254780207

254780207

hypothetical protein CLIBASIA_00460

GeneID in NCBI database:8209188Locus tag:CLIBASIA_00460
Protein GI in NCBI database:254780207Protein Accession:YP_003064620.1
Gene range:+(97816, 98112)Protein Length:98aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAVYTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK
cHHHHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEEEEEEcHHHccccccccccEEEcHHHHHcccEEEEEEcccccccHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHEcccccEccccEEEEEEccccccccccccccccccEEEEcHHHHHcccEEEEEccccccccHHHHHHHHHHHccc
MRHLILIMLLSILTTNIARAQVyhihspriatkssihikchsctlnkhhinktpssssavytkkeelidgkkamittdnfmggepiTFIKYLFEEDKK
MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCtlnkhhinktpssssavytKKEELIDGKKamittdnfmggepITFIKYLFEEDKK
MRHlilimllsilTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAVYTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK
*RHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSC**********************ELIDGKKAMITTDNFMGGEPITFIKYLFE****
MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAVYTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK
*RHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHI**TPSSSSAVYTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEED**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiii
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAVYTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target98 hypothetical protein CLIBASIA_00460 [Candidatus Liberib
315122632119 hypothetical protein CKC_04420 [Candidatus Liberibacter 1 8e-13
>gi|315122632|ref|YP_004063121.1| hypothetical protein CKC_04420 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 119 Back     alignment and organism information
 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 1   MRHLILIMLLSILTTNIARAQ-VYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSS-SS 58
           M  L+L ++L   +  + +AQ VY IH P      SI++KC SC L K   +   +  + 
Sbjct: 1   MNFLMLAVILFAFSAQVGKAQSVYEIHHPIRTQDFSIYVKCLSCELPKQSKSNIQNQLND 60

Query: 59  AVYTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK 98
            + T+KEE+IDGK A++ TDN MG EP TFIK+   E++K
Sbjct: 61  VISTQKEEIIDGKNAIVMTDNLMGDEPETFIKHFKHEEQK 100


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00