254780206

254780206

phosphoribosylamine--glycine ligase

GeneID in NCBI database:8209187Locus tag:CLIBASIA_00455
Protein GI in NCBI database:254780206Protein Accession:YP_003064619.1
Gene range:+(96451, 97725)Protein Length:424aa
Gene description:phosphoribosylamine--glycine ligase
COG prediction:[F] Phosphoribosylamine-glycine ligase
KEGG prediction:purD; phosphoribosylamine--glycine ligase (EC:6.3.4.13); K01945 phosphoribosylamine--glycine ligase [EC:6.3.4.13]
SEED prediction:Phosphoribosylamine--glycine ligase (EC 6.3.4.13)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420----
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKYRNKS
cEEEEEcccHHHHHHHHHHHHcccccEEEEEcccHHHHHHccEEccccccHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHcccEEEcccHHHHHHHHcHHHHHHHHHHcccccccccEEccHHHHHHHHHHccccEEEEEccccccccEEEEccHHHHHHHHHHHHHHccccEEEEEEEcccEEEEEEEEcccEEEEEEEcHHHHHHcccccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccEEEEEEccccccccccccccccccccccccEEEEccEEEEccEEEEcccEEEEEEEEcccHHHHHHHHHHHHHcccccccEEccHHHHHHHHccccccccc
ccEEEEccccHHHHHHHHHHcccccEEEEEccccccccccccccccccccHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHcccccccccHHHHHHHHcHHHHHHHHHHcccccHHHHccccHHHHHHHHHHccccEEEEEccccccccEEEEccHHHHHHHHHHHHcccccEEEEEEHccccEEEEEEEEccccEEEcccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHcccccEEEEEEEEEEcccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccccccccccEEEccccHccccEEEEEccccccccEEEcccEEEEEEcccHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHccccccc
mrvlligsggrEHALAWKIAQSPllselwsipgnpgiaqHAQCVAIDIQNHSAIIHFCQEKHIdlvvvgpelplvngISDALnaagfkvfgpsqraaklESSKSFAKKFCTkygiptatyqhfsdpmkakqyvqnksmpivvkadglcagkGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFalcdgktaipfttardhkrihdgdigpntggmgacspalgmSQELYSTVIQKIILPTiegmqkeqnpfqGVLFAGLmiteqgpylieynvrfgdpeCQAMMMRLESDILEILNscvhgnlhnthINWKAEYALTVVVAtkgypeeyphgtiiskipqntgttqlfHAGTaivnnnltanggrVLSATALGKTITESRELAYHMVENIdwkhgywrediglqkkernvkyrnks
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIpfttardhkrihdGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVenidwkhgywrediglqkkernvkyrnks
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKYRNKS
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK***********
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGP***********SFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER********
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKYRNKS
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKYRNKS
MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKYRNKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target424 phosphoribosylamine--glycine ligase [Candidatus Liberib
254780268443 acetyl-CoA carboxylase biotin carboxylase subunit 1e-06
>gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Back     alignment
 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 8/113 (7%)

Query: 87  FKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADG 146
            K  GPS    K+   K  AKK   + GIP         P  A    +    P++VKA  
Sbjct: 100 IKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASA 159

Query: 147 LCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEG---FEVSFF 191
              G+G+ +A + ++ + AID+   +      N  V IE+YLE     EV  F
Sbjct: 160 GGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIF 212

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target424 phosphoribosylamine--glycine ligase [Candidatus Liberib
315122631414 phosphoribosylamine--glycine ligase [Candidatus Liberib 1 0.0
222147723426 phosphoribosylamine--glycine ligase [Agrobacterium viti 1 1e-140
13476192425 phosphoribosylamine--glycine ligase [Mesorhizobium loti 1 1e-138
222085071423 phosphoribosylamine-glycine ligase protein [Agrobacteri 1 1e-138
227821053423 phosphoribosylamine--glycine ligase [Sinorhizobium fred 1 1e-138
319784734425 phosphoribosylamine/glycine ligase [Mesorhizobium cicer 1 1e-137
159184405423 phosphoribosylamine--glycine ligase [Agrobacterium tume 1 1e-136
163761031426 phosphoribosylamine--glycine ligase [Hoeflea phototroph 1 1e-136
150395696423 phosphoribosylamine--glycine ligase [Sinorhizobium medi 1 1e-136
190890598423 phosphoribosylamine-glycine ligase [Rhizobium etli CIAT 1 1e-135
>gi|315122631|ref|YP_004063120.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 414 Back     alignment and organism information
 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/414 (78%), Positives = 377/414 (91%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSPLLSELWS  GNPGIAQHA+C+ +D+++H AII FCQ+
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPLLSELWSTSGNPGIAQHAKCIPLDVEDHLAIIQFCQK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLV++GPELPLVNGISDALN+AGFKVFGPS+RA++LESSK F KKFCTKY IPTA Y
Sbjct: 61  KKIDLVIIGPELPLVNGISDALNSAGFKVFGPSKRASQLESSKFFTKKFCTKYSIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           QHF+DP+ AK+YV+ + MPIV+KADG+ AGKGVVVA T+D A  AIDRCFQQINSTV+IE
Sbjct: 121 QHFADPIVAKKYVKTQKMPIVIKADGIFAGKGVVVATTLDAAIVAIDRCFQQINSTVVIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           EYLEGFEVSFFA+CDGK A+PFTTARDHKR+ DGDIGPNTGGMGACSPALG+S+ELYST+
Sbjct: 181 EYLEGFEVSFFAICDGKIAVPFTTARDHKRVGDGDIGPNTGGMGACSPALGLSKELYSTI 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           I+ II PT+EGM++E+ PFQGVLFAGLMIT+Q PYLIEYNVRFGDPECQAMMMRLESDIL
Sbjct: 241 IKTIIQPTVEGMKQEKIPFQGVLFAGLMITKQKPYLIEYNVRFGDPECQAMMMRLESDIL 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT 360
           EILNSC  GNLHNT I+WKAEYALTVVVAT GYPE YP GT+I KIP +T  T+LFHAGT
Sbjct: 301 EILNSCAQGNLHNTTIDWKAEYALTVVVATNGYPETYPKGTVIRKIPLDTDKTKLFHAGT 360

Query: 361 AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +I++ +L ANGGRVL+ATALGKTI+ESRE AY+MVE+IDW+HG+WR+DIGLQKK
Sbjct: 361 SIIDGSLVANGGRVLNATALGKTISESRERAYNMVEDIDWEHGFWRKDIGLQKK 414


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147723|ref|YP_002548680.1| phosphoribosylamine--glycine ligase [Agrobacterium vitis S4] Length = 426 Back     alignment and organism information
>gi|13476192|ref|NP_107762.1| phosphoribosylamine--glycine ligase [Mesorhizobium loti MAFF303099] Length = 425 Back     alignment and organism information
>gi|222085071|ref|YP_002543601.1| phosphoribosylamine-glycine ligase protein [Agrobacterium radiobacter K84] Length = 423 Back     alignment and organism information
>gi|227821053|ref|YP_002825023.1| phosphoribosylamine--glycine ligase [Sinorhizobium fredii NGR234] Length = 423 Back     alignment and organism information
>gi|319784734|ref|YP_004144210.1| phosphoribosylamine/glycine ligase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 425 Back     alignment and organism information
>gi|159184405|ref|NP_353670.2| phosphoribosylamine--glycine ligase [Agrobacterium tumefaciens str. C58] Length = 423 Back     alignment and organism information
>gi|163761031|ref|ZP_02168109.1| phosphoribosylamine--glycine ligase [Hoeflea phototrophica DFL-43] Length = 426 Back     alignment and organism information
>gi|150395696|ref|YP_001326163.1| phosphoribosylamine--glycine ligase [Sinorhizobium medicae WSM419] Length = 423 Back     alignment and organism information
>gi|190890598|ref|YP_001977140.1| phosphoribosylamine-glycine ligase [Rhizobium etli CIAT 652] Length = 423 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target424 phosphoribosylamine--glycine ligase [Candidatus Liberib
PRK00885420 PRK00885, PRK00885, phosphoribosylamine--glycine ligase 0.0
PLN02257434 PLN02257, PLN02257, phosphoribosylamine--glycine ligase 1e-151
TIGR00877423 TIGR00877, purD, phosphoribosylamine--glycine ligase 1e-150
KOG0237 788 KOG0237, KOG0237, KOG0237, Glycinamide ribonucleotide s 1e-137
PRK13789426 PRK13789, PRK13789, phosphoribosylamine--glycine ligase 1e-98
PRK05784486 PRK05784, PRK05784, phosphoribosylamine--glycine ligase 2e-62
PRK06395435 PRK06395, PRK06395, phosphoribosylamine--glycine ligase 3e-51
COG0151428 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucl 1e-156
PRK13790379 PRK13790, PRK13790, phosphoribosylamine--glycine ligase 2e-88
pfam01071193 pfam01071, GARS_A, Phosphoribosylglycinamide synthetase 3e-77
COG0189318 COG0189, RimK, Glutathione synthase/Ribosomal protein S 0.003
pfam0284499 pfam02844, GARS_N, Phosphoribosylglycinamide synthetase 3e-43
pfam0284392 pfam02843, GARS_C, Phosphoribosylglycinamide synthetase 2e-25
COG0027394 COG0027, PurT, Formate-dependent phosphoribosylglycinam 5e-09
COG0458400 COG0458, CarB, Carbamoylphosphate synthase large subuni 1e-06
TIGR01142380 TIGR01142, purT, phosphoribosylglycinamide formyltransf 6e-06
PRK12767326 PRK12767, PRK12767, carbamoyl phosphate synthase-like p 6e-09
COG0439449 COG0439, AccC, Biotin carboxylase [Lipid metabolism] 7e-09
pfam02655160 pfam02655, ATP-grasp_3, ATP-grasp domain 6e-07
PRK08654499 PRK08654, PRK08654, pyruvate carboxylase subunit A; Val 2e-06
COG1181317 COG1181, DdlA, D-alanine-D-alanine ligase and related A 6e-06
PRK02471752 PRK02471, PRK02471, bifunctional glutamate--cysteine li 1e-05
TIGR01205315 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase 6e-05
COG4770 645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alp 5e-04
TIGR01435737 TIGR01435, glu_cys_lig_rel, glutamate--cysteine ligase/ 7e-04
KOG0369 1176 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy 9e-04
COG0045387 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [E 0.001
COG0026375 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase 0.002
TIGR01161352 TIGR01161, purK, phosphoribosylaminoimidazole carboxyla 0.002
TIGR00514449 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxy 0.003
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 0.004
pfam07478201 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-termin 0.002
>gnl|CDD|179154 PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|177899 PLN02257, PLN02257, phosphoribosylamine--glycine ligase Back     alignment and domain information
>gnl|CDD|162082 TIGR00877, purD, phosphoribosylamine--glycine ligase Back     alignment and domain information
>gnl|CDD|35458 KOG0237, KOG0237, KOG0237, Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|184327 PRK13789, PRK13789, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|180256 PRK05784, PRK05784, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|102357 PRK06395, PRK06395, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|30500 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|184328 PRK13790, PRK13790, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|110097 pfam01071, GARS_A, Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>gnl|CDD|30538 COG0189, RimK, Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145810 pfam02844, GARS_N, Phosphoribosylglycinamide synthetase, N domain Back     alignment and domain information
>gnl|CDD|145809 pfam02843, GARS_C, Phosphoribosylglycinamide synthetase, C domain Back     alignment and domain information
>gnl|CDD|30377 COG0027, PurT, Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30806 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130212 TIGR01142, purT, phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>gnl|CDD|183732 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|30788 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|145680 pfam02655, ATP-grasp_3, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|181524 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|31374 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|179427 PRK02471, PRK02471, bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>gnl|CDD|162248 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase Back     alignment and domain information
>gnl|CDD|34383 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|130502 TIGR01435, glu_cys_lig_rel, glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>gnl|CDD|35590 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30394 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30376 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|162228 TIGR01161, purK, phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|148851 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 424 phosphoribosylamine--glycine ligase [Candidatus Liberib
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 100.0
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK05784485 phosphoribosylamine--glycine ligase; Provisional 100.0
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotide tra 100.0
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 100.0
KOG0237 788 consensus 100.0
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 100.0
PRK02186 892 argininosuccinate lyase; Provisional 100.0
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 99.97
PRK07206415 hypothetical protein; Provisional 99.97
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 99.97
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 99.97
PRK08462446 biotin carboxylase; Validated 99.96
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 99.96
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 99.96
PRK08654497 pyruvate carboxylase subunit A; Validated 99.96
PRK05586447 biotin carboxylase; Validated 99.96
PRK06111449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 99.95
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 99.95
PRK12833458 acetyl-CoA carboxylase biotin carboxylase subunit; Prov 99.95
PRK08591449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 99.95
PRK07178471 acetyl-CoA carboxylase; Validated 99.95
PRK08463478 acetyl-CoA carboxylase; Validated 99.94
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 99.94
PRK12999 1147 pyruvate carboxylase; Reviewed 99.93
TIGR02712 1226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 99.9
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 99.89
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 99.84
KOG0370 1435 consensus 99.55
TIGR01142407 purT phosphoribosylglycinamide formyltransferase 2; Int 99.54
COG2232389 Predicted ATP-dependent carboligase related to biotin c 99.49
pfam01071193 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp 100.0
pfam02786211 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP b 99.9
pfam02655160 ATP-grasp_3 ATP-grasp domain. No functional information 99.83
pfam07478201 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This fam 99.82
pfam08443190 RimK RimK-like ATP-grasp domain. This ATP-grasp domain 99.82
pfam02222171 ATP-grasp ATP-grasp domain. This family does not contai 99.82
pfam02955176 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp 98.76
TIGR02291320 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterP 98.47
KOG1447412 consensus 95.44
TIGR013691089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 100.0
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 100.0
PRK128151068 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK052941063 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.96
PRK10446300 ribosomal protein S6 modification protein; Provisional 99.77
KOG03701435 consensus 99.77
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) 99.54
TIGR00768321 rimK_fam alpha-L-glutamate ligases, RimK family; InterP 99.52
COG3919415 Predicted ATP-grasp enzyme [General function prediction 99.09
PRK05246316 glutathione synthetase; Provisional 98.79
PRK13277363 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuran 98.64
pfam0284499 GARS_N Phosphoribosylglycinamide synthetase, N domain. 99.97
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 97.8
pfam00289109 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N- 97.39
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 96.95
CHL00194319 ycf39 Ycf39; Provisional 96.23
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 95.54
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 95.46
TIGR03023451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotra 95.2
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl 94.93
pfam06849124 DUF1246 Protein of unknown function (DUF1246). This fam 93.75
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.54
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.52
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.5
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.17
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 93.01
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.95
PRK08300298 acetaldehyde dehydrogenase; Validated 92.72
PRK07765221 para-aminobenzoate synthase component II; Provisional 92.6
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 92.49
TIGR02477566 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosphotra 92.33
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.24
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.12
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 92.02
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.04
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.01
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 90.82
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 90.5
TIGR01205375 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: 99.94
PRK01966344 ddl D-alanyl-alanine synthetase A; Reviewed 99.94
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 99.78
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 99.58
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 modifica 99.55
TIGR02144289 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IP 99.51
PRK06524480 biotin carboxylase-like protein; Validated 98.45
PRK12458349 glutathione synthetase; Provisional 98.28
pfam05770307 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase 97.84
TIGR01380322 glut_syn glutathione synthase; InterPro: IPR006284 Thes 97.06
KOG3895488 consensus 94.72
TIGR00514451 accC acetyl-CoA carboxylase, biotin carboxylase; InterP 99.93
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 99.93
KOG0238 670 consensus 99.86
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 99.86
KOG0369 1176 consensus 99.85
KOG0368 2196 consensus 99.66
pfam0284392 GARS_C Phosphoribosylglycinamide synthetase, C domain. 99.92
TIGR01161386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 99.81
PRK06849387 hypothetical protein; Provisional 99.78
PRK13278356 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 98.95
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranos 98.5
TIGR02068 876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 99.61
TIGR02482302 PFKA_ATP 6-phosphofructokinase; InterPro: IPR012828 6-p 93.75
PRK02471753 bifunctional glutamate--cysteine ligase/glutathione syn 99.44
TIGR01016389 sucCoAbeta succinyl-CoA synthetase, beta subunit; Inter 98.98
pfam08442202 ATP-grasp_2 ATP-grasp domain. 98.88
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy prod 98.79
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisional 98.75
KOG2799434 consensus 96.8
TIGR01435754 glu_cys_lig_rel putative glutamate--cysteine ligase/put 95.06
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 94.17
pfam11379355 DUF3182 Protein of unknown function (DUF3182). This fam 93.59
TIGR01361262 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldo 90.53
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 97.08
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 96.84
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 96.44
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 96.17
PRK11579346 putative oxidoreductase; Provisional 95.73
PRK08057241 cobalt-precorrin-6x reductase; Reviewed 95.66
PRK10206345 putative dehydrogenase; Provisional 90.99
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 96.32
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 96.02
PRK07578199 short chain dehydrogenase; Provisional 94.43
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 93.43
PRK10675338 UDP-galactose-4-epimerase; Provisional 93.07
PRK09009235 C factor cell-cell signaling protein; Provisional 92.65
TIGR00715260 precor6x_red precorrin-6x reductase; InterPro: IPR00372 91.54
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 91.4
pfam03133291 TTL Tubulin-tyrosine ligase family. Tubulins and microt 95.9
COG2344211 AT-rich DNA-binding protein [General function predictio 94.39
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 91.07
cd03784401 GT1_Gtf_like This family includes the Gtfs, a group of 92.94
PRK01641201 leuD isopropylmalate isomerase small subunit; Provision 92.83
pfam08886404 GshA Glutamate-cysteine ligase. This is a rare family o 90.79
>TIGR00877 purD phosphoribosylamine--glycine ligase; InterPro: IPR000115 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK07178 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2; InterPro: IPR005862 The formation of isosinate, a precursor of adenylate and guanylate, from 5-phosphoribosyl 1-pyrophosphate in the de novo purine biosynthesis pathway is basically composed of 10 steps of reactions Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>pfam01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>pfam02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>pfam02655 ATP-grasp_3 ATP-grasp domain Back     alignment and domain information
>pfam07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus Back     alignment and domain information
>pfam08443 RimK RimK-like ATP-grasp domain Back     alignment and domain information
>pfam02222 ATP-grasp ATP-grasp domain Back     alignment and domain information
>pfam02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterPro: IPR011758 Members of this protein family contain a region of homology to the RimK family of alpha-L-glutamate ligases (IPR004666 from INTERPRO), various members of which modify the Glu-Glu C-terminus of ribosomal protein S6, or tetrahydromethanopterin, or a form of coenzyme F420 derivative Back     alignment and domain information
>KOG1447 consensus Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family; InterPro: IPR004666 Escherichia coli RimK adds additional Glu residues to the native Glu-Glu C-terminus of ribosomal protein S6 Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>pfam02844 GARS_N Phosphoribosylglycinamide synthetase, N domain Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00289 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>pfam03435 Saccharop_dh Saccharopine dehydrogenase Back     alignment and domain information
>pfam02629 CoA_binding CoA binding domain Back     alignment and domain information
>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>pfam06849 DUF1246 Protein of unknown function (DUF1246) Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR02477 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosphotransferase; InterPro: IPR011183 Diphosphate--fructose-6-phosphate 1-phosphotransferase catalyses the addition of phosphate from diphosphate (PPi) to fructose 6-phosphate to give fructose 1,6-bisphosphate (2 Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: IPR005905 D-alanine--D-alanine ligase (6 Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IPR011870 The family of proteins found in this family include the characterised LysX from Thermus thermophilus which is part of a well-organised lysine biosynthesis gene cluster Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>pfam05770 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthase; InterPro: IPR006284 These are the glutathione synthetases found in Gram-negative bacteria Back     alignment and domain information
>KOG3895 consensus Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549 This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>pfam02843 GARS_C Phosphoribosylglycinamide synthetase, C domain Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, ATPase subunit; InterPro: IPR005875 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>TIGR02482 PFKA_ATP 6-phosphofructokinase; InterPro: IPR012828 6-phosphofructokinase (2 Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site Back     alignment and domain information
>pfam08442 ATP-grasp_2 ATP-grasp domain Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>KOG2799 consensus Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel putative glutamate--cysteine ligase/putative amino acid ligase; InterPro: IPR006335 This entry represents a family with an N-terminal region similar to proteobacterial glutamate-cysteine ligase (gamma-glutamylcysteine synthetase) Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam11379 DUF3182 Protein of unknown function (DUF3182) Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268 These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase) Back     alignment and domain information
>pfam02571 CbiJ Precorrin-6x reductase CbiJ/CobK Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PRK10206 putative dehydrogenase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam03133 TTL Tubulin-tyrosine ligase family Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PRK01641 leuD isopropylmalate isomerase small subunit; Provisional Back     alignment and domain information
>pfam08886 GshA Glutamate-cysteine ligase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target424 phosphoribosylamine--glycine ligase [Candidatus Liberib
1gso_A431 Glycinamide Ribonucleotide Synthetase (Gar-Syn) Fro 1e-92
2yw2_A424 Crystal Structure Of Gar Synthetase From Aquifex Ae 4e-90
2yrw_A451 Crystal Structure Of Gar Synthetase From Geobacillu 3e-89
3mjf_A431 Phosphoribosylamine-Glycine Ligase From Yersinia Pe 4e-88
2qk4_A452 Human Glycinamide Ribonucleotide Synthetase Length 2e-84
2xd4_A422 Nucleotide-Bound Structures Of Bacillus Subtilis Gl 5e-84
2xcl_A422 Nucleotide-Bound Structures Of Bacillus Subtilis Gl 1e-80
2ip4_A417 Crystal Structure Of Glycinamide Ribonucleotide Syn 3e-80
3lp8_A442 Crystal Structure Of Phosphoribosylamine-Glycine Li 1e-73
1vkz_A412 Crystal Structure Of Phosphoribosylamine--Glycine L 2e-58
1kj8_A391 Crystal Structure Of Purt-Encoded Glycinamide Ribon 2e-06
1eyz_A392 Structure Of Escherichia Coli Purt-Encoded Glycinam 2e-06
2czg_A433 Crystal Structure Of Probable Phosphoribosylglycina 8e-06
>gi|6730014|pdb|1GSO|A Chain A, Glycinamide Ribonucleotide Synthetase (Gar-Syn) From E. Coli Length = 431 Back     alignment and structure
 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 3   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 62

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 63  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 122

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 123 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 182

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 183 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 242

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGD E Q +M
Sbjct: 243 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDLETQPIM 302

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 303 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 362

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 363 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 422

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 423 WRAIERE 429


gi|159795596|pdb|2YW2|A Chain A, Crystal Structure Of Gar Synthetase From Aquifex Aeolicus In Complex With Atp Length = 424 Back     alignment and structure
>gi|158431213|pdb|2YRW|A Chain A, Crystal Structure Of Gar Synthetase From Geobacillus Kaustophilus Length = 451 Back     alignment and structure
>gi|296863652|pdb|3MJF|A Chain A, Phosphoribosylamine-Glycine Ligase From Yersinia Pestis Length = 431 Back     alignment and structure
>gi|157835953|pdb|2QK4|A Chain A, Human Glycinamide Ribonucleotide Synthetase Length = 452 Back     alignment and structure
gi|326634053|pdb|2XD4|A Chain A, Nucleotide-Bound Structures Of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase Length = 422 Back     alignment and structure
>gi|326634052|pdb|2XCL|A Chain A, Nucleotide-Bound Structures Of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase Length = 422 Back     alignment and structure