
>gi|2914651|pdb|1AOS|A Chain A, Human Argininosuccinate Lyase Length = 464 Back     alignment and structure
>gi|18655512|pdb|1K62|A Chain A, Crystal Structure Of The Human Argininosuccinate Lyase Q286r Mutant Length = 464 Back     alignment and structure
>gi|157872869|pdb|1DCN|A Chain A, Inactive Mutant H162n Of Delta 2 Crystallin With Bound Argininosuccinate Length = 447 Back     alignment and structure
>gi|55669957|pdb|1TJV|A Chain A, Crystal Structure Of T161d Duck Delta 2 Crystallin Mutant Length = 474 Back     alignment and structure
gi|14278423|pdb|1HY1|A Chain A, Crystal Structure Of Wild Type Duck Delta 2 Crystallin (Eye Lens Protein) Length = 468 Back     alignment and structure
>gi|55669953|pdb|1TJU|A Chain A, Crystal Structure Of T161s Duck Delta 2 Crystallin Mutant Length = 474 Back     alignment and structure
>gi|146387382|pdb|2PFM|A Chain A, Crystal Structure Of Adenylosuccinate Lyase (Purb) From Bacillus Anthracis Length = 444 Back     alignment and structure
>gi|2981709|pdb|1AUW|A Chain A, H91n Delta 2 Crystallin From Duck Length = 468 Back     alignment and structure
>gi|82407488|pdb|1XWO|A Chain A, Crystal Structrue Of Goose Delta Crystallin Length = 465 Back     alignment and structure
>gi|55670107|pdb|1U15|A Chain A, Crystal Structure Of A Duck-Delta-Crystallin-1 Double Loop Mutant (Dlm) Length = 472 Back     alignment and structure
>gi|20150709|pdb|1K7W|A Chain A, Crystal Structure Of S283a Duck Delta 2 Crystallin Mutant Length = 468 Back     alignment and structure
>gi|14278421|pdb|1HY0|A Chain A, Crystal Structure Of Wild Type Duck Delta 1 Crystallin (Eye Lens Protein) Length = 466 Back     alignment and structure
gi|14278427|pdb|1I0A|A Chain A, Crystal Structure Of Wild Type Turkey Delta 1 Crystallin (Eye Lens Protein) Length = 466 Back     alignment and structure
>gi|13096685|pdb|1DOF|A Chain A, The Crystal Structure Of Adenylosuccinate Lyase From Pyrobaculum Aerophilum: Insights Into Thermal Stability And Human Pathology Length = 403 Back     alignment and structure
gi|56553869|pdb|1TJ7|A Chain A, Structure Determination And Refinement At 2.44 A Resolution Of Argininosuccinate Lyase From E. Coli Length = 457 Back     alignment and structure
>gi|7245816|pdb|1C3C|A Chain A, T. Maritima Adenylosuccinate Lyase Length = 429 Back     alignment and structure
gi|7245290|pdb|1C3U|A Chain A, T. Maritima Adenylosuccinate Lyase Length = 431 Back     alignment and structure
>gi|169791879|pdb|3C8T|A Chain A, Crystal Structure Of Fumarate Lyase From Mesorhizobium Sp. Bnc1 Length = 451 Back     alignment and structure
>gi|159795583|pdb|2VD6|A Chain A, Human Adenylosuccinate Lyase In Complex With Its Substrate N6-(1,2-Dicarboxyethyl)-Amp, And Its Products Amp And Fumarate. Length = 503 Back     alignment and structure
>gi|119390451|pdb|2J91|A Chain A, Crystal Structure Of Human Adenylosuccinate Lyase In Complex With Amp Length = 503 Back     alignment and structure
>gi|118137741|pdb|2FEL|A Chain A, 3-Carboxy-Cis,Cis-Muconate Lactonizing Enzyme From Agrobacterium Radiobacter S2 Length = 359 Back     alignment and structure
>gi|151567888|pdb|2PTQ|A Chain A, Crystal Structure Of Escherichia Coli Adenylosuccinate Lyase Mutant H171n With Bound Amp And Fumarate Length = 462 Back     alignment and structure
>gi|151567890|pdb|2PTR|A Chain A, Crystal Structure Of Escherichia Coli Adenylosuccinate Lyase Mutant H171a With Bound Adenylosuccinate Substrate Length = 462 Back     alignment and structure
>gi|151567892|pdb|2PTS|A Chain A, Crystal Structure Of Wild Type Escherichia Coli Adenylosuccinate Lyase Length = 462 Back     alignment and structure
>gi|60594392|pdb|1YIS|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Adenylosuccinate Lyase Length = 478 Back     alignment and structure
>gi|157835920|pdb|2QGA|B Chain B, Plasmodium Vivax Adenylosuccinate Lyase Pv003765 With Amp Bound Length = 465 Back     alignment and structure
>gi|114794583|pdb|2HVG|A Chain A, Crystal Structure Of Adenylosuccinate Lyase From Plasmodium Vivax Length = 482 Back     alignment and structure
>gi|256599714|pdb|3GZH|A Chain A, Crystal Structure Of Phosphate-Bound Adenylosuccinate Lyase From E. Coli Length = 482 Back     alignment and structure
>gi|161761247|pdb|3BHG|A Chain A, Crystal Structure Of Adenylosuccinate Lyase From Legionella Pneumophila Length = 459 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target463 fumarate hydratase [Candidatus Liberibacter asiaticus s
3gtd_A482 Fumarase C, fumarate hydratase class II; structural gen 1e-153
3ocf_A478 Fumarate lyase:delta crystallin; fumarase, brucellosis, 1e-150
3e04_A490 Fumarase, fumarate hydratase; TCA cycle, structural gen 1e-143
1jsw_A478 L-aspartase, L-aspartate ammonia-lyase; amino acid ammo 1e-143
1j3u_A468 Aspartase; multi-domains, lyase; 2.50A {Bacillus SP} SC 1e-141
1fur_A467 Fumarase C, FUMC; hydrolyase, carbon oxygen lyase, KREB 1e-141
3no9_A475 Fumarase C, fumarate hydratase class II; APO, structura 1e-137
1yfm_A488 Fumarase, YFUM; lyase, krebs cycle, active site water, 1e-136
1vdk_A466 Fumarase C, fumarate hydratase class II; TCA cycle, rik 1e-124
1k7w_A468 Delta 2 crystallin; eye lens protein, argininosuccinate 6e-45
1q5n_A454 3-carboxy-CIS,CIS-muconate cycloisomerase; CMLE, aromat 3e-66
2pfm_A444 Adenylosuccinate lyase; PURB, purine biosynthesis; 2.00 1e-44
2e9f_A462 Argininosuccinate lyase; alpha helix bundle; HET: ARG; 5e-41
1re5_A450 3-carboxy-CIS,CIS-muconate cycloisomerase; homotetramer 5e-39
2ptr_A462 Adenylosuccinate lyase; mutant-substrate complex; HET: 9e-33
3bhg_A459 Adenylosuccinate lyase; structural genomics, PSI-2, pro 3e-32
1c3c_A429 Protein (adenylosuccinate lyase); purine biosynthesis; 4e-32
1dof_A403 Adenylosuccinate lyase; purine biosynthesis; 2.10A {Pyr 6e-32
2qga_B465 Adenylosuccinate lyase; malaria, PV003765, SGC, structu 1e-30
1tj7_A457 Argininosuccinate lyase; crystallin, E. coli, fumarase, 3e-29
3c8t_A451 Fumarate lyase; structural genomics, PSI-2, protein str 6e-29
2j91_A503 Adenylosuccinate lyase; disease mutation, adenylosuccin 7e-27
1yis_A478 Adenylosuccinate lyase; structural genomics, PSI, prote 2e-21
2fel_A359 3-carboxy-CIS,CIS-muconate lactonizing enzyme; biodegra 2e-20
>3gtd_A Fumarase C, fumarate hydratase class II; structural genomics, ssgcid, cytoplasm, lyase, tricarboxylic acid cycle; 2.40A {Rickettsia prowazekii} Length = 482 Back     alignment and structure
 Score =  537 bits (1384), Expect = e-153
 Identities = 270/460 (58%), Positives = 334/460 (72%)

Query: 1   MTNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVIIRALGIIKQAAARVNI 60
           M N R E DSFG ++++E  YWGAQ QRSL NFKI ++K P ++IRAL I+K+ AA+VN 
Sbjct: 22  MKNYRIESDSFGEIQIEEKFYWGAQTQRSLNNFKISKQKMPKILIRALAILKKCAAQVNY 81

Query: 61  ELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGG 120
           E G L+ KI  +I KA + ++ G+ +D+FPLVVWQTGSGTQ+NMN+NEVI++ A E L G
Sbjct: 82  EFGDLEYKIATSIDKAIDRILAGEFEDNFPLVVWQTGSGTQTNMNMNEVIASIANEELTG 141

Query: 121 VMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPTLRNLHVALTKKISDFQD 180
             G K PVHPNDHVN  QSSND++PTA+HIA       +L+P L NL   L  K  D+  
Sbjct: 142 KKGGKFPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPALNNLLTYLQDKSKDWDK 201

Query: 181 IIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGLYELAQGGTAVGTGLNTPV 240
           IIKIGRTH QDATPLTL QEFSGY TQ++ +++RIE  L  +Y LAQGGTAVGTG+N+ +
Sbjct: 202 IIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGTAVGTGINSKI 261

Query: 241 GFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAINTSATALFKIANDIRFLGS 300
           GF  K AQ + + T  PF TAPNKFE+LA HDA+    G +NT A +L KIANDIR LGS
Sbjct: 262 GFDIKFAQKVAEFTQQPFKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGS 321

Query: 301 GPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHIFGNHAAITFANSQGHFELNV 360
           GPR GLGEL LPENEPGSSIMPGKVNPTQ EA+T VC  + GNH  +T A S GH ELNV
Sbjct: 322 GPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHLELNV 381

Query: 361 YKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTSKIGYDN 420
           +KP+I YN+LQSI+LLSDS++SF  +C++G++     I    ++SLMLVT L   IGYDN
Sbjct: 382 FKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTLRDKSLMLVTVLNPHIGYDN 441

Query: 421 ASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEKMI 460
           A+ IAK+AH    TLKE A     +S  E+D IV PEKMI
Sbjct: 442 AAKIAKEAHKYGITLKEAAKKLNFLSEEEFDKIVVPEKMI 481