254780191

254780191

alanyl-tRNA synthetase

GeneID in NCBI database:8209171Locus tag:CLIBASIA_00380
Protein GI in NCBI database:254780191Protein Accession:YP_003064604.1
Gene range:-(77784, 80480)Protein Length:898aa
Gene description:alanyl-tRNA synthetase
COG prediction:[J] Alanyl-tRNA synthetase
KEGG prediction:alaS; alanyl-tRNA synthetase (EC:6.1.1.7); K01872 alanyl-tRNA synthetase [EC:6.1.1.7]
SEED prediction:Alanyl-tRNA synthetase (EC 6.1.1.7)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Ala
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------90
MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK
cccHHHHHHHHHHHHHHcccEEEEcccccccccccEEEEEcccccccHHccccccccccccccccccEEcccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEcccHHHHHHHHHHHccccHHHEEEcccccccccccccccccccEEEEEEcccccccccccccccccEEEEEEEEEEEEccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccEEEcccccccccccccccccccccccccccccccEEEEEEEEcccEEEEEccccEEEEEEcccccccccccccccEEEEEEccEEEEEEEEEEccccEEEEEEEccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccEEcccEEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHcHHHHcccccccEEEEEEccccccccEEEccccccccccccccccEEEEEEEccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEccccccEEEEEEEcHHHHccccHHHHHHHHHHHHccccccccHHHHccccccHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHcccEEEccccccccccccEEEEcccccccccccccccccccccccccccEEccccccccHHccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHEEEEEEcccHHHHHHHHHHccccHHHEEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEEEEEEEEccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHEEEEcccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHcccccEEEccccccccccHHHHcHHHcccccccccHHHccEEEEEEEcccEHHHccccccEEEEEccccEEEcccccccccEEEEcccEEEEEEccccccccEEEEEEEEEEEEEEcccEEEEEEcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHcccHEEEccccccEEEEEEEccccccccEEEEccccEccccccEEEEEEEcHHHHHHcHHEHHEccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEcccHHHHccHHHHHHHHHHHHccccccccccHHHcccccHHHHHHHHHHHHHHHHc
MSNVSSIRTTFLEFFQKnghellpssslipcndptlmftnsgmvpfkniftgqekpvYQAVTTVQKCvraggkhndldnvgrtnrhHTFFEMlgnfsfggyFKERAIQLAWDLLTkefdldqrrLYITVYDEDEEAFKLWKKISGLSADKIIRITtndnfwsmaetgpcgpcseiffdqgecipgglpgsseegeRYIEIWNLVFMQFEQQNkqerfilpkmsidtgmGLERMATVLQEKTNNYDIDLFKHLIQASEQVtgmkyegnnivNHRVIVDHLrsssfliadgilpanegrgYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLshlgkdeilngDVAFKlydthglplDIMQDILCARGLAGIDIISFNQALEEQRSRARAhslglgsgttEKIWFSLKEKygatqfigydllrgskfmkedrkvlcqkppidltngVSSIVKAIVQQGEIVEEAVSgqkvevvfdqtpfyaeaggqlgdtgcaigdgiRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTIlgshvsqngscitpdglrfdvthskpitsaELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEyedggvhssalcggthvsstGEIMLLYIVSESSIRAGIRRIEAITGQrarshlmgqDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQlnvedlschkiadVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKvlgggggggrphmaqsggpngnkaDQAIAGVASFLKK
MSNVSSIRTTFLEFFQKnghellpssSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVraggkhndldnvgrtNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKkisglsadKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFliadgilpanegrgYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSRARahslglgsgtTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCqkppidltngvSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAelksiednvnDIIAQNLPVVTRIMNREDAIASGAaallgtkyndRVRVVSVEYedggvhssalcggthvSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK
MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIpgglpgsseegeRYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTldrglvlldgvlSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINhsathllhhalstilGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLgggggggRPHMAQSGGPNGNKADQAIAGVASFLKK
***VSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHL***EILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQAL******************TEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEE******************************DVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK
MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVL************QSGGPNGNKADQAIAGVASFLKK
***VSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSRARAHS*******TEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGG**GGGR***********NKADQAIAGVASFLKK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK
MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK
MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFLKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
254781004 652 threonyl-tRNA synthetase [Candidatus Liberibacter 6e-07
>gi|254781004|ref|YP_003065417.1| threonyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Back     alignment
 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 75/183 (40%), Gaps = 10/183 (5%)

Query: 531 TGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSAT 590
           TG  + + I   +    KKA  + ++  + +      E S+ +      R    I HS  
Sbjct: 22  TGSDVAESISRSLA---KKAVAVAINGKVCDLSDPVREGSIEIITPEDPRSLAVIRHSCA 78

Query: 591 HLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVV 650
           H++  A+ +I    V      I  DG  +D    +P +S EL  IE  + +IIA++ P +
Sbjct: 79  HIMAEAVQSIW-PEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFL 137

Query: 651 TRIMNREDAIASGAAALLGTKYNDRVRVVSVE----YEDGGVHSSALCGGTHVSSTGEIM 706
            + ++ E A     +     K      + + E    Y  G      LC G HV STG++ 
Sbjct: 138 KQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFD--LCRGPHVRSTGQVK 195

Query: 707 LLY 709
             +
Sbjct: 196 KFF 198

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
315122762906 alanyl-tRNA synthetase [Candidatus Liberibacter solanac 1 0.0
222086162886 alanyl-tRNA synthetase protein [Agrobacterium radiobact 1 0.0
15965551887 alanyl-tRNA synthetase [Sinorhizobium meliloti 1021] Le 1 0.0
150396732887 alanyl-tRNA synthetase [Sinorhizobium medicae WSM419] L 1 0.0
227822193887 alanyl-tRNA synthetase [Sinorhizobium fredii NGR234] Le 1 0.0
241204888884 alanyl-tRNA synthetase [Rhizobium leguminosarum bv. tri 1 0.0
116252382884 alanyl-tRNA synthetase [Rhizobium leguminosarum bv. vic 1 0.0
325293275897 Alanyl-tRNA synthetase [Agrobacterium sp. H13-3] Length 1 0.0
159184958887 alanyl-tRNA synthetase [Agrobacterium tumefaciens str. 1 0.0
86357937899 alanyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 1 0.0
>gi|315122762|ref|YP_004063251.1| alanyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 906 Back     alignment and organism information
 Score = 1380 bits (3572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/901 (73%), Positives = 776/901 (86%), Gaps = 4/901 (0%)

Query: 1   MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQA 60
           M N+ SIR TFL+FFQK  H++L SSSLIP NDPTLMFTN+GMV FKNIFT QEK  Y+ 
Sbjct: 1   MRNLGSIRKTFLDFFQKREHKILDSSSLIPHNDPTLMFTNAGMVQFKNIFTSQEKRSYKT 60

Query: 61  VTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDL 120
             TVQKCVRAGGKHNDLDNVGRT RHHTFFEMLGNFSFG YFKERAI+LAW+LLTKEFD+
Sbjct: 61  AATVQKCVRAGGKHNDLDNVGRTTRHHTFFEMLGNFSFGDYFKERAIKLAWELLTKEFDI 120

Query: 121 DQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQG 180
           D RR+ +TVYD DEEAF LWKKISGL ++KIIR+   DNFWSMA+TGPCGPCSEIFFDQG
Sbjct: 121 DCRRIVVTVYDGDEEAFNLWKKISGLPSNKIIRVAGKDNFWSMADTGPCGPCSEIFFDQG 180

Query: 181 ECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEK 240
           E   GGLPGS+E G+RY+EIWNLVFMQFEQ++++ER ILP MSIDTGMGLER++ VLQ K
Sbjct: 181 EGFLGGLPGSAEAGDRYLEIWNLVFMQFEQKSQKERCILPSMSIDTGMGLERISAVLQGK 240

Query: 241 TNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGILPANEGRGYV 300
           T+NYDIDLFK LIQASEQ+TG+KY+G++I+NHRVIVDHLRSSSFLIADGILP NEGRGYV
Sbjct: 241 TDNYDIDLFKTLIQASEQITGVKYKGDDIINHRVIVDHLRSSSFLIADGILPTNEGRGYV 300

Query: 301 LRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERFGK 360
           LRRIMRRAMCYARLLGY +PLMM L P LC+EMGSAYPELIQA+LLIEETL+ ED RF K
Sbjct: 301 LRRIMRRAMCYARLLGYEDPLMMRLFPVLCSEMGSAYPELIQAQLLIEETLKVEDMRFSK 360

Query: 361 TLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDIISFNQ 420
           TLD+G+ LLD V S L K+ IL+G VAFKLYDTHGLPLDIMQDIL ARGL G+D+ SF Q
Sbjct: 361 TLDKGIYLLDEVSSSLEKNAILDGSVAFKLYDTHGLPLDIMQDILWARGLGGVDVASFKQ 420

Query: 421 ALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRK----VL 476
           +LEEQRS+AR+H LGLG   TEKIWFSLKEKYG TQF+GY++  GSK +  D K     L
Sbjct: 421 SLEEQRSKARSHCLGLGEKITEKIWFSLKEKYGTTQFVGYNIHHGSKVIAGDEKKGDYSL 480

Query: 477 CQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIG 536
            QKP +D T G+ +IVKAIV Q  IV+ A +GQKVEV+FDQTPFYAE+GGQ+GDTG A+G
Sbjct: 481 SQKPSVDFTQGIPAIVKAIVLQDSIVDVARAGQKVEVLFDQTPFYAESGGQVGDTGIAVG 540

Query: 537 DGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHA 596
           +G+ LQITDVQKK  GIFVHHA +E G+LRTEM ++LTI+YQ+RRQLSINHSATHLLH A
Sbjct: 541 EGVSLQITDVQKKVGGIFVHHATIEHGVLRTEMPIILTINYQDRRQLSINHSATHLLHAA 600

Query: 597 LSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNR 656
           L TILG HVSQ GS I P+ LRFD+ HSKPIT  E+K I+D++ND+IAQN  ++TRIMN 
Sbjct: 601 LRTILGPHVSQKGSHIIPERLRFDIVHSKPITREEIKLIQDHINDVIAQNYSIITRIMNI 660

Query: 657 EDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSI 716
           +DAIASG++AL G KY+D+VRVVS+E +DG V++S LCGGTHVSSTGEIML++IVSES++
Sbjct: 661 DDAIASGSSALFGKKYSDKVRVVSIESDDGRVYASELCGGTHVSSTGEIMLVHIVSESAV 720

Query: 717 RAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQGNVVGRVEEIWEEYRKLQLIHAK 776
            AGIRRIEA++GQRARS+L+ QDEK++SLASFLKV   NVV RVEEIWEE R+L LI+AK
Sbjct: 721 SAGIRRIEAVSGQRARSYLVEQDEKVRSLASFLKVQPSNVVKRVEEIWEERRELHLINAK 780

Query: 777 RKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSVMDALQKKIQSGIIMLVGISKEKKA 836
            KL+LNV+DLSCH IA+VNFMSH+I + D KELK ++D LQKKI+SGIIML+G+SKEKKA
Sbjct: 781 HKLKLNVDDLSCHTIANVNFMSHVIPDADFKELKGLIDMLQKKIKSGIIMLIGVSKEKKA 840

Query: 837 SVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGRPHMAQSGGPNGNKADQAIAGVASFL 896
           SV+I VT+DL+DRFNA++L RL+AKVLGG GGGGRP+MAQSGGP+GNK DQ+IA + SFL
Sbjct: 841 SVVIAVTQDLIDRFNAINLVRLAAKVLGGSGGGGRPNMAQSGGPDGNKVDQSIANIVSFL 900

Query: 897 K 897
           K
Sbjct: 901 K 901


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086162|ref|YP_002544694.1| alanyl-tRNA synthetase protein [Agrobacterium radiobacter K84] Length = 886 Back     alignment and organism information
>gi|15965551|ref|NP_385904.1| alanyl-tRNA synthetase [Sinorhizobium meliloti 1021] Length = 887 Back     alignment and organism information
>gi|150396732|ref|YP_001327199.1| alanyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 887 Back     alignment and organism information
>gi|227822193|ref|YP_002826164.1| alanyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 887 Back     alignment and organism information
>gi|241204888|ref|YP_002975984.1| alanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 884 Back     alignment and organism information
>gi|116252382|ref|YP_768220.1| alanyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 884 Back     alignment and organism information
>gi|325293275|ref|YP_004279139.1| Alanyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 897 Back     alignment and organism information
>gi|159184958|ref|NP_354854.2| alanyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 887 Back     alignment and organism information
>gi|86357937|ref|YP_469829.1| alanyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 899 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
pfam01411545 pfam01411, tRNA-synt_2c, tRNA synthetases class II (A) 0.0
PRK00252865 PRK00252, alaS, alanyl-tRNA synthetase; Reviewed 0.0
TIGR00344851 TIGR00344, alaS, alanine--tRNA ligase 0.0
PLN02900936 PLN02900, PLN02900, alanyl-tRNA synthetase 0.0
KOG0188895 KOG0188, KOG0188, KOG0188, Alanyl-tRNA synthetase [Tran 1e-170
PRK13902900 PRK13902, alaS, alanyl-tRNA synthetase; Provisional 1e-113
TIGR03683902 TIGR03683, A-tRNA_syn_arch, alanyl-tRNA synthetase 1e-104
COG0013879 COG0013, AlaS, Alanyl-tRNA synthetase [Translation, rib 0.0
PRK01584594 PRK01584, PRK01584, alanyl-tRNA synthetase; Provisional 9e-95
cd00673232 cd00673, AlaRS_core, Alanyl-tRNA synthetase (AlaRS) cla 7e-91
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 1e-08
PRK01584594 PRK01584, PRK01584, alanyl-tRNA synthetase; Provisional 1e-34
PRK12305 575 PRK12305, thrS, threonyl-tRNA synthetase; Reviewed 6e-09
PRK00413 638 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed 4e-08
COG0441 589 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, r 6e-06
PRK12444 639 PRK12444, PRK12444, threonyl-tRNA synthetase; Reviewed 6e-05
TIGR00418 563 TIGR00418, thrS, threonyl-tRNA synthetase 3e-04
PLN02837 614 PLN02837, PLN02837, threonine-tRNA ligase 7e-04
COG2872241 COG2872, COG2872, Predicted metal-dependent hydrolases 3e-25
PLN02961223 PLN02961, PLN02961, alanine-tRNA ligase 5e-12
KOG2105415 KOG2105, KOG2105, KOG2105, Predicted metal-dependent hy 3e-11
smart0086344 smart00863, tRNA_SAD, Threonyl and Alanyl tRNA syntheta 2e-09
pfam0797344 pfam07973, tRNA_SAD, Threonyl and Alanyl tRNA synthetas 4e-09
pfam0227269 pfam02272, DHHA1, DHHA1 domain 5e-05
>gnl|CDD|144852 pfam01411, tRNA-synt_2c, tRNA synthetases class II (A) Back     alignment and domain information
>gnl|CDD|178947 PRK00252, alaS, alanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161830 TIGR00344, alaS, alanine--tRNA ligase Back     alignment and domain information
>gnl|CDD|178488 PLN02900, PLN02900, alanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35409 KOG0188, KOG0188, KOG0188, Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|184382 PRK13902, alaS, alanyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|163395 TIGR03683, A-tRNA_syn_arch, alanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|30363 COG0013, AlaS, Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179306 PRK01584, PRK01584, alanyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|29811 cd00673, AlaRS_core, Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|179306 PRK01584, PRK01584, alanyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|183422 PRK12305, thrS, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|179011 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30790 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183530 PRK12444, PRK12444, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161870 TIGR00418, thrS, threonyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178431 PLN02837, PLN02837, threonine-tRNA ligase Back     alignment and domain information
>gnl|CDD|32699 COG2872, COG2872, Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|178546 PLN02961, PLN02961, alanine-tRNA ligase Back     alignment and domain information
>gnl|CDD|37316 KOG2105, KOG2105, KOG2105, Predicted metal-dependent hydrolase, contains AlaS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|129096 smart00863, tRNA_SAD, Threonyl and Alanyl tRNA synthetase second additional domain Back     alignment and domain information
>gnl|CDD|149189 pfam07973, tRNA_SAD, Threonyl and Alanyl tRNA synthetase second additional domain Back     alignment and domain information
>gnl|CDD|145431 pfam02272, DHHA1, DHHA1 domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
PRK00252864 alaS alanyl-tRNA synthetase; Reviewed 100.0
COG0013879 AlaS Alanyl-tRNA synthetase [Translation, ribosomal str 100.0
PRK13902898 alaS lanyl-tRNA synthetase; Provisional 100.0
KOG0188895 consensus 100.0
TIGR00344914 alaS alanyl-tRNA synthetase; InterPro: IPR002318 The am 100.0
PRK01584593 alanyl-tRNA synthetase; Provisional 100.0
pfam01411545 tRNA-synt_2c tRNA synthetases class II (A). Other tRNA 100.0
cd00673232 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core 100.0
cd00733279 GlyRS_alpha_core Class II Glycyl-tRNA synthetase (GlyRS 98.25
PRK09348291 glyQ glycyl-tRNA synthetase subunit alpha; Validated 98.25
COG0752298 GlyQ Glycyl-tRNA synthetase, alpha subunit [Translation 98.14
pfam02091284 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit. 98.08
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 97.0
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 94.91
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 93.98
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 93.63
COG2872241 Predicted metal-dependent hydrolases related to alanyl- 100.0
KOG2105415 consensus 100.0
PRK00413 639 thrS threonyl-tRNA synthetase; Reviewed 99.14
PRK03772 642 threonyl-tRNA synthetase; Validated 99.13
PRK12304 604 thrS threonyl-tRNA synthetase; Reviewed 99.11
PRK12444 639 threonyl-tRNA synthetase; Reviewed 99.09
PRK04483 634 threonyl-tRNA synthetase; Validated 99.08
PRK12305 576 thrS threonyl-tRNA synthetase; Reviewed 98.87
COG0441 589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 98.47
TIGR00418 595 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The 98.13
pfam0797344 tRNA_SAD Threonyl and Alanyl tRNA synthetase second add 99.05
smart0086344 tRNA_SAD Threonyl and Alanyl tRNA synthetase second add 98.87
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 92.67
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 91.94
pfam0227269 DHHA1 DHHA1 domain. This domain is often found adjacent 98.43
pfam01411545 tRNA-synt_2c tRNA synthetases class II (A). Other tRNA 97.68
TIGR00344914 alaS alanyl-tRNA synthetase; InterPro: IPR002318 The am 94.11
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 95.17
PRK06462332 asparagine synthetase A; Reviewed 93.26
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 92.16
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 90.69
TIGR00644 705 recJ single-stranded-DNA-specific exonuclease RecJ; Int 92.71
TIGR00470558 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR 91.94
KOG1501636 consensus 91.16
>PRK00252 alaS alanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0013 AlaS Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13902 alaS lanyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG0188 consensus Back     alignment and domain information
>TIGR00344 alaS alanyl-tRNA synthetase; InterPro: IPR002318 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK01584 alanyl-tRNA synthetase; Provisional Back     alignment and domain information
>pfam01411 tRNA-synt_2c tRNA synthetases class II (A) Back     alignment and domain information
>cd00673 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain Back     alignment and domain information
>cd00733 GlyRS_alpha_core Class II Glycyl-tRNA synthetase (GlyRS) alpha subunit core catalytic domain Back     alignment and domain information
>PRK09348 glyQ glycyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>COG0752 GlyQ Glycyl-tRNA synthetase, alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>COG2872 Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain [General function prediction only] Back     alignment and domain information
>KOG2105 consensus Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK03772 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12304 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04483 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain Back     alignment and domain information
>smart00863 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>pfam02272 DHHA1 DHHA1 domain Back     alignment and domain information
>pfam01411 tRNA-synt_2c tRNA synthetases class II (A) Back     alignment and domain information
>TIGR00344 alaS alanyl-tRNA synthetase; InterPro: IPR002318 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>TIGR00644 recJ single-stranded-DNA-specific exonuclease RecJ; InterPro: IPR004610 All proteins in this family are 5'-3' single-strand DNA exonucleases Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR005246 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1501 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
3hxu_A441 Crystal Structure Of Catalytic Fragment Of E. Coli 1e-164
3hxz_A441 Crystal Structure Of Catalytic Fragment Of E. Coli 1e-163
3htz_A464 Crystal Structure Of The Catalytic Fragment Of Alan 1e-161
1yfr_A465 Crystal Structure Of Alanyl-Trna Synthetase In Comp 1e-161
1riq_A465 The Crystal Structure Of The Catalytic Fragment Of 1e-148
2zzf_A752 Crystal Structure Of Alanyl-Trna Synthetase Without 1e-105
2zze_A752 Crystal Structure Of Alanyl-Trna Synthetase Without 1e-100
2ztg_A739 Crystal Structure Of Archaeoglobus Fulgidus Alanyl- 2e-85
3g98_A111 Crystal Structure Of The C-Ala Domain From Aquifex 5e-16
2zvf_A171 Crystal Structure Of Archaeoglobus Fulgidus Alanyl- 5e-16
2e1b_A216 Crystal Structure Of The Alax-M Trans-Editing Enzym 1e-04
3kew_A241 Crystal Structure Of Probable Alanyl-Trna-Synthase 0.002
>gi|281307084|pdb|3HXU|A Chain A, Crystal Structure Of Catalytic Fragment Of E. Coli Alars In Complex With Alasa Length = 441 Back     alignment and structure
 Score =  584 bits (1504), Expect = e-164,   Method: Composition-based stats.
 Identities = 234/441 (53%), Positives = 308/441 (69%), Gaps = 14/441 (3%)

Query: 2   SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAV 61
            + + IR  FL+FF   GH+++ SSSL+P NDPTL+FTN+GM  FK++F G +K  Y   
Sbjct: 2   KSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA 61

Query: 62  TTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLT--KEFD 119
           TT Q+CVRAGGKHNDL+NVG T RHHTFFEMLGNFSFG YFK  AI  AW LLT  K F 
Sbjct: 62  TTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKLDAILFAWLLLTSEKWFA 121

Query: 120 LDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTN-------DNFWSMAETGPCGPC 172
           L + RL++TVY+ D+EA+++W+K  G+  ++IIRI  N       DNFW M +TGPCGPC
Sbjct: 122 LPKERLWVTVYESDDEAYEIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPC 181

Query: 173 SEIFFDQGECIPGGLPGSS-EEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLE 231
           +EIF+D G+ I GG PGS  E+G+RYIEIWN+VFMQF +Q       LPK S+DTGMGLE
Sbjct: 182 TEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLE 241

Query: 232 RMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRSSSFLIADGIL 291
           R+A VLQ   +NYDIDLF+ LIQA  +VTG      +  + RVI DH+RS +FLIADG++
Sbjct: 242 RIAAVLQHVNSNYDIDLFRTLIQAVAKVTGATD--LSNKSLRVIADHIRSCAFLIADGVM 299

Query: 292 PANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETL 351
           P+NE RGYVLRRI+RRA+ +  +LG  E     L+  L   MGSA  +L + +  +E+ L
Sbjct: 300 PSNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKRQQAQVEQVL 359

Query: 352 RSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLA 411
           ++E+E+F +TL+RGL LLD  L+ L   + L+G+ AF+LYDT+G P+D+  D+   R + 
Sbjct: 360 KTEEEQFARTLERGLALLDEELAKLS-GDTLDGETAFRLYDTYGFPVDLTADVCRERNIK 418

Query: 412 GIDIISFNQALEEQRSRARAH 432
            +D   F  A+EEQR RAR  
Sbjct: 419 -VDEAGFEAAMEEQRRRAREA 438


>gi|281307089|pdb|3HXZ|A Chain A, Crystal Structure Of Catalytic Fragment Of E. Coli Alars G237a In Complex With Alasa Length = 441 Back     alignment and structure
>gi|242556759|pdb|3HTZ|A Chain A, Crystal Structure Of The Catalytic Fragment Of Alanyl-Trna Synthetase In Complex With L-Serine: Re-Refined Length = 464 Back     alignment and structure
>gi|60594334|pdb|1YFR|A Chain A, Crystal Structure Of Alanyl-Trna Synthetase In Complex With Atp And Magnesium Length = 465 Back     alignment and structure
>gi|47168789|pdb|1RIQ|A Chain A, The Crystal Structure Of The Catalytic Fragment Of The Alanyl-Trna Synthetase Length = 465 Back     alignment and structure
>gi|254574772|pdb|2ZZF|A Chain A, Crystal Structure Of Alanyl-Trna Synthetase Without Oligomerization Domain Length = 752 Back     alignment and structure
>gi|254574770|pdb|2ZZE|A Chain A, Crystal Structure Of Alanyl-Trna Synthetase Without Oligomerization Domain In Lysine-Methylated Form Length = 752 Back     alignment and structure
>gi|242556274|pdb|2ZTG|A Chain A, Crystal Structure Of Archaeoglobus Fulgidus Alanyl-Trna Synthetase Lacking The C-Terminal Dimerization Domain In Complex With Ala-Sa Length = 739 Back     alignment and structure
>gi|260656268|pdb|3G98|A Chain A, Crystal Structure Of The C-Ala Domain From Aquifex Aeolicus Alanyl-Trna Synthetase Length = 111 Back     alignment and structure
>gi|242556277|pdb|2ZVF|A Chain A, Crystal Structure Of Archaeoglobus Fulgidus Alanyl-Trna Synthetase C-Terminal Dimerization Domain Length = 171 Back     alignment and structure
gi|134104183|pdb|2E1B|A Chain A, Crystal Structure Of The Alax-M Trans-Editing Enzyme From Pyrococcus Horikoshii Length = 216 Back     alignment and structure
>gi|262368192|pdb|3KEW|A Chain A, Crystal Structure Of Probable Alanyl-Trna-Synthase From Clostridium Perfringens Length = 241 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
2zze_A752 Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2. 1e-177
2ztg_A739 Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthet 1e-163
3hy0_A441 Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, liga 1e-159
1yfs_A465 Alanyl-tRNA synthetase; alpha-beta fold, helix-loop-hel 1e-139
3kew_A241 DHHA1 domain protein; structural genomics, PSI-2, tRNA 4e-26
2e1b_A216 PH0108, 216AA long hypothetical alanyl-tRNA synthetase; 5e-25
2zvf_A171 Alanyl-tRNA synthetase; C-terminal, oligomerization dom 3e-20
1v4p_A157 Alanyl-tRNA synthetase; alanine-tRNA ligase, riken stru 5e-19
1nyr_A 645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET 3e-08
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, 2e-05
3g98_A111 Alanyl-tRNA synthetase; alpha and beta fold, aminoacyl- 2e-15
>2zze_A Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2.16A {Pyrococcus horikoshii} PDB: 2zzf_A 2zzg_A* Length = 752 Back     alignment and structure
 Score =  617 bits (1592), Expect = e-177
 Identities = 174/795 (21%), Positives = 302/795 (37%), Gaps = 168/795 (21%)

Query: 3   NVSSIRTTFLEFFQKN---GHELLPSSSLIPCNDPTLMFTNSGMVPFKN-IFTGQEKPVY 58
            +  +R  FL FF+ +    H  +    ++P     ++   + ++ F+  + +G+  P  
Sbjct: 58  TLDEMREXFLRFFEXHEIYPHGRVXRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPA 117

Query: 59  QAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFG-----GYFKERAIQLAWDL 113
             +   Q  +R      D+DNVG T RH T FEM+ + +F       Y+ +  ++LA++ 
Sbjct: 118 NPLVISQPSIR----FTDIDNVGITGRHFTIFEMMAHHAFNYPGXPIYWMDETVELAFEF 173

Query: 114 LTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCS 173
            TKE  +    +                K               +N W+    G  GP  
Sbjct: 174 FTKELXMXPEDI--------------TFK---------------ENPWAGG--GNAGPAF 202

Query: 174 EIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQF------------EQQNKQERFILPK 221
           E+ +                    +E+  LVFMQ+                 ++   +  
Sbjct: 203 EVLYR------------------GLEVATLVFMQYXXAPENAPQDQVVVIXGEKYIPMET 244

Query: 222 MSIDTGMGLERMATVLQEKTNNYDIDLF-------------------------------- 249
             +DTG GLER+  + Q     YD  L                                 
Sbjct: 245 XVVDTGYGLERLVWMSQGTPTAYDAVLGYVVEPLXXMAGIEKIDEKILMENSRLAGMFDI 304

Query: 250 ------KHLIQASEQVTGMKYEGNN-----IVNHRVIVDHLRSSSFLIADGILPANEGRG 298
                 ++L +   +  G+  E              I DH ++ +F++ADG++P+N   G
Sbjct: 305 EDLGDLRYLREQVAKRVGITVEELEKAIRPYELIYAIADHTKALTFMLADGVVPSNVXAG 364

Query: 299 YVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPELIQAKLLIEETLRSEDERF 358
           Y+ R ++R+++ + R LG   PL   ++     E+   +PE  + + +I E +  E++ +
Sbjct: 365 YLARLLIRKSIRHLRELGLEVPL-SEIVALHIXELHKTFPEFXEMEDIILEMIELEEKXY 423

Query: 359 GKTLDRGLVLLDGVL--SHLGKDEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGIDII 416
            +TL RG  L+   +        + +  +     Y++HGL  +I+ +I    G+      
Sbjct: 424 AETLRRGSDLVRREIAKLKKKGIKEIPVEXLVTFYESHGLTPEIVXEIAEKEGVKVNIPD 483

Query: 417 SFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVL 476
           +F   + ++  R +           E + F L +    T+ + Y+               
Sbjct: 484 NFYSMVAKEAERTKEEK------GEELVDFELLKDLPDTRRLYYE--------------- 522

Query: 477 CQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIG 536
                                  E     +      V+ D T FY E GGQ  DTG  I 
Sbjct: 523 ------------------DPFMXEFDAXVLRVIXDWVILDATAFYPEGGGQPYDTGVLIV 564

Query: 537 DGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTIDYQNRRQLSINHSATHLLHHA 596
           +G  + +T+VQ    G  + H + + G     M +   ID+  R Q   +H+ TH+L  A
Sbjct: 565 NGREVXVTNVQXV--GXVIIHXVEDPGAFXEGMIVHGXIDWXRRIQHMRHHTGTHVLMGA 622

Query: 597 LSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRIMNR 656
           L  +LG HV Q GS +T D  R D++H   I+  EL  IE   N I+ ++  V    + R
Sbjct: 623 LVRVLGRHVWQAGSQLTTDWARLDISHYXRISEEELXEIEMLANRIVMEDRXVTWEWLPR 682

Query: 657 EDAIASGAAALL--GTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSES 714
             A       L   G      +RVV +            CGGTH+ STG +  + I+   
Sbjct: 683 TTAEQXYGFRLYQGGVVPGREIRVVXI----EDW-DVQACGGTHLPSTGLVGPIXILRTE 737

Query: 715 SIRAGIRRIEAITGQ 729
            I+ G+ RI    G+
Sbjct: 738 RIQDGVERIIFACGE 752


>2ztg_A Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthetase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: A5A; 2.20A {Archaeoglobus fulgidus} Length = 739 Back     alignment and structure
>3hy0_A Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, protein biosynthesis, nucleotide-binding, amino acid-binding, acetylation; HET: G5A EPE; 1.90A {Escherichia coli} PDB: 3hxz_A* 3hy1_A* 3hxv_A* 3hxu_A* 3hxw_A* 3hxx_A* 3hxy_A* Length = 441 Back     alignment and structure
>1yfs_A Alanyl-tRNA synthetase; alpha-beta fold, helix-loop-helix motif, amino acid binding, ligase; 2.08A {Aquifex aeolicus} SCOP: a.203.1.1 d.104.1.1 PDB: 1yfr_A* 1riq_A 1yft_A 1ygb_A 3htz_A Length = 465 Back     alignment and structure
>3kew_A DHHA1 domain protein; structural genomics, PSI-2, tRNA synthase, protein structure initiative; 2.00A {Clostridium perfringens atcc 13124} Length = 241 Back     alignment and structure
>2e1b_A PH0108, 216AA long hypothetical alanyl-tRNA synthetase; zinc-binding motif, trans-editing enzyme, structural genomics, NPPSFA; 2.70A {Pyrococcus horikoshii} SCOP: b.43.3.6 d.67.1.2 Length = 216 Back     alignment and structure
>2zvf_A Alanyl-tRNA synthetase; C-terminal, oligomerization domain, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 3.20A {Archaeoglobus fulgidus} Length = 171 Back     alignment and structure
>1v4p_A Alanyl-tRNA synthetase; alanine-tRNA ligase, riken structural genomics/proteomics initiative RSGI, structural genomics; 1.45A {Pyrococcus horikoshii} SCOP: d.67.1.2 PDB: 1wxo_A 1v7o_A 1wnu_A Length = 157 Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Length = 645 Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, mRNA, aminoacylation, translational regulation, protein/RNA, ligase/RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Length = 642 Back     alignment and structure
>3g98_A Alanyl-tRNA synthetase; alpha and beta fold, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 1.85A {Aquifex aeolicus} Length = 111 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
2zze_A752 Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2. 100.0
2ztg_A739 Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthet 100.0
1yfs_A465 Alanyl-tRNA synthetase; alpha-beta fold, helix-loop-hel 100.0
3hy0_A441 Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, liga 100.0
3kew_A241 DHHA1 domain protein; structural genomics, PSI-2, tRNA 100.0
2e1b_A216 PH0108, 216AA long hypothetical alanyl-tRNA synthetase; 100.0
1v4p_A157 Alanyl-tRNA synthetase; alanine-tRNA ligase, riken stru 99.96
1nyr_A 645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET 99.04
1tke_A224 Threonyl-tRNA synthetase; ligase; 1.46A {Escherichia co 98.95
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, 98.92
2zvf_A171 Alanyl-tRNA synthetase; C-terminal, oligomerization dom 99.89
3g98_A111 Alanyl-tRNA synthetase; alpha and beta fold, aminoacyl- 99.76
1j5w_A298 Glycyl-tRNA synthetase alpha chain; structural genomics 98.2
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterotetrame 93.77
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA s 93.15
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; structural 92.24
3a5y_A345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA sy 91.74
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacylatio 91.45
>2zze_A Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2.16A {Pyrococcus horikoshii} PDB: 2zzf_A 2zzg_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1699.79  Aligned_cols=626  Identities=27%  Similarity=0.464  Sum_probs=571.3

Q ss_pred             CCHHHHHHHHHHHHHHC---CCEECCCCCCCCCCCCCHHEEECCCCCCCCC-CCCCCCCCCCCCCCCCCCEECCCCCCCH
Q ss_conf             78789999999999978---9889116675667787100230143475540-0588799999851115432248987863
Q gi|254780191|r    2 SNVSSIRTTFLEFFQKN---GHELLPSSSLIPCNDPTLMFTNSGMVPFKNI-FTGQEKPVYQAVTTVQKCVRAGGKHNDL   77 (898)
Q Consensus         2 ~s~~eiR~~fl~fF~~~---~H~~~~s~slvp~~d~~llft~Agm~~fk~~-f~G~~~p~~~r~~~~QkCiR~ggkhnDl   77 (898)
                      +|++|||++||+||++|   ||++||||||||+||||||||||||+||||| |+|.++||++|+|+||||||+    |||
T Consensus        57 ~~~~eiR~~fl~fF~~~~~~gH~~i~~~pvvp~~~~~llft~Agm~~Fkp~v~~G~~~pp~~~l~~sQ~CiR~----nDl  132 (752)
T 2zze_A           57 YTLDEMREXFLRFFEXHEIYPHGRVXRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLVISQPSIRF----TDI  132 (752)
T ss_dssp             CCHHHHHHHHHHHHHTCSSSCCEECCCCCSSCTTCSSCSSCCSGGGGGTTHHHHTSSCCSSSSEEEEEEEECC----TTG
T ss_pred             CCHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEEC----CCH
T ss_conf             8999999999998386888997387147837799998246603664355721578768999972455200003----747


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHCC-----CCHHHHHHHHHHHHHHHCCCCHHHEEEEECCCHHHHHHHHHHHCCCCHHHEE
Q ss_conf             43464885001788854223147-----5378899989986133418981237999718828999975663499989975
Q gi|254780191|r   78 DNVGRTNRHHTFFEMLGNFSFGG-----YFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKII  152 (898)
Q Consensus        78 d~VG~t~rH~TfFEMlGn~Sfgd-----YfK~eai~~awe~lt~~~~l~~~~l~vtv~~~D~e~~~iW~~~~gi~~~~i~  152 (898)
                      ||||+|+||||||||||||||||     |||+|||+|||||||++||+||++|+                          
T Consensus       133 dnVG~t~rH~T~FEMlGn~sFg~~~~~~Y~k~e~i~~~~e~lt~~lgi~~~~i~--------------------------  186 (752)
T 2zze_A          133 DNVGITGRHFTIFEMMAHHAFNYPGXPIYWMDETVELAFEFFTKELXMXPEDIT--------------------------  186 (752)
T ss_dssp             GGTTTSSSCCSEEEEEEEEEEECTTCCCCCHHHHHHHHHHHHHHTSCCCGGGEE--------------------------
T ss_pred             HHCCCCCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCEEEECHHHCC--------------------------
T ss_conf             655788764055760412512899701769999999999975212342576615--------------------------


Q ss_pred             ECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEHHHHHHHCCCCCC------------CCCCC
Q ss_conf             357866654579999987704678853855689888777889826896001123443047887------------56576
Q gi|254780191|r  153 RITTNDNFWSMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQE------------RFILP  220 (898)
Q Consensus       153 ~~~~~dNfW~~g~~GpcGPcsEi~~d~g~~~~~~~~~~~~~~~r~lEiwNlVFmq~~~~~~g~------------~~~Lp  220 (898)
                         .+||||+||  |||||||||||                  |+|||||||||||+++.+|.            |.|||
T Consensus       187 ---~~en~W~~G--G~~GPc~Ei~~------------------~glEi~nlVFmq~~~~~~g~~~~~~~~~~~~~~~~Lp  243 (752)
T 2zze_A          187 ---FKENPWAGG--GNAGPAFEVLY------------------RGLEVATLVFMQYXXAPENAPQDQVVVIXGEKYIPME  243 (752)
T ss_dssp             ---EEECCEEET--TEEECEEEEEE------------------TTEEEEEEEEEEEEECCTTCCSCCEEETTTEEEEEEE
T ss_pred             ---CCCCCCCCC--CCCCCCEEEEE------------------CCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             ---545766589--89988756887------------------1444210001002558888756542334530146688


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCC---------------------------------
Q ss_conf             65310175799999998879853005769999999997306785433---------------------------------
Q gi|254780191|r  221 KMSIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGN---------------------------------  267 (898)
Q Consensus       221 ~~~IDTGmGLERl~~vlqg~~s~ydtD~f~pii~~i~~~~g~~y~~~---------------------------------  267 (898)
                      +|+||||||||||||++||+||||||| |.++|+.+.+.+|+.+.++                                 
T Consensus       244 ~k~VDTGmGLERl~~vlQg~~t~Ydtd-~~~~i~~l~~~~gi~~~~~~~~~~~~~~~g~~di~~~~~~~~~~~~va~~~~  322 (752)
T 2zze_A          244 TXVVDTGYGLERLVWMSQGTPTAYDAV-LGYVVEPLXXMAGIEKIDEKILMENSRLAGMFDIEDLGDLRYLREQVAKRVG  322 (752)
T ss_dssp             EEEEEEEEEHHHHHHHHHCCSSHHHHH-SHHHHHHHHHHHTCCCCCHHHHHHHHHHHHTCCSSSSSCHHHHHHHHHHHHT
T ss_pred             CCCCCCCCCHHHHHHHHCCCCCCHHCC-CHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCHHCCHHHHHHHHHHHHHC
T ss_conf             786588878999999982899702213-4123455665315442104677655554276560110017789999988738


Q ss_pred             -----------CCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             -----------502489999989899998740333344464125778899999999984874331045689999986455
Q gi|254780191|r  268 -----------NIVNHRVIVDHLRSSSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSA  336 (898)
Q Consensus       268 -----------~~~~~rvIaDH~Ra~~f~I~DGv~PsN~GrGYvlRrilRRa~r~~~~lg~~~~fl~~lv~~v~~~m~~~  336 (898)
                                 ...++||||||+||++|||+|||+|||+|||||||||||||+||+++||++.| |++||+.+++.|++.
T Consensus       323 ~~~~~~~~~~~~~~~~~vIaDH~Ral~f~I~DGv~PSN~grGYvlRrilRRA~r~~~~lg~~~~-l~~lv~~~i~~m~~~  401 (752)
T 2zze_A          323 ITVEELEKAIRPYELIYAIADHTKALTFMLADGVVPSNVXAGYLARLLIRKSIRHLRELGLEVP-LSEIVALHIXELHKT  401 (752)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCSSSHHHHHHHHHHHHHHHHHHHTTCCCC-HHHHHHHHHHHHTTT
T ss_pred             CCHHHHCCCCCCCCCCEEECCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHH
T ss_conf             8803210112554441374308999999986578534455327899999999999986288676-899999999998545


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             555576467889999874898999999899999999861154--642457437998524588889999876650774435
Q gi|254780191|r  337 YPELIQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGK--DEILNGDVAFKLYDTHGLPLDIMQDILCARGLAGID  414 (898)
Q Consensus       337 ypeL~~~~~~I~~ii~~EE~~F~~TL~~G~~~l~~~i~~~~~--~~~lsg~~af~LyDTyGfP~dlt~eia~e~gi~~vD  414 (898)
                      ||||.++++.|.++|+.||++|.+||++|+++|++.+++.++  .+.|||++||+||||||||+|||++||+|+|+. ||
T Consensus       402 ypeL~~~~~~I~~ii~~EEe~F~~TL~~G~~~l~~~i~~~~~~~~~~i~ge~aF~LYDTyGfP~Dlt~eiA~E~g~~-VD  480 (752)
T 2zze_A          402 FPEFXEMEDIILEMIELEEKXYAETLRRGSDLVRREIAKLKKKGIKEIPVEXLVTFYESHGLTPEIVXEIAEKEGVK-VN  480 (752)
T ss_dssp             CTHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCSCCCHHHHHHHHHHHCCCHHHHHHHHTTSSCC-CC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHCCE-EC
T ss_conf             86878648999999999999999999987999999997631001356668899999871599889999999872646-30


Q ss_pred             H-HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             8-889999999997644433110012013567888730488626434444432111222111344454455565534899
Q gi|254780191|r  415 I-ISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFIGYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVK  493 (898)
Q Consensus       415 ~-~~f~~~m~~qk~~sr~~~~~~~~~~~~~~~~~~~~~~~~t~F~GYe~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~v~  493 (898)
                      + ..|++.|++|++++|+.+.....      ........++|++++|+....                    ...+++|+
T Consensus       481 ~~~~f~~~~~~~~~~~k~~~~~~~~------~~~~~~~l~~t~~l~y~~~~~--------------------~e~~a~V~  534 (752)
T 2zze_A          481 IPDNFYSMVAKEAERTKEEKGEELV------DFELLKDLPDTRRLYYEDPFM--------------------XEFDAXVL  534 (752)
T ss_dssp             CCTTHHHHHHGGGGCC-------CC------CSSSSSSSCCCEEHHHHCTTC--------------------CEEEEEEE
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCC------CHHHHHHCCCCCEEEECCCEE--------------------EEEEEEEE
T ss_conf             1457889999999999863455421------212233146641221011124--------------------56788899


Q ss_pred             EEEECCCEEEECCCCCEEEEEECCCCEEECCCCCCCCCCEEEECCEEEEEECCCCCCCEEEEEEECCCCCCCCCCCEEEE
Q ss_conf             99747813200047976999973752000368765665145404248985224565533899851046787556733888
Q gi|254780191|r  494 AIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVL  573 (898)
Q Consensus       494 ~i~~~~~~v~~~~~g~~~~ivLd~T~FY~E~GGQ~~D~G~i~~~~~~~~V~dv~k~~~g~i~H~~~~~~g~l~~g~~V~~  573 (898)
                      .+..+             +||||+||||||||||++|+|+|..++..+.|.++++. +++++|.+ ...+.+.+|++|.+
T Consensus       535 ~i~~~-------------~vvLD~T~FYpegGGQ~~D~G~i~~~~~~~~v~~~~~~-~~~i~h~~-~~~~~l~~G~~V~~  599 (752)
T 2zze_A          535 RVIXD-------------WVILDATAFYPEGGGQPYDTGVLIVNGREVXVTNVQXV-GXVIIHXV-EDPGAFXEGMIVHG  599 (752)
T ss_dssp             EEETT-------------EEEESEECSCCSBTTBCCCCEEEEETTEEEEEEEEEEE-TTEEEEEE-SCGGGCCTTCEEEE
T ss_pred             EEECC-------------EEECCCCEECCCCCCCCCCEEEEECCCCEEEEEEEECC-CCCEEECC-CCCCCCCCCCEEEE
T ss_conf             86505-------------26436740233358988850368404633653222105-74023112-22686588998999


Q ss_pred             EEHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCEECCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             42125567775201368899999752125444445530024300000247678999999999999989887304530466
Q gi|254780191|r  574 TIDYQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSIEDNVNDIIAQNLPVVTRI  653 (898)
Q Consensus       574 ~VD~~rR~~~~~~HTatHlL~~alr~vLG~hv~Q~GS~v~~~~lrfDfsh~~~lt~eel~~IE~~vN~~I~~n~~V~~~~  653 (898)
                      +|||+||..+|+|||||||||+|||++||+||+|+||+|+++++||||+|++++|+|||.+||++||++|++|+||++.+
T Consensus       600 ~ID~~rR~~~mr~HTAtHLL~~alr~vlG~hv~Q~Gs~v~~d~~R~Df~~~~~lt~eel~~IE~~vN~~I~~~~~V~~~~  679 (752)
T 2zze_A          600 XIDWXRRIQHMRHHTGTHVLMGALVRVLGRHVWQAGSQLTTDWARLDISHYXRISEEELXEIEMLANRIVMEDRXVTWEW  679 (752)
T ss_dssp             EECHHHHHHHHHHHHHHHHHHHHHHHHHCTTCEEEEEEECSSCEEEEEECSSCCCHHHHHHHHHHHHHHHHHTCBEEEEE
T ss_pred             EECHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             71587899999855799999999999868873014675069827998518999999999999999999998589168997


Q ss_pred             ECCCCCCCCHHHHHH--HHCCCCCEEEEEECCCCCCCCCEECCCCCCCCCHHHHHHHHEECCCCCCCCCEEEEEEECH
Q ss_conf             123222100035544--3155562489984476778553101562225886460110011012126882899997168
Q gi|254780191|r  654 MNREDAIASGAAALL--GTKYNDRVRVVSVEYEDGGVHSSALCGGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQ  729 (898)
Q Consensus       654 ~~~~eA~~~ga~alf--gekygd~VRVV~I~~~d~~~~S~ElCGGTHV~nTgeIG~fkIise~si~sGvRRIeavtG~  729 (898)
                      +++++|++.+++++|  |++|+++||||+|+     ++|+|+||||||.||||||.|+|++++++++|+|||+|+||+
T Consensus       680 ~~~~ea~~~~~~~l~~~g~~~~~~vRvV~I~-----~~d~e~CGGTHV~nT~eIg~~kI~~~~~i~~Gv~RI~~v~Ge  752 (752)
T 2zze_A          680 LPRTTAEQXYGFRLYQGGVVPGREIRVVXIE-----DWDVQACGGTHLPSTGLVGPIXILRTERIQDGVERIIFACGE  752 (752)
T ss_dssp             EEHHHHHHHHCGGGCSSCCCCSSEEEEEEET-----TTEEEECCSCCCSBGGGGCCEEEEEEEEEETTEEEEEEEECC
T ss_pred             CCHHHHHHCCCCCCCCCCCCCCCEEEEEEEC-----CEEECCCCCCCCCCHHHCCCEEEEEEEEECCCCEEEEEEECC
T ss_conf             5799998669820024888889827999989-----935465787030149768856999887686995899998187



>2ztg_A Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthetase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: A5A; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1yfs_A Alanyl-tRNA synthetase; alpha-beta fold, helix-loop-helix motif, amino acid binding, ligase; 2.08A {Aquifex aeolicus} SCOP: a.203.1.1 d.104.1.1 PDB: 1yfr_A* 1riq_A 1yft_A 1ygb_A 3htz_A Back     alignment and structure
>3hy0_A Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, protein biosynthesis, nucleotide-binding, amino acid-binding, acetylation; HET: G5A EPE; 1.90A {Escherichia coli} PDB: 3hxz_A* 3hy1_A* 3hxv_A* 3hxu_A* 3hxw_A* 3hxx_A* 3hxy_A* Back     alignment and structure
>3kew_A DHHA1 domain protein; structural genomics, PSI-2, tRNA synthase, protein structure initiative; 2.00A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2e1b_A PH0108, 216AA long hypothetical alanyl-tRNA synthetase; zinc-binding motif, trans-editing enzyme, structural genomics, NPPSFA; 2.70A {Pyrococcus horikoshii} SCOP: b.43.3.6 d.67.1.2 Back     alignment and structure
>1v4p_A Alanyl-tRNA synthetase; alanine-tRNA ligase, riken structural genomics/proteomics initiative RSGI, structural genomics; 1.45A {Pyrococcus horikoshii} SCOP: d.67.1.2 PDB: 1wxo_A 1v7o_A 1wnu_A Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>1tke_A Threonyl-tRNA synthetase; ligase; 1.46A {Escherichia coli} SCOP: d.15.10.1 d.67.1.1 PDB: 1tje_A 1tkg_A* 1tky_A* Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, mRNA, aminoacylation, translational regulation, protein/RNA, ligase/RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>2zvf_A Alanyl-tRNA synthetase; C-terminal, oligomerization domain, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 3.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3g98_A Alanyl-tRNA synthetase; alpha and beta fold, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1j5w_A Glycyl-tRNA synthetase alpha chain; structural genomics, TM0216, JCSG, PSI, protein structure initiative; 1.95A {Thermotoga maritima} SCOP: d.104.1.1 Back     alignment and structure
>2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
d1riqa2236 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aqu 3e-80
d1riqa1221 a.203.1.1 (A:237-457) Putative anticodon-binding domain 2e-45
d2e1ba2129 d.67.1.2 (A:88-216) AlaX-M trans-editing enzyme, C-term 7e-21
d1v4pa_151 d.67.1.2 (A:) Hypothetical protein PH0574 {Archaeon Pyr 3e-19
d1nyra3179 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), s 1e-16
d1tkea2162 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), s 2e-10
d2e1ba187 b.43.3.6 (A:1-87) AlaX-M trans-editing enzyme, N-termin 3e-09
>d1riqa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]} Length = 236 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Alanyl-tRNA synthetase (AlaRS)
species: Aquifex aeolicus [TaxId: 63363]
 Score =  294 bits (753), Expect = 3e-80
 Identities = 127/242 (52%), Positives = 170/242 (70%), Gaps = 8/242 (3%)

Query: 3   NVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVT 62
           +   IR  FL FF+K GH  + S+ L+P NDPTL+F N+GMVPFKN+F G EK  Y+  T
Sbjct: 3   SAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRAT 62

Query: 63  TVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQ 122
           + QKC+R  GKHNDL+ VG T+RHHTFFEMLGNFSFG YFK+ AI+ AW+ +T+   L +
Sbjct: 63  SCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPK 122

Query: 123 RRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGEC 182
            +LY++VY +DEEA+++W +  G+ +++I R+   DNFW M + GPCGP SEI+ D+GE 
Sbjct: 123 EKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEE 182

Query: 183 IPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTN 242
             G         ERY+EIWNLVFMQ+ +        LP  +IDTGMGLER+A+VLQ K +
Sbjct: 183 YEG--------DERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNS 234

Query: 243 NY 244
           N+
Sbjct: 235 NF 236


>d1riqa1 a.203.1.1 (A:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]} Length = 221 Back     information, alignment and structure
>d2e1ba2 d.67.1.2 (A:88-216) AlaX-M trans-editing enzyme, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 129 Back     information, alignment and structure
>d1v4pa_ d.67.1.2 (A:) Hypothetical protein PH0574 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 151 Back     information, alignment and structure
>d1nyra3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Staphylococcus aureus [TaxId: 1280]} Length = 179 Back     information, alignment and structure
>d1tkea2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d2e1ba1 b.43.3.6 (A:1-87) AlaX-M trans-editing enzyme, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 87 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target898 alanyl-tRNA synthetase [Candidatus Liberibacter asiatic
d1riqa2236 Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId 100.0
d1j5wa_281 Glycyl-tRNA synthetase (GlyRS) alpha chain {Thermotoga 97.88
d1nnha_293 Hypothetical protein PF1951 {Archaeon Pyrococcus furios 91.34
d1riqa1221 Putative anticodon-binding domain of alanyl-tRNA synthe 100.0
d2e1ba2129 AlaX-M trans-editing enzyme, C-terminal domain {Pyrococ 99.97
d1v4pa_151 Hypothetical protein PH0574 {Archaeon Pyrococcus horiko 99.96
d1nyra3179 Threonyl-tRNA synthetase (ThrRS), second 'additional' d 99.96
d1tkea2162 Threonyl-tRNA synthetase (ThrRS), second 'additional' d 99.66
d2e1ba187 AlaX-M trans-editing enzyme, N-terminal domain {Pyrococ 99.44
d1ir6a_385 Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} 91.73
d1jjca_266 Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {The 90.91
>d1riqa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Alanyl-tRNA synthetase (AlaRS)
species: Aquifex aeolicus [TaxId: 63363]
Probab=100.00  E-value=0  Score=865.82  Aligned_cols=235  Identities=54%  Similarity=1.022  Sum_probs=230.8

Q ss_pred             CCHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCHHEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCHHHCC
Q ss_conf             78789999999999978988911667566778710023014347554005887999998511154322489878634346
Q gi|254780191|r    2 SNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVG   81 (898)
Q Consensus         2 ~s~~eiR~~fl~fF~~~~H~~~~s~slvp~~d~~llft~Agm~~fk~~f~G~~~p~~~r~~~~QkCiR~ggkhnDld~VG   81 (898)
                      ||++|||++||+||++|||+++|||||||+||||||||||||+||||||+|.++||++|+|++|||||+|||||||||||
T Consensus         2 mt~~eiR~~Fl~FF~~~gH~~v~s~slvp~~DptlLFtnAGM~~Fkp~flG~~~p~~~r~~~~QkCiR~~gk~nDld~VG   81 (236)
T d1riqa2           2 LSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVG   81 (236)
T ss_dssp             CCHHHHHHHHHHHHHHTTCEECCCCCSSCTTCTTCSSCCSTTGGGHHHHTTSSCCSCSEEEEEEEEECEETTEECTTTTT
T ss_pred             CCHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCEEEECCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCC
T ss_conf             98899999999999867998857877356999974654101022266646764567776444321401167430223138


Q ss_pred             CCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHEEEEECCCHHHHHHHHHHHCCCCHHHEEECCCCCCCC
Q ss_conf             48850017888542231475378899989986133418981237999718828999975663499989975357866654
Q gi|254780191|r   82 RTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFW  161 (898)
Q Consensus        82 ~t~rH~TfFEMlGn~SfgdYfK~eai~~awe~lt~~~~l~~~~l~vtv~~~D~e~~~iW~~~~gi~~~~i~~~~~~dNfW  161 (898)
                      +|+|||||||||||||||||||+|||.|||||||++|+|||+|||||||++|+||+++|.+.+|||++||++++.+||||
T Consensus        82 ~t~rH~TfFEMLGn~SFgdYfK~eai~~awe~lt~~l~l~~~rl~vtv~~~D~e~~~~w~~~~gi~~~rI~~~~~~dNfW  161 (236)
T d1riqa2          82 YTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFW  161 (236)
T ss_dssp             TSSSCCSEEEEEEEEESSSCCHHHHHHHHHHHHHHTSCCCGGGEEEEEETTCHHHHHHHHTTTCCCGGGEEEECHHHHEE
T ss_pred             CCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCCEECCCCCCCC
T ss_conf             76531105554352013860288899999999888851576424787515748998888760482004415337777724


Q ss_pred             CCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCC
Q ss_conf             57999998770467885385568988877788982689600112344304788756576653101757999999988798
Q gi|254780191|r  162 SMAETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKT  241 (898)
Q Consensus       162 ~~g~~GpcGPcsEi~~d~g~~~~~~~~~~~~~~~r~lEiwNlVFmq~~~~~~g~~~~Lp~~~IDTGmGLERl~~vlqg~~  241 (898)
                      +||++||||||||||||+|+++.        +++|||||||||||||+|.++|++.|||+|+|||||||||||||+||++
T Consensus       162 ~~g~~GpcGPcsEi~yd~g~~~~--------~~~r~lEIwNlVFmqy~~~~~G~~~~L~~k~IDTGmGLERi~~vlqg~~  233 (236)
T d1riqa2         162 QMGDVGPCGPSSEIYVDRGEEYE--------GDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKN  233 (236)
T ss_dssp             ESSSSEEEEEEEEEEEECCTTSC--------HHHHEEEEEEEEEEEEEECTTSCEEEEEEEEEEEEEEHHHHHHHHTTCS
T ss_pred             CCCCCCCCCCCEEEEECCCCCCC--------CCCCEEEEEEEEHEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHCCCC
T ss_conf             06897777765347871333337--------8976566311001000106898654388971658966999999985999


Q ss_pred             CCC
Q ss_conf             530
Q gi|254780191|r  242 NNY  244 (898)
Q Consensus       242 s~y  244 (898)
                      |||
T Consensus       234 s~y  236 (236)
T d1riqa2         234 SNF  236 (236)
T ss_dssp             SGG
T ss_pred             CCC
T ss_conf             899



>d1j5wa_ d.104.1.1 (A:) Glycyl-tRNA synthetase (GlyRS) alpha chain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1riqa1 a.203.1.1 (A:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2e1ba2 d.67.1.2 (A:88-216) AlaX-M trans-editing enzyme, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v4pa_ d.67.1.2 (A:) Hypothetical protein PH0574 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nyra3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tkea2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e1ba1 b.43.3.6 (A:1-87) AlaX-M trans-editing enzyme, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 898 alanyl-tRNA synthetase [Candidatus Liberibacter as
1yfs_A_1-237237 (A:1-237) Alanyl-tRNA synthetase; alpha-beta fold, 8e-94
3hy0_A_1-252252 (A:1-252) Alanyl-tRNA synthetase; aminoacyl-tRNA s 7e-92
2zze_A_1-266266 (A:1-266) Alanyl-tRNA synthetase; ligase, hydrolas 4e-62
2ztg_A_1-260260 (A:1-260) Alanyl-tRNA synthetase; class-II aminoac 9e-59
1c0a_A_129-271_422-557279 (A:129-271,A:422-557) Aspartyl tRNA synthetase; pr 5e-28
1nnh_A_294 (A:) Asparaginyl-tRNA synthetase-related peptide; 2e-24
2ztg_A_261-423163 (A:261-423) Alanyl-tRNA synthetase; class-II amino 6e-48
2zze_A_267-426160 (A:267-426) Alanyl-tRNA synthetase; ligase, hydrol 4e-42
3hy0_A_253-368116 (A:253-368) Alanyl-tRNA synthetase; aminoacyl-tRNA 6e-38
1yfs_A_238-355118 (A:238-355) Alanyl-tRNA synthetase; alpha-beta fol 2e-36
2zze_A_603-752150 (A:603-752) Alanyl-tRNA synthetase; ligase, hydrol 3e-30
2ztg_A_590-739150 (A:590-739) Alanyl-tRNA synthetase; class-II amino 1e-29
1qf6_A_64-224161 (A:64-224) THRRS, threonyl-tRNA synthetase; tRNA(T 1e-28
1v4p_A_157 (A:) Alanyl-tRNA synthetase; alanine-tRNA ligase, 5e-28
3kew_A_89-241153 (A:89-241) DHHA1 domain protein; structural genomi 8e-27
2e1b_A_89-216128 (A:89-216) PH0108, 216AA long hypothetical alanyl- 1e-24
1yfs_A_356-465110 (A:356-465) Alanyl-tRNA synthetase; alpha-beta fol 9e-22
3g98_A_111 (A:) Alanyl-tRNA synthetase; alpha and beta fold, 9e-21
3hy0_A_369-44173 (A:369-441) Alanyl-tRNA synthetase; aminoacyl-tRNA 1e-17
2zze_A_427-50377 (A:427-503) Alanyl-tRNA synthetase; ligase, hydrol 1e-14
2ztg_A_424-49471 (A:424-494) Alanyl-tRNA synthetase; class-II amino 1e-12
2zvf_A_27-171145 (A:27-171) Alanyl-tRNA synthetase; C-terminal, oli 6e-17
1nyr_A_66-134_188-224106 (A:66-134,A:188-224) Threonyl-tRNA synthetase 1; A 7e-17
2zze_A_504-60299 (A:504-602) Alanyl-tRNA synthetase; ligase, hydrol 1e-16
2e1b_A_1-8888 (A:1-88) PH0108, 216AA long hypothetical alanyl-tR 3e-13
3kew_A_1-8888 (A:1-88) DHHA1 domain protein; structural genomics 1e-11
2ztg_A_495-58995 (A:495-589) Alanyl-tRNA synthetase; class-II amino 2e-15
>1yfs_A (A:1-237) Alanyl-tRNA synthetase; alpha-beta fold, helix-loop-helix motif, amino acid binding, ligase; 2.08A {Aquifex aeolicus}Length = 237 Back     alignment and structure
 Score =  339 bits (871), Expect = 8e-94
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 8/238 (3%)

Query: 7   IRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVPFKNIFTGQEKPVYQAVTTVQK 66
           IR  FL FF+K GH  + S+ L+P NDPTL+F N+GMVPFKN+F G EK  Y+  T+ QK
Sbjct: 8   IRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQK 67

Query: 67  CVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKERAIQLAWDLLTKEFDLDQRRLY 126
           C+R  GKHNDL+ VG T+RHHTFFEMLGNFSFG YFK+ AI+ AW+ +T+   L + +LY
Sbjct: 68  CLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLY 127

Query: 127 ITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSMAETGPCGPCSEIFFDQGECIPGG 186
           ++VY +DEEA+++W +  G+ +++I R+   DNFW M + GPCGP SEI+ D+GE   G 
Sbjct: 128 VSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEG- 186

Query: 187 LPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKMSIDTGMGLERMATVLQEKTNNY 244
                   ERY+EIWNLVFMQ+ +        LP  +IDTGMGLER+A+VLQ K +N+
Sbjct: 187 -------DERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNF 237


>3hy0_A (A:1-252) Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, protein biosynthesis, nucleotide-binding, amino acid-binding, acetylation; HET: G5A EPE; 1.90A {Escherichia coli} PDB: 3hxz_A* 3hy1_A* 3hxv_A* 3hxu_A* 3hxw_A* 3hxx_A* 3hxy_A*Length = 252 Back     alignment and structure
>2zze_A (A:1-266) Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2.16A {Pyrococcus horikoshii} PDB: 2zzf_A 2zzg_A*Length = 266 Back     alignment and structure