254780194

254780194

50S ribosomal protein L31

GeneID in NCBI database:8209174Locus tag:CLIBASIA_00395
Protein GI in NCBI database:254780194Protein Accession:YP_003064607.1
Gene range:+(83786, 84010)Protein Length:74aa
Gene description:50S ribosomal protein L31
COG prediction:[J] Ribosomal protein L31
KEGG prediction:rpmE; 50S ribosomal protein L31; K02909 large subunit ribosomal protein L31
SEED prediction:LSU ribosomal protein L31p
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70----
MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSIE
cccccccccEEEEEEEccccEEEEEEEEcccccEEEEEEcccccccEEccEEEEEEccccHHHHHHHHHHcccc
cccccccccEEEEEEEccccEEEEEccccccccEEEEEcccccccccccccEEEEcccccHHHHcccccccccc
mkknihpetHLITVVMtdgtqyqtrstwkeegavmkldidplshfawiggrqkitdrggqvsrFKKRFAGLSIE
mkknihpethlitvvmtdgtqyQTRSTWKEEGAVMKLDIDPLSHFAWIGGrqkitdrggqvsrfkkrfaglsie
MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSIE
MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFA*L***
MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSIE
***NIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSI*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSIE
MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSIE
MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSIE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target74 50S ribosomal protein L31 [Candidatus Liberibacter asia
31512276674 50S ribosomal protein L31 [Candidatus Liberibacter sola 1 1e-32
11470660073 50S ribosomal protein L31 [Fulvimarina pelagi HTCC2506] 1 1e-22
31940624773 50S ribosomal protein L31 [Bartonella sp. AR 15-3] Leng 1 2e-22
1589120673 50S ribosomal protein L31 [Agrobacterium tumefaciens st 1 5e-22
1596652773 50S ribosomal protein L31 [Sinorhizobium meliloti 1021] 1 6e-22
11625375673 50S ribosomal protein L31 [Rhizobium leguminosarum bv. 1 6e-22
8635909773 50S ribosomal protein L31 [Rhizobium etli CFN 42] Lengt 1 2e-21
11063551973 50S ribosomal protein L31 [Mesorhizobium sp. BNC1] Leng 1 2e-21
32718883286 50S ribosomal protein L31 [Rhizobium etli CNPAF512] Len 1 2e-21
10348743375 50S ribosomal protein L31 [Sphingopyxis alaskensis RB22 1 2e-21
>gi|315122766|ref|YP_004063255.1| 50S ribosomal protein L31 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 74 Back     alignment and organism information
 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 73/74 (98%)

Query: 1  MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQ 60
          MKKNIHP+THLITVVMTDGT+YQTR+TWKEEGAVMKLDIDPLSH AWIGG++KITDRGGQ
Sbjct: 1  MKKNIHPKTHLITVVMTDGTEYQTRTTWKEEGAVMKLDIDPLSHSAWIGGKRKITDRGGQ 60

Query: 61 VSRFKKRFAGLSIE 74
          VS+FKKRF+GLSIE
Sbjct: 61 VSKFKKRFSGLSIE 74


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|114706600|ref|ZP_01439501.1| 50S ribosomal protein L31 [Fulvimarina pelagi HTCC2506] Length = 73 Back     alignment and organism information
>gi|319406247|emb|CBI79884.1| 50S ribosomal protein L31 [Bartonella sp. AR 15-3] Length = 73 Back     alignment and organism information
>gi|15891206|ref|NP_356878.1| 50S ribosomal protein L31 [Agrobacterium tumefaciens str. C58] Length = 73 Back     alignment and organism information
>gi|15966527|ref|NP_386880.1| 50S ribosomal protein L31 [Sinorhizobium meliloti 1021] Length = 73 Back     alignment and organism information
>gi|116253756|ref|YP_769594.1| 50S ribosomal protein L31 [Rhizobium leguminosarum bv. viciae 3841] Length = 73 Back     alignment and organism information
>gi|86359097|ref|YP_470989.1| 50S ribosomal protein L31 [Rhizobium etli CFN 42] Length = 73 Back     alignment and organism information
>gi|110635519|ref|YP_675727.1| 50S ribosomal protein L31 [Mesorhizobium sp. BNC1] Length = 73 Back     alignment and organism information
>gi|327188832|gb|EGE56026.1| 50S ribosomal protein L31 [Rhizobium etli CNPAF512] Length = 86 Back     alignment and organism information
>gi|103487433|ref|YP_616994.1| 50S ribosomal protein L31 [Sphingopyxis alaskensis RB2256] Length = 75 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target74 50S ribosomal protein L31 [Candidatus Liberibacter asia
PRK0052871 PRK00528, rpmE, 50S ribosomal protein L31; Reviewed 5e-27
TIGR0010568 TIGR00105, L31, ribosomal protein L31 4e-23
COG025475 COG0254, RpmE, Ribosomal protein L31 [Translation, ribo 2e-14
PRK0001972 PRK00019, rpmE, 50S ribosomal protein L31; Reviewed 2e-10
PRK0167887 PRK01678, rpmE2, 50S ribosomal protein L31 type B; Revi 4e-09
PRK0139778 PRK01397, PRK01397, 50S ribosomal protein L31; Provisio 1e-04
CHL0013668 CHL00136, rpl31, ribosomal protein L31; Validated 9e-04
pfam0119769 pfam01197, Ribosomal_L31, Ribosomal protein L31 3e-16
>gnl|CDD|179057 PRK00528, rpmE, 50S ribosomal protein L31; Reviewed Back     alignment and domain information
>gnl|CDD|129211 TIGR00105, L31, ribosomal protein L31 Back     alignment and domain information
>gnl|CDD|30603 COG0254, RpmE, Ribosomal protein L31 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178797 PRK00019, rpmE, 50S ribosomal protein L31; Reviewed Back     alignment and domain information
>gnl|CDD|179318 PRK01678, rpmE2, 50S ribosomal protein L31 type B; Reviewed Back     alignment and domain information
>gnl|CDD|179294 PRK01397, PRK01397, 50S ribosomal protein L31; Provisional Back     alignment and domain information
>gnl|CDD|177058 CHL00136, rpl31, ribosomal protein L31; Validated Back     alignment and domain information
>gnl|CDD|144697 pfam01197, Ribosomal_L31, Ribosomal protein L31 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 74 50S ribosomal protein L31 [Candidatus Liberibacter asia
PRK0052871 rpmE 50S ribosomal protein L31; Reviewed 99.97
PRK0167886 rpmE2 50S ribosomal protein L31 type B; Reviewed 99.97
PRK0001971 rpmE 50S ribosomal protein L31; Reviewed 99.96
COG025475 RpmE Ribosomal protein L31 [Translation, ribosomal stru 99.95
pfam0119769 Ribosomal_L31 Ribosomal protein L31. 99.95
TIGR0010577 L31 ribosomal protein L31; InterPro: IPR002150 Ribosome 99.94
PRK0139778 50S ribosomal protein L31; Provisional 99.93
CHL0013672 rpl31 ribosomal protein L31; Validated 99.93
>PRK00528 rpmE 50S ribosomal protein L31; Reviewed Back     alignment and domain information
>PRK01678 rpmE2 50S ribosomal protein L31 type B; Reviewed Back     alignment and domain information
>PRK00019 rpmE 50S ribosomal protein L31; Reviewed Back     alignment and domain information
>COG0254 RpmE Ribosomal protein L31 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01197 Ribosomal_L31 Ribosomal protein L31 Back     alignment and domain information
>TIGR00105 L31 ribosomal protein L31; InterPro: IPR002150 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK01397 50S ribosomal protein L31; Provisional Back     alignment and domain information
>CHL00136 rpl31 ribosomal protein L31; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target74 50S ribosomal protein L31 [Candidatus Liberibacter asia
2aw4_Z70 Crystal Structure Of The Bacterial Ribosome From Es 3e-19
2j01_471 Structure Of The Thermus Thermophilus 70s Ribosome 2e-18
3d5b_497 Structural Basis For Translation Termination On The 1e-17
1nkw_Y73 Crystal Structure Of The Large Ribosomal Subunit Fr 4e-12
3bbo_1144 Homology Model For The Spinach Chloroplast 50s Subu 5e-12
3fin_450 T. Thermophilus 70s Ribosome In Complex With Mrna, 2e-10
gi|83754085|pdb|2AW4|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 70 Back     alignment and structure
 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 1  MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQ 60
          MKK+IHP+   IT   + G   + RST   +   + LD+    H  +  G+Q+    GG+
Sbjct: 1  MKKDIHPKYEEITASCSCGNVMKIRSTVGHD---LNLDVCSKCHP-FFTGKQRDVATGGR 56

Query: 61 VSRFKKRF 68
          V RF KRF
Sbjct: 57 VDRFNKRF 64


gi|116668226|pdb|2J01|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 71 Back     alignment and structure
>gi|209156544|pdb|3D5B|4 Chain 4, Structural Basis For Translation Termination On The 70s Ribosome. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes As Described In Remark 400. Length = 97 Back     alignment and structure
gi|28948943|pdb|1NKW|Y Chain Y, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 73 Back     alignment and structure
gi|189096149|pdb|3BBO|1 Chain 1, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 144 Back     alignment and structure
>gi|224510773|pdb|3FIN|4 Chain 4, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 50 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target74 50S ribosomal protein L31 [Candidatus Liberibacter asia
1vs6_Z70 50S ribosomal protein L31; ribosome, kasugamycin; 3.46A 1e-18
1nkw_Y73 50S ribosomal protein L31; ribosome, large subunit, X- 4e-18
3bbo_1144 Ribosomal protein L31; large ribosomal subunit, spinach 1e-17
3f1f_497 50S ribosomal protein L31; RF2, ribosome, termination, 4e-16
2j01_471 50S ribosomal protein L31; ribosome, tRNA, paromomycin, 2e-15
>1vs6_Z 50S ribosomal protein L31; ribosome, kasugamycin; 3.46A {Escherichia coli} SCOP: d.325.1.2 PDB: 1vs8_Z 2aw4_Z 2awb_Z 2j28_Z 2rdo_Z 2vhm_Z 2vhn_Z 3bbx_Z 3e1b_S 3e1d_S Length = 70 Back     alignment and structure
 Score = 86.3 bits (214), Expect = 1e-18
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 1  MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQ 60
          MKK+IHP+   IT   + G   + RST   +   + LD+    H  + G  Q+    GG+
Sbjct: 1  MKKDIHPKYEEITASCSCGNVMKIRSTVGHD---LNLDVCSKCHPFFTGK-QRDVATGGR 56

Query: 61 VSRFKKRFAGLS 72
          V RF KRF    
Sbjct: 57 VDRFNKRFNIPG 68


>1nkw_Y 50S ribosomal protein L31; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1nwx_Y* 1nwy_Y* 1pnu_Y 1pny_Y 1sm1_Y* 1vor_1 1vou_1 1vow_1 1voy_1 1vp0_1 1xbp_Y* 1yl3_4 2b66_4 2b9n_4 2b9p_4 Length = 73 Back     alignment and structure
>3bbo_1 Ribosomal protein L31; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Length = 144 Back     alignment and structure
>3f1f_4 50S ribosomal protein L31; RF2, ribosome, termination, tRNA; 3.00A {Thermus thermophilus} PDB: 3d5d_4 3d5b_4 3f1h_4 Length = 97 Back     alignment and structure
>2j01_4 50S ribosomal protein L31; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: d.325.1.2 PDB: 2hgq_3 2hgj_3 2hgu_3 2j03_4 2v47_4 2v49_4 2wdi_4 2wdj_4 2wdl_4 2wdn_4 2wh2_4 3hux_4 3huz_4 3fin_4 2wh4_4 Length = 71 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target74 50S ribosomal protein L31 [Candidatus Liberibacter asia
1nkw_Y73 50S ribosomal protein L31; ribosome, large subunit, X- 99.95
3f1f_497 50S ribosomal protein L31; RF2, ribosome, termination, 99.94
1vs6_Z70 50S ribosomal protein L31; ribosome, kasugamycin; 3.46A 99.93
2j01_471 50S ribosomal protein L31; ribosome, tRNA, paromomycin, 99.92
3bbo_1144 Ribosomal protein L31; large ribosomal subunit, spinach 99.88
>1nkw_Y 50S ribosomal protein L31; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1nwx_Y* 1nwy_Y* 1pnu_Y 1pny_Y 1sm1_Y* 1vor_1 1vou_1 1vow_1 1voy_1 1vp0_1 1xbp_Y* 1yl3_4 2b66_4 2b9n_4 2b9p_4 Back     alignment and structure
Probab=99.95  E-value=3.4e-28  Score=187.04  Aligned_cols=68  Identities=25%  Similarity=0.410  Sum_probs=64.0

Q ss_pred             CCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCEEEEEECCCCCCCEECCCEEEEECCCHHHHHHHHHHCCCC
Q ss_conf             9887889840799998799979988765476886999854877897116817897213648999977602678
Q gi|254780194|r    1 MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSI   73 (74)
Q Consensus         1 MKk~IHP~y~~v~v~~t~g~~~~t~sT~g~~~~~~~vdi~s~~HP~fytgkq~~~dt~GrveKF~kkfg~~~~   73 (74)
                      ||+||||+|+++.|.|+||++|.+.||.    |++.|||||+||| ||||+|+++|++|||||||+|||++..
T Consensus         1 MKk~IHP~y~~~~v~~~~~~~~~~~st~----~~~~vdv~s~~HP-fyTGkq~~vdt~GRVekF~krf~~~~~   68 (73)
T 1nkw_Y            1 MQKDLHPKAVPCKIIYQGQVVMETMSTR----PEIHVDVWSGVHP-FWTGEERFLDTEGRVDKFNKRFGDSYR   68 (73)
T ss_pred             CCCCCCCCCEEEEEEECCCCEEEECCCC----CCEEEEECCCCCC-CEECCEEEEECCCCHHHHHHHHHHHCC
T ss_conf             9887799988799998998699954116----6278887688877-181878887236509999998740312



>3f1f_4 50S ribosomal protein L31; RF2, ribosome, termination, tRNA; 3.00A {Thermus thermophilus} PDB: 3d5d_4 3d5b_4 3f1h_4 Back     alignment and structure
>1vs6_Z 50S ribosomal protein L31; ribosome, kasugamycin; 3.46A {Escherichia coli} SCOP: d.325.1.2 PDB: 1vs8_Z 2aw4_Z 2awb_Z 2j28_Z 2rdo_Z 2vhm_Z 2vhn_Z 3bbx_Z 3e1b_S 3e1d_S Back     alignment and structure
>2j01_4 50S ribosomal protein L31; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: d.325.1.2 PDB: 2hgq_3 2hgj_3 2hgu_3 2j03_4 2v47_4 2v49_4 2wdi_4 2wdj_4 2wdl_4 2wdn_4 2wh2_4 2wrj_4 2wrl_4 2wro_4 2wrr_4 2x9s_4 2x9u_4 2xg0_4 2xg2_4 3hux_4 ... Back     alignment and structure
>3bbo_1 Ribosomal protein L31; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 74 50S ribosomal protein L31 [Candidatus Liberibacter asia
d1vs6z170 d.325.1.2 (Z:1-70) Ribosomal protein L31p {Escherichia 1e-18
d2j014150 d.325.1.2 (4:1-50) Ribosomal protein L31p {Thermus ther 8e-11
>d1vs6z1 d.325.1.2 (Z:1-70) Ribosomal protein L31p {Escherichia coli [TaxId: 562]} Length = 70 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: L28p-like
superfamily: L28p-like
family: Ribosomal protein L31p
domain: Ribosomal protein L31p
species: Escherichia coli [TaxId: 562]
 Score = 85.2 bits (211), Expect = 1e-18
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 1  MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQ 60
          MKK+IHP+   IT   + G   + RST   +   + LD+    H  + G  Q+    GG+
Sbjct: 1  MKKDIHPKYEEITASCSCGNVMKIRSTVGHD---LNLDVCSKCHPFFTGK-QRDVATGGR 56

Query: 61 VSRFKKRFAGLS 72
          V RF KRF    
Sbjct: 57 VDRFNKRFNIPG 68


>d2j0141 d.325.1.2 (4:1-50) Ribosomal protein L31p {Thermus thermophilus [TaxId: 274]} Length = 50 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target74 50S ribosomal protein L31 [Candidatus Liberibacter asia
d1vs6z170 Ribosomal protein L31p {Escherichia coli [TaxId: 562]} 99.94
d2j014150 Ribosomal protein L31p {Thermus thermophilus [TaxId: 27 99.7
>d1vs6z1 d.325.1.2 (Z:1-70) Ribosomal protein L31p {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: L28p-like
superfamily: L28p-like
family: Ribosomal protein L31p
domain: Ribosomal protein L31p
species: Escherichia coli [TaxId: 562]
Probab=99.94  E-value=6.5e-30  Score=195.78  Aligned_cols=70  Identities=36%  Similarity=0.529  Sum_probs=66.7

Q ss_pred             CCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCEEEEEECCCCCCCEECCCEEEEECCCHHHHHHHHHHCCCCC
Q ss_conf             98878898407999987999799887654768869998548778971168178972136489999776026789
Q gi|254780194|r    1 MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSIE   74 (74)
Q Consensus         1 MKk~IHP~y~~v~v~~t~g~~~~t~sT~g~~~~~~~vdi~s~~HP~fytgkq~~~dt~GrveKF~kkfg~~~~k   74 (74)
                      ||+||||+|++|++.|+||++|.++||++.+   +.|||||+||| ||||+|+++|++|||||||+|||.+++|
T Consensus         1 MKk~IHP~y~~v~~~~s~g~~f~~~sT~~~e---~~vdi~s~~HP-fyTG~q~~~dt~GRVekF~krf~~~~~K   70 (70)
T d1vs6z1           1 MKKDIHPKYEEITASCSCGNVMKIRSTVGHD---LNLDVCSKCHP-FFTGKQRDVATGGRVDRFNKRFNIPGSK   70 (70)
T ss_dssp             CCCTTSCCCCCCBCCCCSSCCCCCBCCCCCC---CCCBCCSSSCC-BCCCCCTTTTTHHHHSCSSTTTTTTSCC
T ss_pred             CCCCCCCCCEEEEEEECCCCEEEEEEEECCC---EEEEECCCCCC-CCCCCEEEEECCCCHHHHHHHHCCCCCC
T ss_conf             9798799998699997899999973684773---88875788887-5929787861467499998766553579



>d2j0141 d.325.1.2 (4:1-50) Ribosomal protein L31p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 74 50S ribosomal protein L31 [Candidatus Liberibacter
2j01_4_71 (4:) 50S ribosomal protein L31; ribosome, tRNA, pa 2e-19
3f1f_4_97 (4:) 50S ribosomal protein L31; RF2, ribosome, ter 2e-17
3bbo_1_144 (1:) Ribosomal protein L31; large ribosomal subuni 2e-16
1nkw_Y_1-5656 (Y:1-56) 50S ribosomal protein L31; ribosome, larg 4e-14
1vs6_Z_1-2828 (Z:1-28) 50S ribosomal protein L31; ribosome, kasu 9e-08
1vs6_Z_29-7042 (Z:29-70) 50S ribosomal protein L31; ribosome, kas 2e-07
>2j01_4 (4:) 50S ribosomal protein L31; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 71 Back     alignment and structure
 Score = 88.6 bits (220), Expect = 2e-19
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 1  MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQ 60
          MK+ IHP+     ++   G   +T ST  E    + +++    H  +  G+Q+  D  G+
Sbjct: 1  MKEGIHPKLVPARIICGCGNVIETYSTKPE----IYVEVCSKCHPFYT-GQQRFVDTEGR 55

Query: 61 VSRFKKRFAGLS 72
          V RF++R+    
Sbjct: 56 VERFQRRYGDSY 67


>3f1f_4 (4:) 50S ribosomal protein L31; RF2, ribosome, termination, tRNA; 3.00A {Thermus thermophilus} PDB: 3d5d_4 3d5b_4 3f1h_4Length = 97 Back     alignment and structure
>3bbo_1 (1:) Ribosomal protein L31; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana}Length = 144 Back     alignment and structure
>1nkw_Y (Y:1-56) 50S ribosomal protein L31; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans}Length = 56 Back     alignment and structure
>1vs6_Z (Z:1-28) 50S ribosomal protein L31; ribosome, kasugamycin; 3.46A {Escherichia coli}Length = 28 Back     alignment and structure
>1vs6_Z (Z:29-70) 50S ribosomal protein L31; ribosome, kasugamycin; 3.46A {Escherichia coli}Length = 42 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target74 50S ribosomal protein L31 [Candidatus Liberibacter asia
3f1f_4_97 50S ribosomal protein L31; RF2, ribosome, terminat 99.93
2j01_4_71 50S ribosomal protein L31; ribosome, tRNA, paromom 99.93
1nkw_Y_1-5656 50S ribosomal protein L31; ribosome, large subunit 99.89
3bbo_1_144 Ribosomal protein L31; large ribosomal subunit, sp 99.86
1vs6_Z_29-7042 50S ribosomal protein L31; ribosome, kasugamycin; 99.52
1vs6_Z_1-2828 50S ribosomal protein L31; ribosome, kasugamycin; 98.77
3f1f_4_97 50S ribosomal protein L31; RF2, ribosome, terminat 96.82
>3f1f_4 (4:) 50S ribosomal protein L31; RF2, ribosome, termination, tRNA; 3.00A {Thermus thermophilus} PDB: 3d5d_4 3d5b_4 3f1h_4 Back     alignment and structure
Probab=99.93  E-value=1.2e-27  Score=184.71  Aligned_cols=69  Identities=25%  Similarity=0.410  Sum_probs=64.3

Q ss_pred             CCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCEEEEEECCCCCCCEECCCEEEEECCCHHHHHHHHHHCCCCC
Q ss_conf             98878898407999987999799887654768869998548778971168178972136489999776026789
Q gi|254780194|r    1 MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSRFKKRFAGLSIE   74 (74)
Q Consensus         1 MKk~IHP~y~~v~v~~t~g~~~~t~sT~g~~~~~~~vdi~s~~HP~fytgkq~~~dt~GrveKF~kkfg~~~~k   74 (74)
                      ||++|||+|+++++.|+||++|++.||.    |++.|||||+||| ||||+|+++|++|||||||+||+.+..+
T Consensus        27 MKk~IHP~y~~~~v~c~cg~~~~~~sT~----~~i~vdVcs~cHP-FyTG~q~~~dt~GRVekF~krf~~~~~~   95 (97)
T 3f1f_4           27 VKEGIHPKLVPARIICGCGNVIETYSTK----PEIYVEVCSKCHP-FYTGQQRFVDTEGRVERFQRRYGDSYRK   95 (97)
T ss_dssp             ---------CCCEEEETTEEEEECCCSS----CCEEESSCTTC-------------------------------
T ss_pred             CCCCCCCCCEEEEEEECCCCEEEEEECC----CCEEEEECCCCCC-CCCCCEEEEECCCCHHHHHHHHCCCCCC
T ss_conf             5667898878899997899999973525----6589887689877-4818787871567399999987232324



>2j01_4 (4:) 50S ribosomal protein L31; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>1nkw_Y (Y:1-56) 50S ribosomal protein L31; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} Back     alignment and structure
>3bbo_1 (1:) Ribosomal protein L31; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure
>1vs6_Z (Z:29-70) 50S ribosomal protein L31; ribosome, kasugamycin; 3.46A {Escherichia coli} Back     alignment and structure
>1vs6_Z (Z:1-28) 50S ribosomal protein L31; ribosome, kasugamycin; 3.46A {Escherichia coli} Back     alignment and structure
>3f1f_4 (4:) 50S ribosomal protein L31; RF2, ribosome, termination, tRNA; 3.00A {Thermus thermophilus} PDB: 3d5d_4 3d5b_4 3f1h_4 Back     alignment and structure