254780214

254780214

metal-dependent hydrolase protein

GeneID in NCBI database:8209195Locus tag:CLIBASIA_00495
Protein GI in NCBI database:254780214Protein Accession:YP_003064627.1
Gene range:-(101444, 102259)Protein Length:271aa
Gene description:metal-dependent hydrolase protein
COG prediction:[R] Metal-dependent hydrolases of the beta-lactamase superfamily I
KEGG prediction:metal-dependent hydrolase protein; K06167 PhnP protein
SEED prediction:Metal-dependent hydrolases of the beta-lactamase superfamily I; PhnP protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Beta-lactamase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP
cccEEEEEEEEEccccccccccccccccccccccccccEEEEEEEEcccccccEEEEEEccccHHHHHHHcccHHccEEEEEcccHHHHccHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHHHcccccccccccccEEEcccccccccccccccEEEEEEEcccccccccEEEEccEEEEcccccccHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHcccccEEEEcccEEEEccc
cccEEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccccEEEEEEccccHHHHHHHcccccccEEEEEccccccHcccccHHHHHHcccccccEEccHHHHHHHHHHccHHEccccccccccccccEEEEcccccEEEEcccccEEEEEEEcccccccEEEEEEccEEEEcccccccHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHcccccEEEEEccccccHHHHHHHcccccEEccccEEEEEccc
MKDYYHFTILgcgaslgvpritgdwgacdptnpknrrtrsslkisrvsergsnttvivdtgpdFYMQVLREQVLSIDAvlythphadhihgidglrgyflkqkrpidvyaapdcMKHLFESFRYCFKalddrtyppivnpivienndvpicmksaggvieaipilqqhgrisslgfrfgnvayctdvnafpaeslEKLQNLDFLIIDALKnglhsshfslseslkkielinpknailtHMHVDLDydmvlkstpsrvvpafdgmqfsspip
MKDYYHFTILGCGASLGVPRITGdwgacdptnpknrrtrsslkisrvsergsnttvivdtgpDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRvvpafdgmqfsspip
MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGlhsshfslseslKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP
***YYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP
MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP
*KDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP
MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP
MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target271 metal-dependent hydrolase protein [Candidatus Liberibac
315122343269 metal-dependent hydrolase protein [Candidatus Liberibac 1 1e-127
86357773272 metal-dependent hydrolase protein [Rhizobium etli CFN 4 1 1e-83
116252218272 hypothetical protein RL2471 [Rhizobium leguminosarum bv 1 6e-83
190891832271 probable metal-dependent hydrolase protein [Rhizobium e 1 7e-83
209549394274 beta-lactamase [Rhizobium leguminosarum bv. trifolii WS 1 1e-82
241204711274 beta-lactamase [Rhizobium leguminosarum bv. trifolii WS 1 2e-82
222148594272 metal dependent hydrolase [Agrobacterium vitis S4] Leng 1 9e-82
218463184271 probable metal-dependent hydrolase protein [Rhizobium e 1 6e-81
159184781274 metal dependent hydrolase [Agrobacterium tumefaciens st 1 1e-78
325292847276 metal dependent hydrolase [Agrobacterium sp. H13-3] Len 1 3e-78
>gi|315122343|ref|YP_004062832.1| metal-dependent hydrolase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 269 Back     alignment and organism information
 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/270 (81%), Positives = 242/270 (89%), Gaps = 1/270 (0%)

Query: 1   MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDT 60
           MKD+Y+FTILGC AS GVPRITGDWG CDP NPKNRRTRSSLK+SRVSERG +TTVI+DT
Sbjct: 1   MKDFYYFTILGCSASPGVPRITGDWGLCDPKNPKNRRTRSSLKVSRVSERGGDTTVIIDT 60

Query: 61  GPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFE 120
           GPDFYMQ+LRE+VLSIDAVLYTH HADH+HGIDGLRGYFL+QK PIDVYAAPDCM++L  
Sbjct: 61  GPDFYMQMLREKVLSIDAVLYTHEHADHVHGIDGLRGYFLQQKHPIDVYAAPDCMENLVN 120

Query: 121 SFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGN 180
           SF YCFKA +  +Y PI NP +IE  DVPI +K AGGVIEAIPILQ+HG+ISSLGFRF N
Sbjct: 121 SFGYCFKAPEGSSYLPIANPRIIE-KDVPISVKGAGGVIEAIPILQRHGKISSLGFRFSN 179

Query: 181 VAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHM 240
           VAYCTDVN+FP ESLEKLQNLDFLIIDAL+NGLH SHFSLSESLKKI+LINPKNAILTHM
Sbjct: 180 VAYCTDVNSFPDESLEKLQNLDFLIIDALRNGLHGSHFSLSESLKKIDLINPKNAILTHM 239

Query: 241 HVDLDYDMVLKSTPSRVVPAFDGMQFSSPI 270
           HVDLDYD V +STPSRVVPAFDGM F S I
Sbjct: 240 HVDLDYDKVFRSTPSRVVPAFDGMHFKSLI 269


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357773|ref|YP_469665.1| metal-dependent hydrolase protein [Rhizobium etli CFN 42] Length = 272 Back     alignment and organism information
>gi|116252218|ref|YP_768056.1| hypothetical protein RL2471 [Rhizobium leguminosarum bv. viciae 3841] Length = 272 Back     alignment and organism information
>gi|190891832|ref|YP_001978374.1| probable metal-dependent hydrolase protein [Rhizobium etli CIAT 652] Length = 271 Back     alignment and organism information
>gi|209549394|ref|YP_002281311.1| beta-lactamase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 274 Back     alignment and organism information
>gi|241204711|ref|YP_002975807.1| beta-lactamase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 274 Back     alignment and organism information
>gi|222148594|ref|YP_002549551.1| metal dependent hydrolase [Agrobacterium vitis S4] Length = 272 Back     alignment and organism information
>gi|218463184|ref|ZP_03503275.1| probable metal-dependent hydrolase protein [Rhizobium etli Kim 5] Length = 271 Back     alignment and organism information
>gi|159184781|ref|NP_354500.2| metal dependent hydrolase [Agrobacterium tumefaciens str. C58] Length = 274 Back     alignment and organism information
>gi|325292847|ref|YP_004278711.1| metal dependent hydrolase [Agrobacterium sp. H13-3] Length = 276 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 metal-dependent hydrolase protein [Candidatus Liberibac
PRK02113252 PRK02113, PRK02113, putative hydrolase; Provisional 7e-41
PRK11244250 PRK11244, phnP, carbon-phosphorus lyase complex accesso 6e-13
COG1234292 COG1234, ElaC, Metal-dependent hydrolases of the beta-l 1e-07
COG1235269 COG1235, PhnP, Metal-dependent hydrolases of the beta-l 2e-37
smart00849183 smart00849, Lactamase_B, Metallo-beta-lactamase superfa 4e-10
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase superfam 1e-07
COG0491252 COG0491, GloB, Zn-dependent hydrolases, including glyox 6e-06
COG0595 555 COG0595, COG0595, Predicted hydrolase of the metallo-be 1e-04
TIGR03307238 TIGR03307, PhnP, phosphonate metabolism protein PhnP 3e-09
TIGR03413248 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase 8e-07
COG1237259 COG1237, COG1237, Metal-dependent hydrolases of the bet 2e-05
PRK02126334 PRK02126, PRK02126, ribonuclease Z; Provisional 0.004
TIGR02651299 TIGR02651, RNase_Z, ribonuclease Z 9e-06
>gnl|CDD|179371 PRK02113, PRK02113, putative hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|183052 PRK11244, phnP, carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>gnl|CDD|31427 COG1234, ElaC, Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>gnl|CDD|31428 COG1235, PhnP, Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>gnl|CDD|129082 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|144377 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|30837 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>gnl|CDD|30940 COG0595, COG0595, Predicted hydrolase of the metallo-beta-lactamase superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|163212 TIGR03307, PhnP, phosphonate metabolism protein PhnP Back     alignment and domain information
>gnl|CDD|163252 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|31430 COG1237, COG1237, Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>gnl|CDD|179375 PRK02126, PRK02126, ribonuclease Z; Provisional Back     alignment and domain information
>gnl|CDD|162962 TIGR02651, RNase_Z, ribonuclease Z Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 271 metal-dependent hydrolase protein [Candidatus Liberibac
PRK02113252 putative hydrolase; Provisional 100.0
TIGR03307249 PhnP phosphonate metabolism protein PhnP. This family o 100.0
PRK11244250 phnP carbon-phosphorus lyase complex accessory protein; 100.0
PRK05184302 pyrroloquinoline quinone biosynthesis protein PqqB; Pro 100.0
PRK00055259 ribonuclease Z; Reviewed 100.0
TIGR02651327 RNase_Z ribonuclease Z; InterPro: IPR013471 All tRNA mo 100.0
COG1234292 ElaC Metal-dependent hydrolases of the beta-lactamase s 100.0
COG1235269 PhnP Metal-dependent hydrolases of the beta-lactamase s 100.0
TIGR02108314 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; Inter 100.0
KOG2121746 consensus 99.98
TIGR02649304 true_RNase_BN ribonuclease BN; InterPro: IPR013469 Prot 99.95
PRK00685228 metal-dependent hydrolase; Provisional 99.65
pfam02112323 PDEase_II cAMP phosphodiesterases class-II. 99.49
PRK04286294 hypothetical protein; Provisional 99.35
COG2248304 Predicted hydrolase (metallo-beta-lactamase superfamily 98.89
PRK02126334 ribonuclease Z; Provisional 100.0
TIGR02650277 RNase_Z_T_toga ribonuclease Z, Thermotoga type; InterPr 99.58
COG1237259 Metal-dependent hydrolases of the beta-lactamase superf 99.49
PRK11709355 putative L-ascorbate 6-phosphate lactonase; Provisional 98.56
COG2333293 ComEC Predicted hydrolase (metallo-beta-lactamase super 98.49
KOG1361 481 consensus 98.38
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta-lact 99.67
TIGR03675 630 arCOG00543 arCOG01782 universal archaeal KH-domain/beta 99.67
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase fold i 99.49
COG1782 637 Predicted metal-dependent RNase, consists of a metallo- 99.4
KOG1136 501 consensus 98.96
KOG1137 668 consensus 98.6
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Apart f 99.3
TIGR03413248 GSH_gloB hydroxyacylglutathione hydrolase. Members of t 98.84
PRK10241251 hydroxyacylglutathione hydrolase; Provisional 98.8
KOG1135 764 consensus 98.76
COG0491252 GloB Zn-dependent hydrolases, including glyoxylases [Ge 98.61
COG0426 388 FpaA Uncharacterized flavoproteins [Energy production a 98.22
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; Provi 97.55
PRK11921 395 metallo-beta-lactamase/flavodoxin domain-containing pro 97.45
COG2220258 Predicted Zn-dependent hydrolases of the beta-lactamase 99.11
pfam00753148 Lactamase_B Metallo-beta-lactamase superfamily. 99.1
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary metab 96.62
KOG0814237 consensus 94.46
KOG3592 934 consensus 92.6
TIGR00649 593 MG423 conserved hypothetical protein; InterPro: IPR0046 99.05
PRK11539754 hypothetical protein; Provisional 98.82
COG5212356 PDE1 Low-affinity cAMP phosphodiesterase [Signal transd 98.67
KOG3798343 consensus 96.95
KOG0813265 consensus 97.76
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z; InterPro: IPR013471 All tRNA molecules are synthesised as long precursors with extra sequence at both the 5' and 3' ends, which undergo several processing steps to form the mature tRNA molecule Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; InterPro: IPR011842 This entry describes coenzyme PQQ biosynthesis protein B, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information
>KOG2121 consensus Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN; InterPro: IPR013469 Proteins in this entry include ribonuclease BN of Escherichia coli (strain K-12) and closely related proteins believed to be equivalent in function Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>pfam02112 PDEase_II cAMP phosphodiesterases class-II Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type; InterPro: IPR013470 All tRNA molecules are synthesised as long precursors with extra sequence at both the 5' and 3' ends, which undergo several processing steps to form the mature tRNA molecule Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1361 consensus Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG01782 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>KOG1136 consensus Back     alignment and domain information
>KOG1137 consensus Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>KOG1135 consensus Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>pfam00753 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0814 consensus Back     alignment and domain information
>KOG3592 consensus Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein; InterPro: IPR004613 This is a family of conserved hypothetical proteins, the members of which contain an ATP-binding domain at the N-terminal end of the protein Back     alignment and domain information
>PRK11539 hypothetical protein; Provisional Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3798 consensus Back     alignment and domain information
>KOG0813 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target271 metal-dependent hydrolase protein [Candidatus Liberibac
3md7_A293 Crystal Structure Of A Beta-Lactamase-Like Protein 2e-63
3py6_A274 Crystal Structure Of A Beta-Lactamase-Like Protein 5e-63
3g1p_A258 Crystals Structure Of Phnp From E.Coli K-12 Length 2e-19
3jxp_A321 Crystal Structure Of The Coenzyme Pqq Synthesis Pro 8e-14
1xto_A311 Crystal Structure Of The Coenzyme Pqq Synthesis Pro 2e-12
2cbn_A306 Crystal Structure Of Zipd From Escherichia Coli Len 9e-09
2fk6_A320 Crystal Structure Of Rnase ZTRNA(THR) COMPLEX Lengt 3e-08
1y44_A320 Crystal Structure Of Rnase Z Length = 320 1e-06
1zkp_A268 1.5a Resolution Crystal Structure Of A Metallo Beta 2e-08
1ww1_A280 Crystal Structure Of Trnase Z From Thermotoga Marit 5e-04
>gi|294979848|pdb|3MD7|A Chain A, Crystal Structure Of A Beta-Lactamase-Like Protein Bound To Gmp From Brucella Melitensis Length = 293 Back     alignment and structure
 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 139/269 (51%), Positives = 183/269 (68%), Gaps = 1/269 (0%)

Query: 2   KDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTG 61
           ++   FT+LGCG+S GVPRI GDWG CDP NPKNRR R+SL + R    G+NT V++DTG
Sbjct: 26  RNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTG 85

Query: 62  PDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFES 121
           PDF MQ++   V  +DA +YTHPHADHIHGID LR Y +   R +DVYA       L+++
Sbjct: 86  PDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDT 145

Query: 122 FRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNV 181
           F YCF+     +YPPI++   I   + P  ++ AGG I   P  Q HG I SLGFR G+V
Sbjct: 146 FGYCFETPVGSSYPPILSMHDI-APETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSV 204

Query: 182 AYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMH 241
            YCTDV+AFP +SL+ +++ D LII AL+   H SHFSL E+L+ IE ++PK AILTHMH
Sbjct: 205 VYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMH 264

Query: 242 VDLDYDMVLKSTPSRVVPAFDGMQFSSPI 270
           V LDY+ V++ TP  V P +DG++F   +
Sbjct: 265 VPLDYETVMRETPHHVEPGYDGLRFEVAV 293


>gi|315364798|pdb|3PY6|A Chain A, Crystal Structure Of A Beta-Lactamase-Like Protein From Brucella Melitensis Bound To Gmp Length = 274 Back     alignment and structure
>gi|224510880|pdb|3G1P|A Chain A, Crystals Structure Of Phnp From E.Coli K-12 Length = 258 Back     alignment and structure
>gi|307568135|pdb|3JXP|A Chain A, Crystal Structure Of The Coenzyme Pqq Synthesis Protein (Pqqb) From Pseudomonas Putida Length = 321 Back     alignment and structure
>gi|56967240|pdb|1XTO|A Chain A, Crystal Structure Of The Coenzyme Pqq Synthesis Protein (Pqqb) From Pseudomonas Putida, Northeast Structural Genomics Target Ppr6 Length = 311 Back     alignment and structure
>gi|90109091|pdb|2CBN|A Chain A, Crystal Structure Of Zipd From Escherichia Coli Length = 306 Back     alignment and structure
>gi|93279549|pdb|2FK6|A Chain A, Crystal Structure Of Rnase ZTRNA(THR) COMPLEX Length = 320 Back     alignment and structure
>gi|60594108|pdb|1Y44|A Chain A, Crystal Structure Of Rnase Z Length = 320 Back     alignment and structure
>gi|71042373|pdb|1ZKP|A Chain A, 1.5a Resolution Crystal Structure Of A Metallo Beta Lactamase Family Protein, The Elac Homolgue Of Bacillus Anthracis, A Putative Ribonuclease Length = 268 Back     alignment and structure
gi|61680268|pdb|1WW1|A Chain A, Crystal Structure Of Trnase Z From Thermotoga Maritima Length = 280 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 metal-dependent hydrolase protein [Candidatus Liberibac
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural geno 5e-58
3jxp_A321 Coenzyme PQQ synthesis protein B; alpha-beta protein, P 2e-38
1xto_A311 Coenzyme PQQ synthesis protein B; alpha-beta protein, n 4e-29
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosphonate 5e-29
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, stru 2e-13
1y44_A320 Ribonuclease Z; zinc-dependent metal hydrolase; HET: ME 1e-12
2cbn_A306 Ribonuclease Z; phosphodiesterase beta lactamase tRNAse 8e-08
2wyl_A360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59 3e-06
3h3e_A267 Uncharacterized protein TM1679; structural genomics, su 1e-29
2p4z_A284 Metal-dependent hydrolases of the beta-lactamase superf 4e-14
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ choline 9e-08
3bv6_A379 Metal-dependent hydrolase; metallo protein, beta-lactam 1e-04
3kl7_A235 Putative metal-dependent hydrolase; structural genomics 2e-04
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductase; HE 6e-04
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiot 0.002
2e7y_A280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, struc 1e-06
2zdf_A 431 Metallo-beta-lactamase superfamily protein; metallo bet 1e-05
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salm 1e-05
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alph 5e-05
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactamase in 2e-04
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 kDa 2e-04
2az4_A 429 Hypothetical protein EF2904; structural genomics, PSI, 6e-04
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fol 7e-04
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A {Pseud 0.001
3adr_A261 Putative uncharacterized protein ST1585; quorum sensing 3e-06
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alpha-hel 2e-04
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclease, e 3e-04
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, metal 4e-04
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase, PRE 8e-04
3af5_A 651 Putative uncharacterized protein PH1404; archaeal CPSF, 0.004
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1 8e-06
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DII 9e-06
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactamase li 2e-05
2vw8_A303 PA1000, PQSE; quinolone signal response protein, signal 2e-05
2whg_A230 VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BET 3e-05
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hydrolas 3e-05
1ko3_A230 VIM-2 metallo-beta-lactamase; alpha-beta/BETA-alpha fol 7e-05
1vme_A 410 Flavoprotein; TM0755, structural genomics, JCSG, protei 1e-04
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like domain, f 2e-04
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotics res 3e-04
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 subun 0.002
1ztc_A221 Hypothetical protein TM0894; structural genomics, PSI, 0.004
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, seattle structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} Length = 293 Back     alignment and structure
 Score =  219 bits (559), Expect = 5e-58
 Identities = 139/267 (52%), Positives = 181/267 (67%), Gaps = 5/267 (1%)

Query: 1   MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDT 60
           ++    FT+LGCG+S GVPRI GDWG CDP NPKNRR R+SL + R    G+NT V++DT
Sbjct: 29  LR----FTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDT 84

Query: 61  GPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFE 120
           GPDF MQ++   V  +DA +YTHPHADHIHGID LR Y +   R +DVYA       L++
Sbjct: 85  GPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYD 144

Query: 121 SFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGN 180
           +F YCF+     +YPPI++   I     P  ++ AGG I   P  Q HG I SLGFR G+
Sbjct: 145 TFGYCFETPVGSSYPPILSMHDIAPET-PFSIEGAGGAIRFEPFSQVHGDIESLGFRIGS 203

Query: 181 VAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHM 240
           V YCTDV+AFP +SL+ +++ D LII AL+   H SHFSL E+L+ IE ++PK AILTHM
Sbjct: 204 VVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHM 263

Query: 241 HVDLDYDMVLKSTPSRVVPAFDGMQFS 267
           HV LDY+ V++ TP  V P +DG++F 
Sbjct: 264 HVPLDYETVMRETPHHVEPGYDGLRFE 290


>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida KT2440} PDB: 1xto_A Length = 321 Back     alignment and structure
>1xto_A Coenzyme PQQ synthesis protein B; alpha-beta protein, northeast structural genomics consortium, NESG, protein structure initiative; 2.80A {Pseudomonas putida KT2440} SCOP: d.157.1.6 Length = 311 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} Length = 258 Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein structure initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Length = 268 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Length = 320 Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Length = 306 Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Length = 360 Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Length = 267 Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; 2.10A {Thermoanaerobacter tengcongensis MB4} Length = 284 Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline binding protein; PCE, hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Length = 547 Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural genomics, PSI-2; 1.80A {Vibrio cholerae o1 biovar eltor str} Length = 379 Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, joint center for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Length = 235 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistance, structure, hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Length = 246 Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Length = 280 Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Length = 210 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER assymmetric UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Length = 228 Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Length = 459 Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Enterococcus faecalis V583} SCOP: d.157.1.10 Length = 429 Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Length = 223 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Length = 331 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Length = 261 Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrolase; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Length = 311 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus HB27} PDB: 3bk1_A* Length = 562 Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding, periplasm,; HET: SDF; 1.41A {Aeromonas hydrophila} PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Length = 227 Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Length = 658 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Length = 303 Back     alignment and structure
>2whg_A VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BETA-alpha fold; HET: FLC; 1.90A {Pseudomonas aeruginosa} PDB: 2wrs_A* 1ko3_A 1ko2_A Length = 230 Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GTT GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Length = 260 Back     alignment and structure
>1ko3_A VIM-2 metallo-beta-lactamase; alpha-beta/BETA-alpha fold, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1ko2_A Length = 230 Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Length = 410 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidoreductase; HET: FMN; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Length = 219 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Length = 640 Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Length = 221 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target271 metal-dependent hydrolase protein [Candidatus Liberibac
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural geno 100.0
3jxp_A321 Coenzyme PQQ synthesis protein B; alpha-beta protein, P 100.0
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosphonate 100.0
2cbn_A306 Ribonuclease Z; phosphodiesterase beta lactamase tRNAse 100.0
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, stru 100.0
1y44_A320 Ribonuclease Z; zinc-dependent metal hydrolase; HET: ME 100.0
3h3e_A267 Uncharacterized protein TM1679; structural genomics, su 99.96
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclease, e 99.79
2e7y_A280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, struc 99.96
2p4z_A284 Metal-dependent hydrolases of the beta-lactamase superf 99.81
3kl7_A235 Putative metal-dependent hydrolase; structural genomics 99.74
2az4_A 429 Hypothetical protein EF2904; structural genomics, PSI, 99.84
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase superf 99.51
3adr_A261 Putative uncharacterized protein ST1585; quorum sensing 99.48
2wyl_A360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59 99.78
3bv6_A379 Metal-dependent hydrolase; metallo protein, beta-lactam 99.77
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein stru 98.64
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 kDa 99.77
3af5_A 651 Putative uncharacterized protein PH1404; archaeal CPSF, 99.68
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 subun 99.67
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase, PRE 99.55
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ choline 99.47
1ztc_A221 Hypothetical protein TM0894; structural genomics, PSI, 99.42
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetallohydr 98.75
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, antibi 99.15
2gmn_A274 Metallo-beta-lactamase; hydrolase; 1.40A {Bradyrhizobiu 99.03
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A {Pseud 98.93
3esh_A280 Protein similar to metal-dependent hydrolase; structura 98.92
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alph 98.91
2zo4_A317 Metallo-beta-lactamase family protein; hydrolase; 2.10A 98.88
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DII 98.82
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like domain, f 98.78
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductase; HE 98.78
2vw8_A303 PA1000, PQSE; quinolone signal response protein, signal 98.74
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acy 98.7
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotics res 98.62
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrolase; 98.6
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase), zin 98.57
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, metal 98.57
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alpha-hel 98.54
2yz3_A266 Metallo-beta-lactamase; enzyme-inhibitor complex, hydro 98.53
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hydrolas 98.5
2whg_A230 VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BET 98.5
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fol 98.44
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactamase in 98.39
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1 98.33
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiot 98.19
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolas 98.06
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salm 98.92
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactamase li 98.86
1vme_A 410 Flavoprotein; TM0755, structural genomics, JCSG, protei 98.84
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- lactamase 98.55
1xm8_A254 Glyoxalase II; structural genomics, protein structure i 98.54
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethylmalon 98.48
2p97_A201 Hypothetical protein; putative metal-dependent hydrolas 97.53
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, seattle structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} Back     alignment and structure
Probab=100.00  E-value=0  Score=386.55  Aligned_cols=268  Identities=51%  Similarity=0.935  Sum_probs=215.4

Q ss_pred             CCEEEEEEEEECCCCCEECCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEECCCCHHHHHHHCCCCCCCEEEE
Q ss_conf             87259999854178965133788787777876774443069999336778971899987984156675223342059999
Q gi|254780214|r    2 KDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLY   81 (271)
Q Consensus         2 ~~~m~l~~LGtg~s~g~P~~~c~c~~C~~~~~~~~R~~~s~~i~~~~~~~~~~~iLiD~G~d~r~ql~~~~i~~Id~I~i   81 (271)
                      .+.|||||||||+|+|+|+++|+|++|++++++|+|+|+|++|+.....+++.+||||||+|+|.|+++.++++||+|||
T Consensus        26 ~~~Mkit~LGTG~~~g~P~~~c~c~~C~~a~~~~~R~~~S~li~~~~~~~~~~~iLiD~G~~~~~~~~~~~~~~id~I~l  105 (293)
T 3md7_A           26 RNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVY  105 (293)
T ss_dssp             CSEEEEEEEECBCTTCBSCTTCCCTTSCTTCGGGCBCBCEEEEEEECTTCCEEEEEECCCTTHHHHHHHHTCCCCSEEEC
T ss_pred             CCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEECCCCHHHHHHHCCCCCCCEEEE
T ss_conf             78039999987689870569999874765578886633479998546789975899968813799986423456778998


Q ss_pred             ECCCHHHHHHCCHHHHHHHCCCCEEEEEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCEEE
Q ss_conf             74352422011102433317821110131120232100222210136677531001232112344333420115874899
Q gi|254780214|r   82 THPHADHIHGIDGLRGYFLKQKRPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEA  161 (271)
Q Consensus        82 TH~H~DHi~Gl~~Lr~~~~~~~~~i~vy~~~~~~~~l~~~~~y~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i  161 (271)
                      ||+|+||+.||+.|+...+....+++++++..........+.+................. ................+.+
T Consensus       106 TH~H~DH~~GL~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~  184 (293)
T 3md7_A          106 THPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMH-DIAPETPFSIEGAGGAIRF  184 (293)
T ss_dssp             SCCCHHHHTTGGGGHHHHHHHTSCEEEEECHHHHHHHHHHCGGGTSCCTTCCCCCCEEEE-ECCTTCCEEECCTTCCEEE
T ss_pred             ECCCCCCCCCHHHHHHHHHCCCCCCCEEEEECCHHHHHCCCCHHCCCCCCCCCCCCHHCC-CCCCCCCCEEECCCCEEEE
T ss_conf             446644455754544455404555313410011012202430011455433346410000-0246653101024651788


Q ss_pred             EEEEEECCCEECCCCCCCCEEEECCCCCCHHHHHHHHCCHHEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             99995077621123346862530323300167888622211025302335768875799999999997299779997688
Q gi|254780214|r  162 IPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSESLKKIELINPKNAILTHMH  241 (271)
Q Consensus       162 ~~~~~~Hg~~~~~Gyri~~~~Y~~Dt~~~~e~~~~~l~~~D~lI~d~l~~~~~~~H~~~~ea~~~~~~~~~k~~~LtHls  241 (271)
                      .++.+.++...+..+.....+|..+.....+.....+.+++++..+.+....+++|+|++||++++++++|||++|||||
T Consensus       185 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~H~t~~ea~~l~~~~~~k~liLtHis  264 (293)
T 3md7_A          185 EPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMH  264 (293)
T ss_dssp             EEEEEEETTEEEEEEEETTEEEECSCSBCCGGGHHHHTTCSEEEEECCCSSCBTTBCCHHHHHHHHHHHCCSEEEEESBC
T ss_pred             EEEEECCCCCEEEEEECCCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCC
T ss_conf             76876247730444410211204753111102455543210011002367998998999999999997598989998999


Q ss_pred             CCCCHHHHHHHCCCCCEEEEECCEEEEEC
Q ss_conf             89888899986799819902044899626
Q gi|254780214|r  242 VDLDYDMVLKSTPSRVVPAFDGMQFSSPI  270 (271)
Q Consensus       242 ~~~~~~~~~~~~~~~v~~A~DGm~i~l~~  270 (271)
                      |+++++++.++++++|++|||||+|+|++
T Consensus       265 ~~~~~~~~~~~l~~~v~~A~DGM~i~l~~  293 (293)
T 3md7_A          265 VPLDYETVMRETPHHVEPGYDGLRFEVAV  293 (293)
T ss_dssp             TTCCHHHHHHHSCTTEEECCTTCEEEECC
T ss_pred             CCCCHHHHHHHCCCCEEEEECCEEEEEEC
T ss_conf             98799999965789819957895999879



>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida KT2440} PDB: 1xto_A Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein structure initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus HB27} PDB: 3bk1_A* Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; 2.10A {Thermoanaerobacter tengcongensis MB4} Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, joint center for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Enterococcus faecalis V583} SCOP: d.157.1.10 Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; structural genomics, JCSG, PSI, protein structure initiative; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural genomics, PSI-2; 1.80A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>3hnn_A Putative diflavin flavoprotein A 5; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, NSR435A, DFA5; 1.80A {Nostoc SP} Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline binding protein; PCE, hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching, alternative binding site, product complex; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovarkurstaki} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>2gmn_A Metallo-beta-lactamase; hydrolase; 1.40A {Bradyrhizobium japonicum usda 110} SCOP: d.157.1.1 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER assymmetric UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus HB8} Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidoreductase; HET: FMN; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center, quorum quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding, periplasm,; HET: SDF; 1.41A {Aeromonas hydrophila} PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrolase; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>2yz3_A Metallo-beta-lactamase; enzyme-inhibitor complex, hydrolase; HET: M5P; 2.30A {Pseudomonas putida} SCOP: d.157.1.1 Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GTT GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>2whg_A VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BETA-alpha fold; HET: FLC; 1.90A {Pseudomonas aeruginosa} PDB: 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistance, structure, hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 2bfz_A 2bg6_A 2bga_A ... Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- lactamase superfamily; 1.45A {Salmonella typhimurium LT2} SCOP: d.157.1.2 Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 271 metal-dependent hydrolase protein [Candidatus Liberibac
d1xtoa_304 d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB { 2e-28
d1zkpa1244 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS101 1e-14
d1y44a1307 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus 1e-12
d2cbna1305 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherich 4e-09
d2e7ya1280 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotog 8e-08
d1vmea2250 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-ter 3e-05
d1wraa1305 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine es 4e-04
d2az4a1183 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Ente 6e-07
d1ztca1207 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Therm 3e-06
d2cfua2 505 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas 7e-06
d2i7xa1 514 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two prot 1e-04
d2i7ta1 451 d.157.1.10 (A:9-459) Cleavage and polyadenylation speci 2e-04
d1qh5a_260 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hy 3e-04
d1p9ea_294 d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas 4e-04
d2q0ia1298 d.157.1.14 (A:1-298) Quinolone signal response protein 0.003
d2dkfa1 431 d.157.1.10 (A:1-431) Putative RNA-degradation protein T 1e-05
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Length = 304 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Coenzyme PQQ synthesis protein B, PqqB
domain: Coenzyme PQQ synthesis protein B, PqqB
species: Pseudomonas putida [TaxId: 303]
 Score =  119 bits (299), Expect = 2e-28
 Identities = 47/313 (15%), Positives = 84/313 (26%), Gaps = 67/313 (21%)

Query: 8   TILGCGASLGVPRITGDWGAC----DPTNPKNRRTRSSLKISRVSERGSNTTVIVDTGPD 63
            +LG  A  G P+   +   C    D T     RT+SS+ +           ++ +  PD
Sbjct: 4   QVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIAL----SDDGVHWILCNASPD 59

Query: 64  FYMQVL---------REQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKRPIDVYAAPDC 114
              Q+            +   I+A++      DH  G+  LR     +  P  V+     
Sbjct: 60  IRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLR-----EGCPHQVWCTDMV 114

Query: 115 MKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIPILQQHGRISSL 174
            + L   F      L         N I +E + V      A   ++  P   +       
Sbjct: 115 HQDLTTGFPLFNM-LSHWNGGLQWNRIELEGSFVI----DACPNLKFTPFPLRSAAPPYS 169

Query: 175 GFRFGNVAYCTDVNAFPAES-----------------------------LEKLQNLDFLI 205
             RF                                             ++     D  +
Sbjct: 170 PHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEM 229

Query: 206 IDA------LKNGLHSSHFSLSESLKKIELINPKNAILTHM-----HVDLDYDMVLKSTP 254
                     +   H +       L+ ++    +  +L H+      +D +     +   
Sbjct: 230 QRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLR 289

Query: 255 SRVVPAFDGMQFS 267
             V  AFDGM   
Sbjct: 290 RGVEVAFDGMSIE 302


>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Length = 244 Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Length = 307 Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Length = 280 Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 250 Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 305 Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Length = 183 Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Length = 207 Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 505 Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 514 Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 451 Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 260 Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Length = 294 Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Length = 298 Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Length = 431 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graph