254780195

254780195

CTP synthetase

GeneID in NCBI database:8209176Locus tag:CLIBASIA_00400
Protein GI in NCBI database:254780195Protein Accession:YP_003064608.1
Gene range:-(85675, 87309)Protein Length:544aa
Gene description:CTP synthetase
COG prediction:none
KEGG prediction:pyrG; CTP synthetase (EC:6.3.4.2); K01937 CTP synthase [EC:6.3.4.2]
SEED prediction:CTP synthase (EC 6.3.4.2)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:pyrimidine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540----
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQSL
ccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccEEccccccccccccEEEEEccccEEccccccEEEEccccccccccccHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHccccHHHEEEcccccHHHHHHHHHHHcccHHHHHHHccccccccccHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHccccEEEEcccccccccccHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHcccccccHHccccccccccccHHHcccccccccccccccccEEEcccEEEEEcccccHHHHHcccccEEccccccccccHHHHHHHHcccEEEEEcccccEEEEEEEccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcc
cccEEEEccccEccccHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccEEEccccccccccccccHHHccccccccccccccHHHHHHHHHHcccccccccEEEcccccHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHcccccccEEEEEEEccHcHHHccccccccccccHHHHHHccccccEEEEEccccccHHHHHHHHHHccccHHHEEEcccHHHHHHcHHHHHHccccHHHHHHccccccccccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEEEEEcHHHHcccHHHHHccccEEEEccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccHccccccEEEEcHHHccccEEccccccccccccHHHHHHcccEEEHHcccHHHccHHHHHHHHHcccEEEcccccccEEEEEEcccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcc
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRvrkldpylnsdpgtmspvqhgevfvtddggeadldfghyerfmgistakadnitagriyknvidrerrgdylgtTVQVIPHVTNEIKEFITQGNEDADFVICEiggtigdievMPFVEAIRQFGNEFSHRGSKALYIHLTLMpyirssgelktkptqHSVKELqalgvhpdilliradrdipEMERRKISLfcnvpmsavipaldvddiykvplsyhregiDSVVLNafgienvslpqidnwqTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLswidaetlekedpvkhfygvhgilvpggfgkrgsegKIAAIKFArenkipflgICFGMQMAVIEAARNLagipnacstefseaGVPVIALMSEWmkgdqqekrlpsddlgatmrlgaydvslkEETLISRiygldliperhrhRYEVNVRYREKlegcglkfsgfsvdhaLPEVVeyinhpwfigvqyhpelksrpldphplfvSFIQATVLYSQSL
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGistakadnitagriyknvidrerrgdYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKElqalgvhpdillIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGIlvpggfgkrgSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQekrlpsddlgatMRLGAYdvslkeetlisriygldliperhrHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQSL
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQSL
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKG**********DLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYS***
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQSL
*VKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQSL
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQSL
MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target544 CTP synthetase [Candidatus Liberibacter asiaticus str.
254780414 520 GMP synthase [Candidatus Liberibacter asiaticus st 0.007
>gi|254780414|ref|YP_003064827.1| GMP synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 520 Back     alignment
 Score = 33.9 bits (76), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 9/68 (13%)

Query: 373 ENKIPFLGICFGMQMAVIEAARNLAG-IPNACSTEFSEAGVPVIA----LMSEWMKGDQQ 427
           E+ IP LGIC+G Q+      ++L G   N+ S EF  A + +      L   W KG +Q
Sbjct: 77  ESNIPLLGICYGQQI----MCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQ 132

Query: 428 EKRLPSDD 435
           +  +   D
Sbjct: 133 QVWMSHGD 140

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target544 CTP synthetase [Candidatus Liberibacter asiaticus str.
315122622546 CTP synthetase [Candidatus Liberibacter solanacearum CL 1 0.0
190891862542 CTP synthase protein [Rhizobium etli CIAT 652] Length = 1 0.0
15888931578 CTP synthetase [Agrobacterium tumefaciens str. C58] Len 1 0.0
86357800542 CTP synthetase [Rhizobium etli CFN 42] Length = 542 1 0.0
24212127542 RecName: Full=CTP synthase; AltName: Full=CTP synthetas 1 0.0
325293008542 CTP synthase [Agrobacterium sp. H13-3] Length = 542 1 0.0
222086037566 CTP synthase [Agrobacterium radiobacter K84] Length = 5 1 0.0
150396290542 CTP synthetase [Sinorhizobium medicae WSM419] Length = 1 0.0
222148651555 CTP synthetase [Agrobacterium vitis S4] Length = 555 1 0.0
209549426542 CTP synthetase [Rhizobium leguminosarum bv. trifolii WS 1 0.0
>gi|315122622|ref|YP_004063111.1| CTP synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 546 Back     alignment and organism information
 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/542 (82%), Positives = 490/542 (90%)

Query: 1   MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVF 60
           MV+YIFITGGVVSSLGKGVAAASLGALLQA +YKVRVRKLDPYLN+DPGTMSP+QHGEVF
Sbjct: 1   MVRYIFITGGVVSSLGKGVAAASLGALLQARQYKVRVRKLDPYLNTDPGTMSPMQHGEVF 60

Query: 61  VTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTN 120
           VTDDG EADLD GHYERFM IS+AK DNIT GRIY +VID+ERRGDYLG TVQVIPHVTN
Sbjct: 61  VTDDGAEADLDLGHYERFMNISSAKTDNITTGRIYNSVIDKERRGDYLGATVQVIPHVTN 120

Query: 121 EIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPY 180
           EIKEFIT+GNED DFVICEIGGT+GDIE MPFVEAIRQ GNE  + GS+ LY+HLTLMPY
Sbjct: 121 EIKEFITKGNEDVDFVICEIGGTVGDIEAMPFVEAIRQLGNELLYHGSRPLYMHLTLMPY 180

Query: 181 IRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPAL 240
           I+SSGELKTKPTQ SVKELQALGVHPDILLIR DR+IPEMERRK+SLFCNVPMSAVI AL
Sbjct: 181 IKSSGELKTKPTQRSVKELQALGVHPDILLIRVDREIPEMERRKLSLFCNVPMSAVIQAL 240

Query: 241 DVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKY 300
           DVDDIYK+P++YH EG+DSV+L+ FGI++   PQ+ NW  FCD  LSLKNEVK+AIVGKY
Sbjct: 241 DVDDIYKIPITYHHEGMDSVILDTFGIKDAQAPQLQNWHVFCDHILSLKNEVKIAIVGKY 300

Query: 301 IHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRG 360
            HLKDAYRSLIEALRH G++N+TKVQL WIDA  LEKEDP  H   VHGILVPGGF KRG
Sbjct: 301 THLKDAYRSLIEALRHGGINNHTKVQLLWIDAGALEKEDPAIHLREVHGILVPGGFDKRG 360

Query: 361 SEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSE 420
           SEGKI AIKFARENKIPFLGICFGMQMAV+EAARNL GI +ACSTEFSE G PVIALMSE
Sbjct: 361 SEGKIVAIKFARENKIPFLGICFGMQMAVVEAARNLVGIHDACSTEFSEPGEPVIALMSE 420

Query: 421 WMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYRE 480
           WMK  Q+EKRL SDDLGATMRLGAYD+SLKE++LIS+IY LDLI ERHRHRYEVN+ Y+E
Sbjct: 421 WMKEGQKEKRLVSDDLGATMRLGAYDISLKEKSLISKIYNLDLISERHRHRYEVNLNYKE 480

Query: 481 KLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLY 540
           KLE CGLKFSGFS+D+ALPEVVEYINHPWFIGVQYHPELKSRPL+PHPLF+SF+QAT+ Y
Sbjct: 481 KLEECGLKFSGFSIDNALPEVVEYINHPWFIGVQYHPELKSRPLNPHPLFISFVQATLSY 540

Query: 541 SQ 542
           SQ
Sbjct: 541 SQ 542


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891862|ref|YP_001978404.1| CTP synthase protein [Rhizobium etli CIAT 652] Length = 542 Back     alignment and organism information
>gi|15888931|ref|NP_354612.1| CTP synthetase [Agrobacterium tumefaciens str. C58] Length = 578 Back     alignment and organism information
>gi|86357800|ref|YP_469692.1| CTP synthetase [Rhizobium etli CFN 42] Length = 542 Back     alignment and organism information
>gi|24212127|sp|Q8UEY5|PYRG_AGRT5 RecName: Full=CTP synthase; AltName: Full=CTP synthetase; AltName: Full=UTP--ammonia ligase Length = 542 Back     alignment and organism information
>gi|325293008|ref|YP_004278872.1| CTP synthase [Agrobacterium sp. H13-3] Length = 542 Back     alignment and organism information
>gi|222086037|ref|YP_002544569.1| CTP synthase [Agrobacterium radiobacter K84] Length = 566 Back     alignment and organism information
>gi|150396290|ref|YP_001326757.1| CTP synthetase [Sinorhizobium medicae WSM419] Length = 542 Back     alignment and organism information
>gi|222148651|ref|YP_002549608.1| CTP synthetase [Agrobacterium vitis S4] Length = 555 Back     alignment and organism information
>gi|209549426|ref|YP_002281343.1| CTP synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 542 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target544 CTP synthetase [Candidatus Liberibacter asiaticus str.
PRK05380533 PRK05380, pyrG, CTP synthetase; Validated 0.0
TIGR00337525 TIGR00337, PyrG, CTP synthase 0.0
PLN02327557 PLN02327, PLN02327, CTP synthase 1e-166
KOG2387585 KOG2387, KOG2387, KOG2387, CTP synthase (UTP-ammonia ly 1e-163
COG0504533 COG0504, PyrG, CTP synthase (UTP-ammonia lyase) [Nucleo 0.0
pfam06418275 pfam06418, CTP_synth_N, CTP synthase N-terminus 1e-136
cd03113255 cd03113, CTGs, CTP synthetase (CTPs) is a two-domain pr 1e-116
cd01746235 cd01746, GATase1_CTP_Synthase, Type 1 glutamine amidotr 1e-100
pfam00117187 pfam00117, GATase, Glutamine amidotransferase class-I 2e-29
PRK06186229 PRK06186, PRK06186, hypothetical protein; Validated 3e-29
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferase (GA 3e-09
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATa 6e-08
COG2071243 COG2071, COG2071, Predicted glutamine amidotransferases 2e-08
PRK11366254 PRK11366, puuD, gamma-glutamyl-gamma-aminobutyrate hydr 1e-04
pfam07722219 pfam07722, Peptidase_C26, Peptidase C26 3e-04
>gnl|CDD|180047 PRK05380, pyrG, CTP synthetase; Validated Back     alignment and domain information
>gnl|CDD|161825 TIGR00337, PyrG, CTP synthase Back     alignment and domain information
>gnl|CDD|177961 PLN02327, PLN02327, CTP synthase Back     alignment and domain information
>gnl|CDD|37598 KOG2387, KOG2387, KOG2387, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30850 COG0504, PyrG, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|148179 pfam06418, CTP_synth_N, CTP synthase N-terminus Back     alignment and domain information
>gnl|CDD|48377 cd03113, CTGs, CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain Back     alignment and domain information
>gnl|CDD|153217 cd01746, GATase1_CTP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>gnl|CDD|143892 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|180452 PRK06186, PRK06186, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|32254 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|183101 PRK11366, puuD, gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|116336 pfam07722, Peptidase_C26, Peptidase C26 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 544 CTP synthetase [Candidatus Liberibacter asiaticus str.
TIGR00337571 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is 100.0
PRK05380534 pyrG CTP synthetase; Validated 100.0
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide trans 100.0
KOG2387585 consensus 100.0
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 99.37
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme meta 98.41
pfam06418275 CTP_synth_N CTP synthase N-terminus. This family consis 100.0
cd03113255 CTGs CTP synthetase (CTPs) is a two-domain protein, whi 100.0
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransferase 100.0
PRK06186229 hypothetical protein; Validated 100.0
pfam07722219 Peptidase_C26 Peptidase C26. These peptidases have gamm 99.92
pfam00117187 GATase Glutamine amidotransferase class-I. 99.86
PRK00758184 GMP synthase subunit A; Validated 99.69
PRK13147211 consensus 99.65
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransferase 99.64
PRK13141204 hisH imidazole glycerol phosphate synthase subunit HisH 99.64
PRK13143201 hisH imidazole glycerol phosphate synthase subunit HisH 99.61
cd01744178 GATase1_CPSase Small chain of the glutamine-dependent f 99.6
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransferase 99.6
PRK05670192 anthranilate synthase component II; Provisional 99.57
PRK13176216 consensus 99.56
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine amidotra 99.55
COG0118204 HisH Glutamine amidotransferase [Amino acid transport a 99.54
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine amid 99.54
PRK13152201 hisH imidazole glycerol phosphate synthase subunit HisH 99.53
PRK12564355 carbamoyl phosphate synthase small subunit; Reviewed 99.51
PRK13153203 consensus 99.51
PRK08007187 para-aminobenzoate synthase component II; Provisional 99.49
CHL00101190 trpG anthranilate synthase component 2 99.49
PRK13181199 hisH imidazole glycerol phosphate synthase subunit HisH 99.49
CHL00188210 hisH imidazole glycerol phosphate synthase subunit hisH 99.48
PRK13175206 consensus 99.48
PRK13179207 consensus 99.47
PRK07765221 para-aminobenzoate synthase component II; Provisional 99.47
PRK13177207 consensus 99.47
PRK13146208 hisH imidazole glycerol phosphate synthase subunit HisH 99.47
PRK13173211 consensus 99.46
PRK13171200 consensus 99.45
TIGR01855211 IMP_synth_hisH imidazole glycerol phosphate synthase, g 99.45
PRK06895191 para-aminobenzoate synthase component II; Provisional 99.43
PRK06774191 para-aminobenzoate synthase component II; Provisional 99.42
PRK13174212 consensus 99.42
PRK13148225 consensus 99.41
PRK13178213 consensus 99.4
PRK13144190 consensus 99.39
PRK12838356 carbamoyl phosphate synthase small subunit; Reviewed 99.39
PRK13170196 hisH imidazole glycerol phosphate synthase subunit HisH 99.38
PRK13180209 consensus 99.38
PRK13151195 consensus 99.34
PRK08857192 para-aminobenzoate synthase component II; Provisional 99.33
COG0505368 CarA Carbamoylphosphate synthase small subunit [Amino a 99.3
PRK13172213 consensus 99.29
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransf 99.29
PRK13566724 anthranilate synthase; Provisional 99.21
PRK09522 531 bifunctional anthranilate synthase/anthranilate phospho 99.19
PRK13142192 hisH imidazole glycerol phosphate synthase subunit HisH 99.16
PRK05637208 anthranilate synthase component II; Provisional 99.16
TIGR01823 851 PabB-fungal para-aminobenzoate synthase; InterPro: IPR0 99.05
TIGR00566212 trpG_papA glutamine amidotransferase of anthranilate sy 98.89
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 98.89
KOG1224 767 consensus 98.85
PRK05665240 amidotransferase; Provisional 98.79
KOG0623 541 consensus 98.58
PRK03619223 phosphoribosylformylglycinamidine synthase subunit I; P 98.33
PRK01175255 phosphoribosylformylglycinamidine synthase subunit I; P 98.07
KOG3179245 consensus 98.0
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GATase1 97.03
PRK05368302 homoserine O-succinyltransferase; Provisional 96.67
pfam04204298 HTS Homoserine O-succinyltransferase. 96.57
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Prov 99.96
COG2071243 Predicted glutamine amidotransferases [General function 99.93
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 glutam 99.84
TIGR00888195 guaA_Nterm GMP synthase, N-terminal domain; InterPro: I 99.46
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 glutam 99.19
PRK00074 513 guaA GMP synthase; Reviewed 99.13
PRK07567242 glutamine amidotransferase; Provisional 98.95
PRK09065238 glutamine amidotransferase; Provisional 98.95
PRK06490243 glutamine amidotransferase; Provisional 98.9
COG0518198 GuaA GMP synthase - Glutamine amidotransferase domain [ 98.88
PRK07053235 glutamine amidotransferase; Provisional 98.85
PRK08250235 glutamine amidotransferase; Provisional 98.83
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 98.77
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, 98.5
KOG1622 552 consensus 98.2
TIGR01737264 FGAM_synth_I phosphoribosylformylglycinamidine synthase 98.16
KOG0370 1435 consensus 98.07
KOG1559340 consensus 97.72
KOG0026223 consensus 97.68
TIGR01368383 CPSaseIIsmall carbamoyl-phosphate synthase, small subun 99.54
CHL00197383 carA carbamoyl-phosphate synthase arginine-specific sma 99.49
PRK13527196 glutamine amidotransferase subunit PdxT; Provisional 99.49
pfam01174188 SNO SNO glutamine amidotransferase family. This family 99.48
PRK13525191 glutamine amidotransferase subunit PdxT; Provisional 99.41
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) involv 99.28
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATa 97.92
COG0311194 PDX2 Predicted glutamine amidotransferase involved in p 97.91
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1)-lik 97.75
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like 97.67
PRK13526179 glutamine amidotransferase subunit PdxT; Provisional 96.15
KOG3210226 consensus 95.67
PRK052971294 phosphoribosylformylglycinamidine synthase; Provisional 95.28
PRK01911290 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 94.51
PRK01231296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 94.42
PRK04759294 consensus 94.12
PRK03378292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 94.11
PRK04539296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.6
PRK02649305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.57
PRK03372303 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.44
PRK02155291 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.01
cd03137187 GATase1_AraC_1 AraC transcriptional regulators having a 92.43
PRK03708278 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 92.18
PRK02645304 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 90.77
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATas 90.61
PRK00784492 cobyric acid synthase; Provisional 99.16
pfam07685158 GATase_3 CobB/CobQ-like glutamine amidotransferase doma 97.9
PRK13896432 cobyrinic acid a,c-diamide synthase; Provisional 97.8
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1 97.7
pfam01965141 DJ-1_PfpI DJ-1/PfpI family. The family includes the pro 92.56
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GATase1) 92.47
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1 92.31
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransferase ( 91.13
COG0693188 ThiJ Putative intracellular protease/amidase [General f 90.64
PRK00090223 bioD dithiobiotin synthetase; Reviewed 97.16
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 96.65
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 96.32
PRK12374231 putative dithiobiotin synthetase; Provisional 95.45
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 94.56
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 92.7
PRK00081199 coaE dephospho-CoA kinase; Reviewed 90.5
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 96.77
cd02040270 NifH NifH gene encodes component II (iron protein) of n 95.48
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 94.86
CHL00175279 minD septum-site determining protein; Validated 94.55
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 93.9
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 93.77
PRK13869405 plasmid-partitioning protein RepA; Provisional 93.74
PRK10818270 cell division inhibitor MinD; Provisional 93.14
cd03114148 ArgK-like The function of this protein family is unkown 92.83
PRK13233275 nifH nitrogenase reductase; Reviewed 91.03
PRK06761281 hypothetical protein; Provisional 91.01
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 96.52
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 95.59
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 92.11
TIGR00313502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 95.59
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 95.18
PRK06278482 cobyrinic acid a,c-diamide synthase; Validated 94.33
TIGR01382189 PfpI intracellular protease, PfpI family; InterPro: IPR 91.38
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic b 90.63
cd06302298 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of 90.44
>TIGR00337 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2387 consensus Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>pfam06418 CTP_synth_N CTP synthase N-terminus Back     alignment and domain information
>cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>pfam07722 Peptidase_C26 Peptidase C26 Back     alignment and domain information
>pfam00117 GATase Glutamine amidotransferase class-I Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK13147 consensus Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK13176 consensus Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK13153 consensus Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK13175 consensus Back     alignment and domain information
>PRK13179 consensus Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK13177 consensus Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13173 consensus Back     alignment and domain information
>PRK13171 consensus Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit; InterPro: IPR010139 Imidazole glycerol phosphate synthetase (IGPS) is a key metabolic enzyme, which links amino acid and nucleotide biosynthesis: it catalyses the closure of the imidazole ring within histidine biosynthesis (fifth step), and provides the substrate for de novo purine biosynthesis Back     alignment and domain information
>PRK06895 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK13174 consensus Back     alignment and domain information
>PRK13148 consensus Back     alignment and domain information
>PRK13178 consensus Back     alignment and domain information
>PRK13144 consensus Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13180 consensus Back     alignment and domain information
>PRK13151 consensus Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13172 consensus Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>TIGR01823 PabB-fungal para-aminobenzoate synthase; InterPro: IPR010117 This entry represents the fungal clade of para-aminobenzoate synthase, which acts on chorismate to form para-aminobenzoic acid (PABA), a precursor of folate Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or para-aminobenzoate synthase; InterPro: IPR006221 This entry presents the glutamine amidotransferase domain or peptide of the tryptophan-biosynthetic pathway enzyme anthranilate synthase or of the folate biosynthetic pathway enzyme para-aminobenzoate synthase Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>KOG1224 consensus Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>KOG0623 consensus Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase subunit I; Provisional Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase subunit I; Provisional Back     alignment and domain information
>KOG3179 consensus Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>pfam04204 HTS Homoserine O-succinyltransferase Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase, N-terminal domain; InterPro: IPR004739 The N-terminal region of GMP synthase 6 Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium) Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I; InterPro: IPR010075 In some species, phosphoribosylformylglycinamidine synthase is composed of a single polypeptide chain Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>KOG1559 consensus Back     alignment and domain information
>KOG0026 consensus Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit; InterPro: IPR006274 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>pfam01174 SNO SNO glutamine amidotransferase family Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>KOG3210 consensus Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04759 consensus Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02155 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>pfam07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>pfam01965 DJ-1_PfpI DJ-1/PfpI family Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>pfam01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>pfam09140 MipZ ATPase MipZ Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>pfam02374 ArsA_ATPase Anion-transporting ATPase Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family; InterPro: IPR006286 Peptidases are grouped into clans and families Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target544 CTP synthetase [Candidatus Liberibacter asiaticus str.
1s1m_A545 Crystal Structure Of E. Coli Ctp Synthetase Length 0.0
1vco_A550 Crystal Structure Of T.Th. Hb8 Ctp Synthetase Compl 0.0
1vcm_A550 Crystal Structure Of T.Th. Hb8 Ctp Synthetase Lengt 0.0
3nva_A535 Dimeric Form Of Ctp Synthase From Sulfolobus Solfat 0.0
2vo1_A295 Crystal Structure Of The Synthetase Domain Of Human 1e-113
3ihl_A282 Human Ctps2 Crystal Structure Length = 282 1e-109
2vkt_A289 Human Ctp Synthetase 2 - Glutaminase Domain Length 3e-64
2v4u_A289 Human Ctp Synthetase 2 - Glutaminase Domain In Comp 1e-63
2w7t_A273 Trypanosoma Brucei Ctps - Glutaminase Domain With B 1e-54
3fij_A254 Crystal Structure Of A Uncharacterized Protein Lin1 2e-05
gi|50513424|pdb|1S1M|A Chain A, Crystal Structure Of E. Coli Ctp Synthetase Length = 545 Back     alignment and structure
 Score =  708 bits (1829), Expect = 0.0,   Method: Composition-based stats.
 Identities = 280/544 (51%), Positives = 367/544 (67%), Gaps = 6/544 (1%)

Query: 2   VKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFV 61
             YIF+TGGVVSSLGKG+AAASL A+L+A    V + KLDPY+N DPGTMSP+QHGEVFV
Sbjct: 3   TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFV 62

Query: 62  TDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNE 121
           T+DG E DLD GHYERF+    ++ +N T GRIY +V+ +ERRGDYLG TVQVIPH+TN 
Sbjct: 63  TEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNA 122

Query: 122 IKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYI 181
           IKE + +G E  D V+ EIGGT+GDIE +PF+EAIRQ   E        L++HLTL+PY+
Sbjct: 123 IKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVEIGR--EHTLFMHLTLVPYM 180

Query: 182 RSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALD 241
            +SGE+KTKPTQHSVKEL ++G+ PDIL+ R+DR +P  ER KI+LFCNVP  AVI   D
Sbjct: 181 AASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKD 240

Query: 242 VDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYI 301
           VD IYK+P     +G+D  +   F   N     +  W+       +  +EV + +VGKYI
Sbjct: 241 VDSIYKIPGLLKSQGLDDYICKRF-SLNCPEANLSEWEQVIFEEANPVSEVTIGMVGKYI 299

Query: 302 HLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGS 361
            L DAY+S+IEAL+H G+ N   V +  ID++ +E     +   G+  ILVPGGFG RG 
Sbjct: 300 ELPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGV-EILKGLDAILVPGGFGYRGV 358

Query: 362 EGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEF-SEAGVPVIALMSE 420
           EG I   +FAREN IP+LGIC GMQ+A+I+ AR++A + NA STEF  +   PV+AL++E
Sbjct: 359 EGMITTARFARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVALITE 418

Query: 421 WMKGDQQ-EKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYR 479
           W   +   E R    DLG TMRLGA    L +++L+ ++Y    I ERHRHRYEVN    
Sbjct: 419 WRDENGNVEVRSEKSDLGGTMRLGAQQCQLVDDSLVRQLYNAPTIVERHRHRYEVNNMLL 478

Query: 480 EKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVL 539
           +++E  GL+ +G S D  L E++E  NHPWF+  Q+HPE  S P D HPLF  F++A   
Sbjct: 479 KQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASE 538

Query: 540 YSQS 543
           + + 
Sbjct: 539 FQKR 542


>gi|52696106|pdb|1VCO|A Chain A, Crystal Structure Of T.Th. Hb8 Ctp Synthetase Complex With Glutamine Length = 550 Back     alignment and structure
gi|52696104|pdb|1VCM|A Chain A, Crystal Structure Of T.Th. Hb8 Ctp Synthetase Length = 550 Back     alignment and structure
gi|306440665|pdb|3NVA|A Chain A, Dimeric Form Of Ctp Synthase From Sulfolobus Solfataricus Length = 535 Back     alignment and structure
>gi|169791764|pdb|2VO1|A Chain A, Crystal Structure Of The Synthetase Domain Of Human Ctp Synthetase Length = 295 Back     alignment and structure
>gi|261278796|pdb|3IHL|A Chain A, Human Ctps2 Crystal Structure Length = 282 Back     alignment and structure
>gi|165761263|pdb|2VKT|A Chain A, Human Ctp Synthetase 2 - Glutaminase Domain Length = 289 Back     alignment and structure
>gi|209156387|pdb|2V4U|A Chain A, Human Ctp Synthetase 2 - Glutaminase Domain In Complex With 5-Oxo-L-Norleucine Length = 289 Back     alignment and structure