254780212

254780212

bacterioferritin comigratory protein

GeneID in NCBI database:8209193Locus tag:CLIBASIA_00485
Protein GI in NCBI database:254780212Protein Accession:YP_003064625.1
Gene range:+(100088, 100561)Protein Length:157aa
Gene description:bacterioferritin comigratory protein
COG prediction:[O] Peroxiredoxin
KEGG prediction:bacterioferritin comigratory protein; K03564 peroxiredoxin Q/BCP [EC:1.11.1.15]
SEED prediction:Thiol peroxidase, Bcp-type (EC 1.11.1.15)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Thioredoxin-disulfide reductase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
cccccccccccccEEEcccccEEcHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccEEEEEcccHHHHHHcccccccccccccccccEEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHc
ccccEccccccccEcccccccEEEEcHccccEEEEEEccccccccccHHHHcHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccccEccccccHHHHHHccccccccccHHcccEEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHcc
mtslsvgdkaphfvlpsndeQEISLLALGGSkivlyfypkddtsgctaeainfsslkadfdeestiligispdsiashkkfhqkhnlsitlLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
mtslsvgdkaphfvlpsndEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLsitlladeskEVLKSYDVWkeksmfgkkymGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
**S*SVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSL**
********KAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
**SLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target157 bacterioferritin comigratory protein [Candidatus Liberi
315122640158 bacterioferritin comigratory protein [Candidatus Liberi 1 3e-65
325293232155 bacterioferritin comigratory protein [Agrobacterium sp. 1 1e-48
15889133155 bacterioferritin comigratory protein [Agrobacterium tum 1 5e-47
323137718164 alkyl hydroperoxide reductase/ Thiol specific antioxida 1 3e-45
239831799154 alkyl hydroperoxide reductase/ Thiol specific antioxida 1 2e-44
153009592154 alkyl hydroperoxide reductase/ Thiol specific antioxida 1 2e-44
254719022154 alkyl hydroperoxide reductase/ Thiol specific antioxida 1 2e-44
222148400157 bacterioferritin comigratory protein [Agrobacterium vit 1 2e-44
294852278154 peroxiredoxin Q/BCP [Brucella sp. NVSL 07-0026] Length 1 3e-44
182677014157 alkyl hydroperoxide reductase/ Thiol specific antioxida 1 4e-44
>gi|315122640|ref|YP_004063129.1| bacterioferritin comigratory protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
 Score =  251 bits (640), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 120/158 (75%), Positives = 144/158 (91%), Gaps = 2/158 (1%)

Query: 1   MTS--LSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKA 58
           MTS  LS GDKAP F+LPS  E+EISL AL GSK+V+YFYPKDDT+GCTAEAI+FS+LK+
Sbjct: 1   MTSILLSSGDKAPDFILPSTAEKEISLSALKGSKLVIYFYPKDDTTGCTAEAIDFSNLKS 60

Query: 59  DFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMG 118
           DF++EST++IGISPDSI SH KF QK+NLSITLL+DESK++L++YDVWKEK+MFGKKYMG
Sbjct: 61  DFEKESTVVIGISPDSIVSHTKFLQKYNLSITLLSDESKKILQAYDVWKEKNMFGKKYMG 120

Query: 119 VVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLK 156
           VVRTTFLIDE+GII++IW+PV LKNHA+SVL  VKSLK
Sbjct: 121 VVRTTFLIDEQGIISKIWRPVKLKNHAKSVLNAVKSLK 158


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293232|ref|YP_004279096.1| bacterioferritin comigratory protein [Agrobacterium sp. H13-3] Length = 155 Back     alignment and organism information
>gi|15889133|ref|NP_354814.1| bacterioferritin comigratory protein [Agrobacterium tumefaciens str. C58] Length = 155 Back     alignment and organism information
>gi|323137718|ref|ZP_08072794.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylocystis sp. ATCC 49242] Length = 164 Back     alignment and organism information
>gi|239831799|ref|ZP_04680128.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ochrobactrum intermedium LMG 3301] Length = 154 Back     alignment and organism information
>gi|153009592|ref|YP_001370807.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ochrobactrum anthropi ATCC 49188] Length = 154 Back     alignment and organism information
>gi|254719022|ref|ZP_05180833.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Brucella sp. 83/13] Length = 154 Back     alignment and organism information
>gi|222148400|ref|YP_002549357.1| bacterioferritin comigratory protein [Agrobacterium vitis S4] Length = 157 Back     alignment and organism information
>gi|294852278|ref|ZP_06792951.1| peroxiredoxin Q/BCP [Brucella sp. NVSL 07-0026] Length = 154 Back     alignment and organism information
>gi|182677014|ref|YP_001831160.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Beijerinckia indica subsp. indica ATCC 9039] Length = 157 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target157 bacterioferritin comigratory protein [Candidatus Liberi
cd03017140 cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacteriof 6e-46
PRK09437154 PRK09437, bcp, thioredoxin-dependent thiol peroxidase; 1e-36
pfam00578124 pfam00578, AhpC-TSA, AhpC/TSA family 3e-35
cd02971140 cd02971, PRX_family, Peroxiredoxin (PRX) family; compos 2e-34
cd03018149 cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, Ahp 1e-23
cd03015173 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typic 1e-19
COG0450194 COG0450, AhpC, Peroxiredoxin [Posttranslational modific 1e-18
KOG0855211 KOG0855, KOG0855, KOG0855, Alkyl hydroperoxide reductas 4e-17
cd03016203 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PR 3e-15
PTZ00253199 PTZ00253, PTZ00253, tryparedoxin peroxidase; Provisiona 4e-13
KOG0852196 KOG0852, KOG0852, KOG0852, Alkyl hydroperoxide reductas 6e-13
pfam08534142 pfam08534, Redoxin, Redoxin 2e-12
PRK13190202 PRK13190, PRK13190, putative peroxiredoxin; Provisional 1e-11
PRK13189222 PRK13189, PRK13189, peroxiredoxin; Provisional 4e-11
cd03014143 cd03014, PRX_Atyp2cys, Peroxiredoxin (PRX) family, Atyp 2e-10
KOG0854224 KOG0854, KOG0854, KOG0854, Alkyl hydroperoxide reductas 3e-09
COG2077158 COG2077, Tpx, Peroxiredoxin [Posttranslational modifica 9e-09
PRK13599215 PRK13599, PRK13599, putative peroxiredoxin; Provisional 7e-08
cd02966116 cd02966, TlpA_like_family, TlpA-like family; composed o 2e-07
PTZ00137261 PTZ00137, PTZ00137, 2-Cys peroxiredoxin; Provisional 2e-07
cd02970149 cd02970, PRX_like2, Peroxiredoxin (PRX)-like 2 family; 3e-07
PRK13191215 PRK13191, PRK13191, putative peroxiredoxin; Provisional 3e-07
PRK03147173 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Pro 5e-07
PRK15000200 PRK15000, PRK15000, peroxidase; Provisional 7e-07
cd02969171 cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; 4e-05
PRK10382187 PRK10382, PRK10382, alkyl hydroperoxide reductase subun 3e-04
TIGR03137187 TIGR03137, AhpC, peroxiredoxin 0.002
COG1225157 COG1225, Bcp, Peroxiredoxin [Posttranslational modifica 2e-49
PRK00522167 PRK00522, tpx, lipid hydroperoxide peroxidase; Provisio 2e-06
>gnl|CDD|48566 cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>gnl|CDD|181857 PRK09437, bcp, thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>gnl|CDD|144244 pfam00578, AhpC-TSA, AhpC/TSA family Back     alignment and domain information
>gnl|CDD|48520 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>gnl|CDD|48567 cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>gnl|CDD|48564 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>gnl|CDD|30799 COG0450, AhpC, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36073 KOG0855, KOG0855, KOG0855, Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48565 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>gnl|CDD|140280 PTZ00253, PTZ00253, tryparedoxin peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|36070 KOG0852, KOG0852, KOG0852, Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|149549 pfam08534, Redoxin, Redoxin Back     alignment and domain information
>gnl|CDD|106159 PRK13190, PRK13190, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|183884 PRK13189, PRK13189, peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|48563 cd03014, PRX_Atyp2cys, Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>gnl|CDD|36072 KOG0854, KOG0854, KOG0854, Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32260 COG2077, Tpx, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|106544 PRK13599, PRK13599, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|48515 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>gnl|CDD|173427 PTZ00137, PTZ00137, 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|48519 cd02970, PRX_like2, Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>gnl|CDD|183885 PRK13191, PRK13191, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|179545 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|184962 PRK15000, PRK15000, peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|48518 cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>gnl|CDD|182423 PRK10382, PRK10382, alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>gnl|CDD|163149 TIGR03137, AhpC, peroxiredoxin Back     alignment and domain information
>gnl|CDD|31418 COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179055 PRK00522, tpx, lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 157 bacterioferritin comigratory protein [Candidatus Liberi
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, prot 100.0
PRK09437156 bcp thioredoxin-dependent thiol peroxidase; Reviewed 100.0
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys P 100.0
TIGR03137187 AhpC peroxiredoxin. This gene contains two invariant cy 100.0
PTZ00253199 tryparedoxin peroxidase; Provisional 100.0
PRK13190202 putative peroxiredoxin; Provisional 100.0
PRK13599215 putative peroxiredoxin; Provisional 100.0
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamil 100.0
PRK10382187 alkyl hydroperoxide reductase subunit C; Provisional 100.0
PTZ00137194 2-Cys peroxiredoxin; Provisional 100.0
PRK13189215 peroxiredoxin; Provisional 100.0
PRK13191230 putative peroxiredoxin; Provisional 100.0
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like sub 100.0
COG0450194 AhpC Peroxiredoxin [Posttranslational modification, pro 100.0
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin co 100.0
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys 100.0
PRK00522168 tpx thiol peroxidase; Provisional 100.0
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of the 99.97
PRK03147176 thiol-disulfide oxidoreductase; Provisional 99.97
pfam08534142 Redoxin Redoxin. This family of redoxins includes perox 99.97
pfam00578124 AhpC-TSA AhpC/TSA family. This family contains proteins 99.96
KOG0854224 consensus 99.96
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetic 99.95
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetic 99.95
KOG0852196 consensus 99.94
KOG0855211 consensus 99.94
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known as Cc 99.9
cd02966116 TlpA_like_family TlpA-like family; composed of TlpA, Re 99.89
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfami 99.88
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for 99.88
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfami 99.86
cd02967114 mauD Methylamine utilization (mau) D family; mauD prote 99.83
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, Try 99.79
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, prot 99.78
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; compo 99.74
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c Oxida 99.71
TIGR00385175 dsbE periplasmic protein thiol:disulfide oxidoreductase 99.67
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification, pro 99.59
pfam02630159 SCO1-SenC SCO1/SenC. This family is involved in biogene 99.57
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved in bio 99.52
KOG0541171 consensus 99.43
KOG2792280 consensus 99.42
PTZ00256183 glutathione peroxidase; Provisional 99.41
PTZ00056180 glutathione peroxidase; Provisional 99.4
PRK10606183 btuE putative glutathione peroxidase; Provisional 99.38
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family; tet 99.27
COG0386162 BtuE Glutathione peroxidase [Posttranslational modifica 99.23
TIGR02661189 MauD methylamine dehydrogenase accessory protein MauD; 99.07
KOG1651171 consensus 98.95
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-de 98.86
KOG2501157 consensus 98.62
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7; InterPro: IP 98.49
pfam05988211 DUF899 Bacterial protein of unknown function (DUF899). 98.47
pfam00837237 T4_deiodinase Iodothyronine deiodinase. Iodothyronine d 98.27
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induced st 98.01
KOG4498197 consensus 98.01
pfam09695174 YtfJ_HI0045 Bacterial protein of unknown function (YtfJ 97.96
PRK13703247 conjugal pilus assembly protein TraF; Provisional 97.79
TIGR02740306 TraF-like TraF-like protein; InterPro: IPR014111 This e 97.69
TIGR02738176 TrbB type-F conjugative transfer system pilin assembly 97.48
pfam05176255 ATP-synt_10 ATP10 protein. ATP 10 is essential for the 97.34
PRK13728181 conjugal transfer protein TrbB; Provisional 97.34
KOG0910150 consensus 97.33
COG4312247 Uncharacterized protein conserved in bacteria [Function 97.21
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; 96.95
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, 96.84
cd02958114 UAS UAS family; UAS is a domain of unknown function. Mo 96.2
COG3054184 Predicted transcriptional regulator [General function p 95.14
PRK08132549 hypothetical protein; Provisional 94.74
TIGR02739270 TraF type-F conjugative transfer system pilin assembly 94.51
cd02979167 PHOX_C FAD-dependent Phenol hydoxylase (PHOX) family, C 93.29
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide oxid 92.68
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was origina 98.79
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protein fam 98.26
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reductase ( 98.21
TIGR01068101 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxi 98.11
PRK09381109 trxA thioredoxin; Provisional 98.04
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical protei 98.04
pfam00085104 Thioredoxin Thioredoxin. Thioredoxins are small enzymes 98.03
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, 97.98
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-termin 97.95
PRK10996139 thioredoxin 2; Provisional 97.88
cd0294793 TRX_family TRX family; composed of two groups: Group I, 97.88
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin 97.84
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed of pro 97.74
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion p 97.72
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of prote 97.55
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of euk 97.52
PTZ0005198 thioredoxin; Provisional 97.38
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; 97.28
KOG0907106 consensus 97.25
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 97.2
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryo 97.18
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 97.16
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 97.14
PRK00293577 dipZ thiol:disulfide interchange protein precursor; Pro 97.05
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) family, 96.98
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxi 96.98
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; compos 96.89
TIGR01126107 pdi_dom protein disulfide-isomerase domain; InterPro: I 96.54
PHA0212575 thioredoxin-like protein 96.28
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulum pro 96.23
cd02957113 Phd_like Phosducin (Phd)-like family; composed of Phd a 95.63
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; 94.88
COG4232569 Thiol:disulfide interchange protein [Posttranslational 93.61
pfam00255108 GSHPx Glutathione peroxidase. 98.59
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (AP 96.79
TIGR01130 522 ER_PDI_fam protein disulfide isomerases; InterPro: IPR0 96.46
PTZ00102 479 disulphide isomerase; Provisional 96.41
COG3118 304 Thioredoxin domain-containing protein [Posttranslationa 96.27
cd02960130 AGR Anterior Gradient (AGR) family; members of this fam 96.15
KOG0190 493 consensus 96.11
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QS 95.88
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [Posttr 93.5
KOG0908 288 consensus 92.31
pfam07976169 Phe_hydrox_dim Phenol hydroxylase, C-terminal dimerizat 91.47
cd02962152 TMX2 TMX2 family; composed of proteins similar to human 91.25
TIGR01130522 ER_PDI_fam protein disulfide isomerases; InterPro: IPR0 95.25
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') 94.81
PTZ00102479 disulphide isomerase; Provisional 91.28
pfam01216 350 Calsequestrin Calsequestrin. 90.63
TIGR02187 237 GlrX_arch Glutaredoxin-like domain protein; InterPro: I 93.88
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PRK00522 tpx thiol peroxidase; Provisional Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>pfam08534 Redoxin Redoxin Back     alignment and domain information
>pfam00578 AhpC-TSA AhpC/TSA family Back     alignment and domain information
>KOG0854 consensus Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>KOG0852 consensus Back     alignment and domain information
>KOG0855 consensus Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily; InterPro: IPR004799 Periplasmic protein thiol:disulphide oxidoreductase is involved in the biogenesis of c-type cytochromes as well as in disulphide bond formation in some periplasmic proteins Back     alignment and domain information
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam02630 SCO1-SenC SCO1/SenC Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>KOG0541 consensus Back     alignment and domain information
>KOG2792 consensus Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD; InterPro: IPR013478 MauD appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulphide bonds Back     alignment and domain information
>KOG1651 consensus Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>KOG2501 consensus Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7; InterPro: IPR013376 This model represents one of several families of known and probable glutathione peroxidases Back     alignment and domain information
>pfam05988 DUF899 Bacterial protein of unknown function (DUF899) Back     alignment and domain information
>pfam00837 T4_deiodinase Iodothyronine deiodinase Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>KOG4498 consensus Back     alignment and domain information
>pfam09695 YtfJ_HI0045 Bacterial protein of unknown function (YtfJ_HI0045) Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein; InterPro: IPR014111 This entry contains TraF-like proteins that are related to the F-type conjugation system pilus assembly proteins TraF (IPR014110 from INTERPRO)and TrbB (IPR014109 from INTERPRO) both of which exhibit a thioredoxin fold Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB; InterPro: IPR014109 This entry includes thiol-disulphide isomerase (TrbB), a protein that is involved in conjugative transfer of plasmid DNA, specifically in the F-type system Back     alignment and domain information
>pfam05176 ATP-synt_10 ATP10 protein Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG0910 consensus Back     alignment and domain information
>COG4312 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626; InterPro: IPR006513 These are sequences from gamma proteobacteria that are related to the E Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>COG3054 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>PRK08132 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF; InterPro: IPR014110 This entry includes TraF; a protein that is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically in the F-type system Back     alignment and domain information
>cd02979 PHOX_C FAD-dependent Phenol hydoxylase (PHOX) family, C-terminal TRX-fold domain; composed of proteins similar to PHOX from the aerobic topsoil yeast Trichosporon cutaneum Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxins , , , are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>pfam00085 Thioredoxin Thioredoxin Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>KOG0907 consensus Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain; InterPro: IPR005788 This is a domain of eukaryotic protein disulphide isomerases, generally found in two copies Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>pfam00255 GSHPx Glutathione peroxidase Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>KOG0190 consensus Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>KOG0908 consensus Back     alignment and domain information
>pfam07976 Phe_hydrox_dim Phenol hydroxylase, C-terminal dimerization domain Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>pfam01216 Calsequestrin Calsequestrin Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein; InterPro: IPR011903 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target157 bacterioferritin comigratory protein [Candidatus Liberi
2ywn_A157 Crystal Structure Of Peroxiredoxin-Like Protein Fro 3e-17
3drn_A161 The Crystal Structure Of Bcp1 From Sulfolobus Sulfa 3e-17
2z9s_A199 Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXI 2e-16
1qq2_A199 Crystal Structure Of A Mammalian 2-Cys Peroxiredoxi 3e-16
3hjp_A164 The Crystal Structure Of Bcp4 From Sulfolobus Solfa 5e-16
2rii_A199 Crystal Structure Of Human Peroxiredoxin I In Compl 5e-16
1e2y_A188 Tryparedoxin Peroxidase From Crithidia Fasciculata 6e-16
3hy2_A206 Crystal Structure Of Sulfiredoxin In Complex With P 8e-16
1qmv_A197 Thioredoxin Peroxidase B From Red Blood Cells Lengt 2e-15
2v2g_A233 Crystal Structure Of The C45s Mutant Of The Peroxir 3e-14
1zye_A220 Crystal Strucutre Analysis Of Bovine Mitochondrial 6e-14
3gkk_A163 Insights Into The Alkyl Peroxide Reduction Activity 3e-13
3gkn_A163 Insights Into The Alkyl Peroxide Reduction Activity 5e-13
2cx3_A164 Crystal Structure Of A Bacterioferritin Comigratory 8e-13
3ixr_A179 Crystal Structure Of Xylella Fastidiosa Prxq C47s M 1e-12
3gkm_A163 Insights Into The Alkyl Peroxide Reduction Activity 1e-12
1uul_A202 Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cr 3e-12
2pn8_A211 Crystal Structure Of Human Peroxiredoxin 4 (Thiored 2e-11
1prx_A224 Horf6 A Novel Human Peroxidase Enzyme Length = 224 4e-11
2jsy_A167 Solution Structure Of Tpx In The Oxidized State Len 6e-11
2h01_A192 Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I 2e-10
3a2v_A249 Peroxiredoxin (C207s) From Aeropyrum Pernix K1 Comp 4e-10
2bmx_A195 Mycobacterium Tuberculosis Ahpc Length = 195 5e-10
3a5w_A249 Peroxiredoxin (Wild Type) From Aeropyrum Pernix K1 6e-10
2e2g_A250 Crystal Structure Of Archaeal Peroxiredoxin, Thiore 6e-10
2h1b_A143 Resa E80q Length = 143 7e-10
1st9_A143 Crystal Structure Of A Soluble Domain Of Resa In Th 8e-10
3a2w_A249 Peroxiredoxin (C50s) From Aeropytum Pernix K1 (Pero 8e-10
2zct_A249 Oxidation Of Archaeal Peroxiredoxin Involves A Hype 1e-09
2e2m_A250 Crystal Structure Of Archaeal Peroxiredoxin, Thiore 1e-09
2h1a_A143 Resa C74a Variant Length = 143 1e-09
2h19_A143 Crystal Structure Of Resa Cys77ala Variant Length = 2e-09
3c71_A143 Struture Of A Resa Variant With A Dsba-Like Active 2e-09
1x0r_A249 Thioredoxin Peroxidase From Aeropyrum Pernix K1 Len 2e-09
2h1g_A143 Resa C74aC77A Length = 143 3e-09
1xcc_A220 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 2 3e-09
2h66_A213 The Crystal Structure Of Plasmodium Vivax 2-Cys Per 5e-09
2cv4_A250 Crystal Structure Of An Archaeal Peroxiredoxin From 5e-09
1xxu_A153 Crystal Structure Of Ahpe From Mycrobacterium Tuber 9e-09
1zof_A198 Crystal Structure Of Alkyl Hydroperoxide-Reductase 2e-08
3c73_A140 Structure Of Cehc Variant Resa Length = 140 2e-08
1xvw_A160 Crystal Structure Of Ahpe From Mycobacterium Tuberc 2e-08
2yzh_A171 Crystal Structure Of Peroxiredoxin-Like Protein Fro 5e-08
3hdc_A158 The Crystal Structure Of Thioredoxin Protein From G 6e-08
1xvq_A175 Crystal Structure Of Thiol Peroxidase From Mycobact 2e-07
1y25_A165 Structure Of Mycobacterial Thiol Peroxidase Tpx Len 2e-07
1qxh_A167 Crystal Structure Of Escherichia Coli Thiol Peroxid 2e-07
1psq_A163 Structure Of A Probable Thiol Peroxidase From Strep 2e-07
3kcm_A154 The Crystal Structure Of Thioredoxin Protein From G 2e-07
3hvx_A167 Escherichia Coli Thiol Peroxidase (Tpx) Resolving C 2e-07
3hvv_A167 Escherichia Coli Thiol Peroxidase (Tpx) Peroxidatic 4e-07
2f9s_A151 2nd Crystal Structure Of A Soluble Domain Of Resa I 8e-07
3or5_A165 Crystal Structure Of Thiol:disulfide Interchange Pr 1e-06
3gl3_A152 Crystal Structure Of A Putative Thiol:disulfide Int 1e-06
1we0_A187 Crystal Structure Of Peroxiredoxin (Ahpc) From Amph 2e-06
2c0d_A221 Structure Of The Mitochondrial 2-Cys Peroxiredoxin 2e-06
3emp_A186 Crystal Structure Of The S-Acetanilide Modified For 1e-05
1yep_A186 Structural And Biochemical Analysis Of The Link Bet 1e-05
1yf0_A186 Structural And Biochemical Analysis Of The Link Bet 1e-05
1yex_A186 Structural And Biochemical Analysis Of The Link Bet 1e-05
1yf1_A186 Structural And Biochemical Analysis Of The Link Bet 2e-05
1n8j_A186 Crystal Structure Of Ahpc With Active Site Cysteine 2e-05
2l5o_A153 Solution Structure Of A Putative Thioredoxin From N 1e-04
3kh7_A176 Crystal Structure Of The Periplasmic Soluble Domain 6e-04
2a4v_A159 Crystal Structure Of A Truncated Mutant Of Yeast Nu 6e-04
1xzo_A174 Identification Of A Disulfide Switch In Bssco, A Me 0.001
1on4_A174 Solution Structure Of Soluble Domain Of Sco1 From B 0.002
1q98_A165 Structure Of A Thiol Peroxidase From Haemophilus In 0.004
>gi|159795627|pdb|2YWN|A Chain A, Crystal Structure Of Peroxiredoxin-Like Protein From Sulfolobus Tokodaii Length = 157 Back     alignment and structure
 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 52/155 (33%), Positives = 84/155 (54%), Gaps = 3/155 (1%)

Query: 3   SLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDE 62
            + +G+ AP F LP  + +++ L AL G  +VL FYP   T  CT E   F    A F++
Sbjct: 3   MVEIGELAPDFELPDTELKKVKLSALKGKVVVLAFYPAAFTQVCTKEMCTFRDSMAKFNQ 62

Query: 63  ESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRT 122
            + +++GIS D   S+K F + + L+ T+L+D ++EV+K Y+V  E       Y+   R 
Sbjct: 63  VNAVVLGISVDPPFSNKAFKEHNKLNFTILSDYNREVVKKYNVAWEFPAL-PGYVLAKRA 121

Query: 123 TFLIDEKGIIAQIW--KPVTLKNHAQSVLKMVKSL 155
            F+ID++G +   W     T +     + K+VKSL
Sbjct: 122 VFVIDKEGKVRYKWVSDDPTKEPPYDEIEKVVKSL 156


>gi|226887715|pdb|3DRN|A Chain A, The Crystal Structure Of Bcp1 From Sulfolobus Sulfataricus Length = 161 Back     alignment and structure
>gi|160877873|pdb|2Z9S|A Chain A, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant Length = 199 Back     alignment and structure
>gi|6435547|pdb|1QQ2|A Chain A, Crystal Structure Of A Mammalian 2-Cys Peroxiredoxin, Hbp23. Length = 199 Back     alignment and structure
>gi|296863456|pdb|3HJP|A Chain A, The Crystal Structure Of Bcp4 From Sulfolobus Solfataricus Length = 164 Back     alignment and structure
>gi|164519504|pdb|2RII|A Chain A, Crystal Structure Of Human Peroxiredoxin I In Complex With Sulfiredoxin Length = 199 Back     alignment and structure
>gi|13786919|pdb|1E2Y|A Chain A, Tryparedoxin Peroxidase From Crithidia Fasciculata Length = 188 Back     alignment and structure
>gi|260656338|pdb|3HY2|A Chain A, Crystal Structure Of Sulfiredoxin In Complex With Peroxiredoxin I And Atp:mg2+ Length = 206 Back     alignment and structure
>gi|9955007|pdb|1QMV|A Chain A, Thioredoxin Peroxidase B From Red Blood Cells Length = 197 Back     alignment and structure
>gi|178847275|pdb|2V2G|A Chain A, Crystal Structure Of The C45s Mutant Of The Peroxiredoxin 6 Of Arenicola Marina. Monoclinic Form Length = 233 Back     alignment and structure
>gi|78101145|pdb|1ZYE|A Chain A, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii Length = 220 Back     alignment and structure
>gi|240104460|pdb|3GKK|A Chain A, Insights Into The Alkyl Peroxide Reduction Activity Of Xanthomonas Campestris Bacterioferritin Comigratory Protein From The Trapped IntermediateLIGAND COMPLEX STRUCTURES Length = 163 Back     alignment and structure
>gi|240104462|pdb|3GKN|A Chain A, Insights Into The Alkyl Peroxide Reduction Activity Of Xanthomonas Campestris Bacterioferritin Comigratory Protein From The Trapped IntermediateLIGAND COMPLEX STRUCTURES Length = 163 Back     alignment and structure
>gi|85544451|pdb|2CX3|A Chain A, Crystal Structure Of A Bacterioferritin Comigratory Protein Peroxiredoxin From The Aeropyrum Pernix K1 (Form-1 Crystal) Length = 164 Back     alignment and structure
>gi|291463493|pdb|3IXR|A Chain A, Crystal Structure Of Xylella Fastidiosa Prxq C47s Mutant Length = 179 Back     alignment and structure
>gi|240104461|pdb|3GKM|A Chain A, Insights Into The Alkyl Peroxide Reduction Activity Of Xanthomonas Campestris Bacterioferritin Comigratory Protein From The Trapped IntermediateLIGAND COMPLEX STRUCTURES Length = 163 Back     alignment and structure
>gi|58176947|pdb|1UUL|A Chain A, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In The Reduced State Length = 202 Back     alignment and structure
>gi|149243259|pdb|2PN8|A Chain A, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) Length = 211 Back     alignment and structure
>gi|3318841|pdb|1PRX|A Chain A, Horf6 A Novel Human Peroxidase Enzyme Length = 224 Back     alignment and structure
gi|194368468|pdb|2JSY|A Chain A, Solution Structure Of Tpx In The Oxidized State Length = 167 Back     alignment and structure
>gi|109158138|pdb|2H01|A Chain A, Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I Length = 192 Back     alignment and structure
>gi|262118485|pdb|3A2V|A Chain A, Peroxiredoxin (C207s) From Aeropyrum Pernix K1 Complexed With Hydrogen Peroxide Length = 249 Back     alignment and structure
>gi|67464614|pdb|2BMX|A Chain A, Mycobacterium Tuberculosis Ahpc Length = 195 Back     alignment and structure
>gi|262118518|pdb|3A5W|A Chain A, Peroxiredoxin (Wild Type) From Aeropyrum Pernix K1 (Reduced Form) Length = 249 Back     alignment and structure
>gi|160877634|pdb|2E2G|A Chain A, Crystal Structure Of Archaeal Peroxiredoxin, Thioredoxin Peroxidase From Aeropyrum Pernix K1 (Pre-Oxidation Form) Length = 250 Back     alignment and structure
>gi|116667529|pdb|2H1B|A Chain A, Resa E80q Length = 143 Back     alignment and structure
>gi|49259146|pdb|1ST9|A Chain A, Crystal Structure Of A Soluble Domain Of Resa In The Oxidised Form Length = 143 Back     alignment and structure
>gi|262118495|pdb|3A2W|A Chain A, Peroxiredoxin (C50s) From Aeropytum Pernix K1 (Peroxide- Bound Form) Length = 249 Back     alignment and structure
>gi|189096094|pdb|2ZCT|A Chain A, Oxidation Of Archaeal Peroxiredoxin Involves A Hypervalent Sulfur Intermediate Length = 249 Back     alignment and structure
>gi|160877644|pdb|2E2M|A Chain A, Crystal Structure Of Archaeal Peroxiredoxin, Thioredoxin Peroxidase From Aeropyrum Pernix K1 (Sulfinic Acid Form) Length = 250 Back     alignment and structure
>gi|116667527|pdb|2H1A|A Chain A, Resa C74a Variant Length = 143 Back     alignment and structure
>gi|116667525|pdb|2H19|A Chain A, Crystal Structure Of Resa Cys77ala Variant Length = 143 Back     alignment and structure
>gi|196049759|pdb|3C71|A Chain A, Struture Of A Resa Variant With A Dsba-Like Active Site Motif (Cphc) Length = 143 Back     alignment and structure
>gi|85543926|pdb|1X0R|A Chain A, Thioredoxin Peroxidase From Aeropyrum Pernix K1 Length = 249 Back     alignment and structure
>gi|116667537|pdb|2H1G|A Chain A, Resa C74aC77A Length = 143 Back     alignment and structure
gi|56967056|pdb|1XCC|A Chain A, 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 220 Back     alignment and structure
>gi|110590544|pdb|2H66|A Chain A, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin Length = 213 Back     alignment and structure
>gi|71042806|pdb|2CV4|A Chain A, Crystal Structure Of An Archaeal Peroxiredoxin From The Aerobic Hyperthermophilic Crenarchaeon Aeropyrum Pernix K1 Length = 250 Back     alignment and structure
gi|61680459|pdb|1XXU|A Chain A, Crystal Structure Of Ahpe From Mycrobacterium Tuberculosis, A 1-Cys Peroxiredoxin Length = 153 Back     alignment and structure
>gi|83753829|pdb|1ZOF|A Chain A, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori Length = 198 Back     alignment and structure
>gi|196049760|pdb|3C73|A Chain A, Structure Of Cehc Variant Resa Length = 140 Back     alignment and structure
>gi|61680453|pdb|1XVW|A Chain A, Crystal Structure Of Ahpe From Mycobacterium Tuberculosis, A 1-Cys Peroxiredoxin Length = 160 Back     alignment and structure
>gi|160286238|pdb|2YZH|A Chain A, Crystal Structure Of Peroxiredoxin-Like Protein From Aquifex Aeolicus Length = 171 Back     alignment and structure
>gi|238538011|pdb|3HDC|A Chain A, The Crystal Structure Of Thioredoxin Protein From Geobacter Metallireducens Length = 158 Back     alignment and structure
>gi|60594471|pdb|1XVQ|A Chain A, Crystal Structure Of Thiol Peroxidase From Mycobacterium Tuberculosis Length = 175 Back     alignment and structure
>gi|83753706|pdb|1Y25|A Chain A, Structure Of Mycobacterial Thiol Peroxidase Tpx Length = 165 Back     alignment and structure
>gi|42543455|pdb|1QXH|A Chain A, Crystal Structure Of Escherichia Coli Thiol Peroxidase In The Oxidized State Length = 167 Back     alignment and structure
>gi|33358145|pdb|1PSQ|A Chain A, Structure Of A Probable Thiol Peroxidase From Streptococcus Pneumoniae Length = 163 Back     alignment and structure
>gi|266618826|pdb|3KCM|A Chain A, The Crystal Structure Of Thioredoxin Protein From Geobacter Metallireducens Length = 154 Back     alignment and structure
>gi|261824982|pdb|3HVX|A Chain A, Escherichia Coli Thiol Peroxidase (Tpx) Resolving Cysteine To Serine Mutant (C95s) With An Intermolecular Disulfide Bond Length = 167 Back     alignment and structure
>gi|261824981|pdb|3HVV|A Chain A, Escherichia Coli Thiol Peroxidase (Tpx) Peroxidatic Cysteine To Serine Mutant (C61s) Length = 167 Back     alignment and structure
>gi|99032200|pdb|2F9S|A Chain A, 2nd Crystal Structure Of A Soluble Domain Of Resa In The Oxidised Form Length = 151 Back     alignment and structure
>gi|307568472|pdb|3OR5|A Chain A, Crystal Structure Of Thiol:disulfide Interchange Protein, Thioredoxin Family Protein From Chlorobium Tepidum Tls Length = 165 Back     alignment and structure
>gi|226192753|pdb|3GL3|A Chain A, Crystal Structure Of A Putative Thiol:disulfide Interchange Protein Dsbe From Chlorobium Tepidum Length = 152 Back     alignment and structure
>gi|62738232|pdb|1WE0|A Chain A, Crystal Structure Of Peroxiredoxin (Ahpc) From Amphibacillus Xylanus Length = 187 Back     alignment and structure
>gi|119389031|pdb|2C0D|A Chain A, Structure Of The Mitochondrial 2-Cys Peroxiredoxin From Plasmodium Falciparum Length = 221 Back     alignment and structure
>gi|224510654|pdb|3EMP|A Chain A, Crystal Structure Of The S-Acetanilide Modified Form Of C165s Ahpc Length = 186 Back     alignment and structure
>gi|75765537|pdb|1YEP|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Olgomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>gi|75765547|pdb|1YF0|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>gi|75765542|pdb|1YEX|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>gi|75765552|pdb|1YF1|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>gi|30749577|pdb|1N8J|A Chain A, Crystal Structure Of Ahpc With Active Site Cysteine Mutated To Serine (C46s) Length = 186 Back     alignment and structure
>gi|315113185|pdb|2L5O|A Chain A, Solution Structure Of A Putative Thioredoxin From Neisseria Meningitidis Length = 153 Back     alignment and structure
>gi|293651904|pdb|3KH7|A Chain A, Crystal Structure Of The Periplasmic Soluble Domain Of Reduced Ccmg From Pseudomonas Aeruginosa Length = 176 Back     alignment and structure
>gi|93278640|pdb|2A4V|A Chain A, Crystal Structure Of A Truncated Mutant Of Yeast Nuclear Thiol Peroxidase Length = 159 Back     alignment and structure
>gi|61680480|pdb|1XZO|A Chain A, Identification Of A Disulfide Switch In Bssco, A Member Of The Sco Family Of Cytochrome C Oxidase Assembly Proteins Length = 174 Back     alignment and structure
>gi|39654376|pdb|1ON4|A Chain A, Solution Structure Of Soluble Domain Of Sco1 From Bacillus Subtilis Length = 174 Back     alignment and structure
gi|34809842|pdb|1Q98|A Chain A, Structure Of A Thiol Peroxidase From Haemophilus Influenzae Rd Length = 165 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target157 bacterioferritin comigratory protein [Candidatus Liberi
3ixr_A179 Bacterioferritin comigratory protein; alpha beta protei 5e-39
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, atypica 4e-32
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox regulati 4e-31
1e2y_A188 TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxi 3e-27
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; peroxi 7e-26
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1 2e-25
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural genom 3e-25
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thiored 4e-24
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXRC, PS 2e-23
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hydroge 5e-23
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, subst 6e-23
1hd2_A161 Peroxiredoxin 5 residues 54-214; antioxidant enzyme, th 9e-23
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, oxido 2e-21