254780215

254780215

hypothetical protein CLIBASIA_00500

GeneID in NCBI database:8209196Locus tag:CLIBASIA_00500
Protein GI in NCBI database:254780215Protein Accession:YP_003064628.1
Gene range:-(102259, 103047)Protein Length:262aa
Gene description:hypothetical protein
COG prediction:[L] Mg-dependent DNase
KEGG prediction:hypothetical protein; K03424 TatD DNase family protein [EC:3.1.21.-]
SEED prediction:Putative deoxyribonuclease YcfH
Pathway involved in KEGG:not defined
Subsystem involved in SEED:YcfH
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV
cEEEEccccccHHHHccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHcccEEEEcccccccccHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcc
cccccccccccHHHHccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHccccEEEEEcccHHHHHHccccHHHHHHHHcccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcccccccccEEccccccHHHHHHHHHHcEEEEEcHHHHccccHHHHHHHHHHcHHHEEEcccEcccccHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccc
mlidthchlllpdfdedrHDVIMRAHQANVLKMIAIAIKVkdfvpliklcqdypssifcsvgthpchaheenEVLVDELVCLAshprvvaigetgldryhnahtiEEQKVVFLRHIEASritgiplvihsrsadDDMAAILQEEmkkgpfpfvihcfsSSQKLADICLELGgyisftgmitfpkYDALRAIArgipmdrvlvetdspyivpvscqgkrnepaYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIvpvscqgkrnepaYVVNTAKALAKEKDVSYEDLMEETTKNALklfskisecvv
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECV*
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV
MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target262 hypothetical protein CLIBASIA_00500 [Candidatus Liberib
315122342262 hypothetical protein CKC_02970 [Candidatus Liberibacter 1 1e-131
163760145260 hypothetical protein HPDFL43_07784 [Hoeflea phototrophi 1 2e-80
159184782260 hypothetical protein Atu1495 [Agrobacterium tumefaciens 1 7e-80
325292848260 deoxyribonuclease [Agrobacterium sp. H13-3] Length = 26 1 9e-80
15965353259 hypothetical protein SMc01193 [Sinorhizobium meliloti 1 1 2e-79
209549395260 hydrolase, TatD family [Rhizobium leguminosarum bv. tri 1 1e-78
150396507259 TatD family hydrolase [Sinorhizobium medicae WSM419] Le 1 1e-78
218463183260 hydrolase, TatD family protein [Rhizobium etli Kim 5] L 1 4e-78
241204712260 hydrolase, TatD family [Rhizobium leguminosarum bv. tri 1 5e-77
227822151259 deoxyribonuclease [Sinorhizobium fredii NGR234] Length 1 7e-77
>gi|315122342|ref|YP_004062831.1| hypothetical protein CKC_02970 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Back     alignment and organism information
 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 221/261 (84%), Positives = 244/261 (93%)

Query: 1   MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCS 60
           MLIDTHCHL LPDFD DRHDVIMR+H+A VLKMIAIAIKVKDFVPLI LCQDYPSS+FCS
Sbjct: 1   MLIDTHCHLALPDFDGDRHDVIMRSHKAGVLKMIAIAIKVKDFVPLITLCQDYPSSVFCS 60

Query: 61  VGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASR 120
           +GTHPCHAHEE EVLVDELVCLASHPRVVAIGETGLDRYHNA TIE+QK VFLRHIEA+R
Sbjct: 61  IGTHPCHAHEELEVLVDELVCLASHPRVVAIGETGLDRYHNADTIEDQKTVFLRHIEAAR 120

Query: 121 ITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMI 180
           ITGIPLVIHSRSAD+DM A+LQE++KKGPF FVIHCFSSSQKLADICLELGGYISF+GMI
Sbjct: 121 ITGIPLVIHSRSADEDMIALLQEQIKKGPFSFVIHCFSSSQKLADICLELGGYISFSGMI 180

Query: 181 TFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYE 240
           TFPKYD LR IA+ IPMDR+LVETDSPYIVPV C G+RNEP+YVVNTAK LA+EK +SYE
Sbjct: 181 TFPKYDGLRVIAQSIPMDRLLVETDSPYIVPVPCSGRRNEPSYVVNTAKVLAREKGISYE 240

Query: 241 DLMEETTKNALKLFSKISECV 261
           +LME+TT+NA +LFSK+S+CV
Sbjct: 241 ELMEKTTENAFRLFSKMSKCV 261


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163760145|ref|ZP_02167228.1| hypothetical protein HPDFL43_07784 [Hoeflea phototrophica DFL-43] Length = 260 Back     alignment and organism information
>gi|159184782|ref|NP_354501.2| hypothetical protein Atu1495 [Agrobacterium tumefaciens str. C58] Length = 260 Back     alignment and organism information
>gi|325292848|ref|YP_004278712.1| deoxyribonuclease [Agrobacterium sp. H13-3] Length = 260 Back     alignment and organism information
>gi|15965353|ref|NP_385706.1| hypothetical protein SMc01193 [Sinorhizobium meliloti 1021] Length = 259 Back     alignment and organism information
>gi|209549395|ref|YP_002281312.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 260 Back     alignment and organism information
>gi|150396507|ref|YP_001326974.1| TatD family hydrolase [Sinorhizobium medicae WSM419] Length = 259 Back     alignment and organism information
>gi|218463183|ref|ZP_03503274.1| hydrolase, TatD family protein [Rhizobium etli Kim 5] Length = 260 Back     alignment and organism information
>gi|241204712|ref|YP_002975808.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 260 Back     alignment and organism information
>gi|227822151|ref|YP_002826122.1| deoxyribonuclease [Sinorhizobium fredii NGR234] Length = 259 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target262 hypothetical protein CLIBASIA_00500 [Candidatus Liberib
COG0084256 COG0084, TatD, Mg-dependent DNase [DNA replication, rec 1e-71
pfam01026255 pfam01026, TatD_DNase, TatD related DNase 9e-70
TIGR00010252 TIGR00010, TIGR00010, hydrolase, TatD family 1e-67
PRK10812265 PRK10812, PRK10812, putative DNAse; Provisional 2e-51
KOG3020296 KOG3020, KOG3020, KOG3020, TatD-related DNase [Replicat 2e-43
PRK10425258 PRK10425, PRK10425, DNase TatD; Provisional 2e-33
PRK11449258 PRK11449, PRK11449, putative deoxyribonuclease YjjV; Pr 6e-29
COG1099254 COG1099, COG1099, Predicted metal-dependent hydrolases 1e-09
cd01310251 cd01310, TatD_DNAse, TatD like proteins; E 2e-72
cd01292275 cd01292, metallo-dependent_hydrolases, Superfamily of m 2e-04
>gnl|CDD|30433 COG0084, TatD, Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144567 pfam01026, TatD_DNase, TatD related DNase Back     alignment and domain information
>gnl|CDD|161662 TIGR00010, TIGR00010, hydrolase, TatD family Back     alignment and domain information
>gnl|CDD|182752 PRK10812, PRK10812, putative DNAse; Provisional Back     alignment and domain information
>gnl|CDD|38230 KOG3020, KOG3020, KOG3020, TatD-related DNase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|182449 PRK10425, PRK10425, DNase TatD; Provisional Back     alignment and domain information
>gnl|CDD|171118 PRK11449, PRK11449, putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>gnl|CDD|31296 COG1099, COG1099, Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|30053 cd01310, TatD_DNAse, TatD like proteins; E Back     alignment and domain information
>gnl|CDD|30035 cd01292, metallo-dependent_hydrolases, Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 262 hypothetical protein CLIBASIA_00500 [Candidatus Liberib
TIGR00010269 TIGR00010 hydrolase, TatD family; InterPro: IPR015991 E 100.0
PRK10812265 putative metallodependent hydrolase; Provisional 100.0
PRK10425258 DNase TatD; Provisional 100.0
cd01310251 TatD_DNAse TatD like proteins; E.coli TatD is a cytopla 100.0
PRK11449258 putative deoxyribonuclease YjjV; Provisional 100.0
COG0084256 TatD Mg-dependent DNase [DNA replication, recombination 100.0
pfam01026255 TatD_DNase TatD related DNase. This family of proteins 100.0
KOG3020296 consensus 100.0
COG1099254 Predicted metal-dependent hydrolases with the TIM-barre 100.0
COG1831285 Predicted metal-dependent hydrolase (urease superfamily 99.68
pfam04909270 Amidohydro_2 Amidohydrolase. These proteins are amidohy 99.17
PRK09875292 putative hydrolase; Provisional 99.01
cd00530293 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis o 98.99
pfam02126308 PTE Phosphotriesterase family. 98.99
cd01292275 metallo-dependent_hydrolases Superfamily of metallo-dep 98.95
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates adeni 98.74
COG2159293 Predicted metal-dependent hydrolase of the TIM-barrel f 98.58
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. Membe 98.53
PRK12394387 putative metallo-dependent hydrolase; Provisional 98.53
COG3618279 Predicted metal-dependent hydrolase of the TIM-barrel f 98.51
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOas 98.41
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, includin 98.4
PRK07369419 dihydroorotase; Provisional 98.34
COG3964386 Predicted amidohydrolase [General function prediction o 98.34
PRK02382440 dihydroorotase; Provisional 98.26
PRK10657384 isoaspartyl dipeptidase; Provisional 98.24
PRK09357425 pyrC dihydroorotase; Validated 98.2
PRK07575439 dihydroorotase; Provisional 98.13
PRK08393419 N-ethylammeline chlorohydrolase; Provisional 98.12
PRK11170381 nagA N-acetylglucosamine-6-phosphate deacetylase; Provi 98.12
COG1735316 Php Predicted metal-dependent hydrolase with the TIM-ba 98.1
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgr 98.05
PRK10027 588 cryptic adenine deaminase; Provisional 98.04
PRK09059429 dihydroorotase; Validated 97.94
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the reversible 97.9
PRK09237384 dihydroorotase; Provisional 97.88
PRK08418407 chlorohydrolase; Provisional 97.85
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and metabo 97.84
PRK08044449 allantoinase; Provisional 97.75
cd01293398 Bact_CD Bacterial cytosine deaminase and related metal- 97.67
PRK07627425 dihydroorotase; Provisional 97.65
PRK06886328 hypothetical protein; Validated 97.65
PRK01211413 dihydroorotase; Provisional 97.62
COG0402421 SsnA Cytosine deaminase and related metal-dependent hyd 97.5
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deaminase is 97.44
PRK09230426 cytosine deaminase; Provisional 97.38
PRK05451345 dihydroorotase; Provisional 97.35
PRK06846410 deaminase; Validated 97.33
PRK09060444 dihydroorotase; Validated 97.26
PRK06151480 N-ethylammeline chlorohydrolase; Provisional 97.15
PRK07583437 cytosine deaminase; Validated 97.01
cd01316344 CAD_DHOase The eukaryotic CAD protein is a trifunctiona 96.96
TIGR00857459 pyrC_multi dihydroorotase, multifunctional complex type 96.57
PRK04250408 dihydroorotase; Provisional 96.56
COG4464254 CapC Capsular polysaccharide biosynthesis protein [Carb 96.27
COG1820380 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbo 96.26
TIGR03179427 gua_deam guanine deaminase. This enzyme converts guanin 96.18
PRK07572425 cytosine deaminase; Validated 95.62
COG1574535 Predicted metal-dependent hydrolase with the TIM-barrel 95.41
cd01311263 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydr 95.12
PRK00369393 pyrC dihydroorotase; Provisional 94.07
KOG3968439 consensus 91.4
PRK06189433 allantoinase; Provisional 98.11
PRK09236444 dihydroorotase; Reviewed 97.12
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydroly 96.75
PRK00912237 ribonuclease P protein component 3; Provisional 95.39
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolases. Yt 98.04
PRK08203456 hydroxydechloroatrazine ethylaminohydrolase; Reviewed 98.02
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgr 97.91
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the a 97.91
PRK06038432 N-ethylammeline chlorohydrolase; Provisional 97.87
PRK09356401 imidazolonepropionase; Validated 97.84
PRK06380418 metal-dependent hydrolase; Provisional 97.78
PRK07228445 N-ethylammeline chlorohydrolase; Provisional 97.75
PRK08204451 hypothetical protein; Provisional 97.74
PRK09045444 N-ethylammeline chlorohydrolase; Provisional 97.68
PRK07213378 chlorohydrolase; Provisional 97.59
PRK12393459 amidohydrolase; Provisional 97.58
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-pro 97.56
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOas 97.52
PRK06687422 chlorohydrolase; Validated 97.39
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, 96.95
PRK07203442 putative chlorohydrolase/aminohydrolase; Validated 96.53
PRK09228429 guanine deaminase; Provisional 96.35
TIGR03314441 Se_ssnA putative selenium metabolism protein SsnA. Memb 96.22
pfam01979307 Amidohydro_1 Amidohydrolase family. This family of enzy 95.88
PRK09229457 N-formimino-L-glutamate deiminase; Validated 95.74
pfam01244316 Peptidase_M19 Membrane dipeptidase (Peptidase family M1 95.06
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgr 94.95
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgr 94.72
COG1228406 HutI Imidazolonepropionase and related amidohydrolases 94.64
COG2355313 Zn-dependent dipeptidase, microsomal dipeptidase homolo 94.43
PTZ00124362 adenosine deaminase; Provisional 94.19
PRK05985398 cytosine deaminase; Provisional 92.76
pfam07969392 Amidohydro_3 Amidohydrolase family. 91.74
cd01301309 rDP_like renal dipeptidase (rDP), best studied in mamma 90.36
PRK13404476 dihydropyrimidinase; Provisional 97.97
PRK08323463 dihydropyrimidinase; Validated 97.79
cd01315447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (AL 97.57
PRK08417387 dihydroorotase; Provisional 97.54
TIGR03178442 allantoinase allantoinase. This enzyme carries out the 97.52
PRK09061496 D-glutamate deacylase; Validated 91.94
cd01314 447 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimi 97.88
PRK07328268 histidinol-phosphatase; Provisional 97.39
COG0044 430 PyrC Dihydroorotase and related cyclic amidohydrolases 96.61
PRK05588256 histidinol-phosphatase; Provisional 95.72
PRK13206 573 ureC urease subunit alpha; Reviewed 95.66
PRK13985 568 UreB urease subunit beta; Provisional 95.51
PRK13309 572 ureC urease subunit alpha; Reviewed 95.23
PRK13207 568 ureC urease subunit alpha; Reviewed 95.22
TIGR01792 605 urease_alph urease, alpha subunit; InterPro: IPR005848 95.03
PRK13308 569 ureC urease subunit alpha; Reviewed 94.96
cd00375 567 Urease_alpha Urease alpha-subunit; Urease is a nickel-d 94.94
COG0804 568 UreC Urea amidohydrolase (urease) alpha subunit [Amino 92.22
PRK08392215 hypothetical protein; Provisional 97.73
COG1387237 HIS2 Histidinol phosphatase and related hydrolases of t 96.48
TIGR00674288 dapA dihydrodipicolinate synthase; InterPro: IPR005263 93.15
PRK09248246 putative hydrolase; Validated 96.85
PRK08609570 hypothetical protein; Provisional 90.06
TIGR01430346 aden_deam adenosine deaminase; InterPro: IPR006330 This 93.15
PRK08123266 histidinol-phosphatase; Reviewed 92.22
TIGR03473283 HpnK hopanoid biosynthesis associated protein HpnK. The 90.81
pfam04794261 YdjC YdjC-like protein. Family of YdjC-like proteins. T 90.23
pfam02679245 ComA (2R)-phospho-3-sulfolactate synthase (ComA). In me 90.34
>TIGR00010 TIGR00010 hydrolase, TatD family; InterPro: IPR015991 Escherichia coli TatD (synonym MttC) has been shown experimentally to be a DNase Back     alignment and domain information
>PRK10812 putative metallodependent hydrolase; Provisional Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam01026 TatD_DNase TatD related DNase Back     alignment and domain information
>KOG3020 consensus Back     alignment and domain information
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>COG1831 Predicted metal-dependent hydrolase (urease superfamily) [General function prediction only] Back     alignment and domain information
>pfam04909 Amidohydro_2 Amidohydrolase Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon Back     alignment and domain information
>pfam02126 PTE Phosphotriesterase family Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>COG3618 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>PRK01211 dihydroorotase; Provisional Back     alignment and domain information
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>PRK05451 dihydroorotase; Provisional Back     alignment and domain information
>PRK06846 deaminase; Validated Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK07583 cytosine deaminase; Validated Back     alignment and domain information
>cd01316 CAD_DHOase The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type; InterPro: IPR004722 Dihydroorotase belongs to MEROPS peptidase family M38 (clan MJ), where it is classified as a non-peptidase homologue Back     alignment and domain information
>PRK04250 dihydroorotase; Provisional Back     alignment and domain information
>COG4464 CapC Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1820 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03179 gua_deam guanine deaminase Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01311 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM) Back     alignment and domain information
>PRK00369 pyrC dihydroorotase; Provisional Back     alignment and domain information
>KOG3968 consensus Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>PRK00912 ribonuclease P protein component 3; Provisional Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA Back     alignment and domain information
>pfam01979 Amidohydro_1 Amidohydrolase family Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information
>pfam01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19) Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00124 adenosine deaminase; Provisional Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>pfam07969 Amidohydro_3 Amidohydrolase family Back     alignment and domain information
>cd01301 rDP_like renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipeptidase, is a membrane-bound glycoprotein hydrolyzing dipeptides and is involved in hydrolytic metabolism of penem and carbapenem beta-lactam antibiotics Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>PRK08323 dihydropyrimidinase; Validated Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>PRK07328 histidinol-phosphatase; Provisional Back     alignment and domain information
>COG0044 PyrC Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05588 histidinol-phosphatase; Provisional Back     alignment and domain information
>PRK13206 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK13985 UreB urease subunit beta; Provisional Back     alignment and domain information
>PRK13309 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK13207 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>TIGR01792 urease_alph urease, alpha subunit; InterPro: IPR005848 Urease (urea amidohydrolase, 3 Back     alignment and domain information
>PRK13308 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide Back     alignment and domain information
>COG0804 UreC Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>COG1387 HIS2 Histidinol phosphatase and related hydrolases of the PHP family [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase; InterPro: IPR005263 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK09248 putative hydrolase; Validated Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase; InterPro: IPR006330 This family includes the experimentally verified adenosine deaminases of mammals and Escherichia coli Back     alignment and domain information
>PRK08123 histidinol-phosphatase; Reviewed Back     alignment and domain information
>TIGR03473 HpnK hopanoid biosynthesis associated protein HpnK Back     alignment and domain information
>pfam04794 YdjC YdjC-like protein Back     alignment and domain information
>pfam02679 ComA (2R)-phospho-3-sulfolactate synthase (ComA) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target262 hypothetical protein CLIBASIA_00500 [Candidatus Liberib
2gzx_A265 Crystal Structure Of The Tatd Deoxyribonuclease Mw0 5e-45
1j6o_A268 Crystal Structure Of Tatd-Related Deoxyribonuclease 3e-39
1yix_A265 Crystal Structure Of Ycfh, Tatd Homolog From Escher 2e-38
1zzm_A259 Crystal Structure Of Yjjv, Tatd Homolog From Escher 4e-36
1xwy_A264 Crystal Structure Of Tatd Deoxyribonuclease From Es 5e-31
2y1h_A272 Crystal Structure Of The Human Tatd-Domain Protein 1e-28
3rcm_A287 Crystal Structure Of Efi Target 500140:tatd Family 1e-24
2xio_A301 Structure Of Putative Deoxyribonuclease Tatdn1 Isof 2e-21
3ipw_A325 Crystal Structure Of Hydrolase Tatd Family Protein 3e-17
3gg7_A254 Crystal Structure Of An Uncharacterized Metalloprot 3e-14
3e2v_A401 Crystal Structure Of An Uncharacterized Amidohydrol 3e-06
>gi|112491012|pdb|2GZX|A Chain A, Crystal Structure Of The Tatd Deoxyribonuclease Mw0446 From Staphylococcus Aureus. Northeast Structural Genomics Consortium Target Zr237. Length = 265 Back     alignment and structure
 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 90/254 (35%), Positives = 137/254 (53%), Gaps = 1/254 (0%)

Query: 2   LIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSV 61
           LIDTH HL    +D+D  +VI RA +A V +   +           KL  +Y    +  +
Sbjct: 2   LIDTHVHLNDEQYDDDLSEVITRAREAGVDRXFVVGFNKSTIERAXKLIDEYDFL-YGII 60

Query: 62  GTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRI 121
           G HP  A +  E  ++ +  LA HP+V+ IGE GLD + +    + QK VF + I  ++ 
Sbjct: 61  GWHPVDAIDFTEEHLEWIESLAQHPKVIGIGEXGLDYHWDKSPADVQKEVFRKQIALAKR 120

Query: 122 TGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMIT 181
             +P++IH+R A  D   IL EE  +           S +    +  +L  YIS  G +T
Sbjct: 121 LKLPIIIHNREATQDCIDILLEEHAEEVGGIXHSFSGSPEIADIVTNKLNFYISLGGPVT 180

Query: 182 FPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYED 241
           F      + +A+ +  +R+LVETD+PY+ P   +GKRNEPA V   A+ +A+ K +SYE+
Sbjct: 181 FKNAKQPKEVAKHVSXERLLVETDAPYLSPHPYRGKRNEPARVTLVAEQIAELKGLSYEE 240

Query: 242 LMEETTKNALKLFS 255
           + E+TTKNA KLF+
Sbjct: 241 VCEQTTKNAEKLFN 254


>gi|24987382|pdb|1J6O|A Chain A, Crystal Structure Of Tatd-Related Deoxyribonuclease (Tm0667) From Thermotoga Maritima At 1.8 A Resolution Length = 268 Back     alignment and structure
>gi|60594393|pdb|1YIX|A Chain A, Crystal Structure Of Ycfh, Tatd Homolog From Escherichia Coli K12, At 1.9 A Resolution Length = 265 Back     alignment and structure
gi|71042572|pdb|1ZZM|A Chain A, Crystal Structure Of Yjjv, Tatd Homolog From Escherichia Coli K12, At 1.8 A Resolution Length = 259 Back     alignment and structure
gi|60594083|pdb|1XWY|A Chain A, Crystal Structure Of Tatd Deoxyribonuclease From Escherichia Coli K12 At 2.0 A Resolution Length = 264 Back     alignment and structure
>gi|315583405|pdb|2Y1H|A Chain A, Crystal Structure Of The Human Tatd-Domain Protein 3 (Tatdn3) Length = 272 Back     alignment and structure
>gi|329666294|pdb|3RCM|A Chain A, Crystal Structure Of Efi Target 500140:tatd Family Hydrolase From Pseudomonas Putida Length = 287 Back     alignment and structure
>gi|300508387|pdb|2XIO|A Chain A, Structure Of Putative Deoxyribonuclease Tatdn1 Isoform A Length = 301 Back     alignment and structure
>gi|257097747|pdb|3IPW|A Chain A, Crystal Structure Of Hydrolase Tatd Family Protein From Entamoeba Histolytica Length = 325 Back     alignment and structure
>gi|225734259|pdb|3GG7|A Chain A, Crystal Structure Of An Uncharacterized Metalloprotein From Deinococcus Radiodurans Length = 254 Back     alignment and structure
>gi|197305164|pdb|3E2V|A Chain A, Crystal Structure Of An Uncharacterized Amidohydrolase From Saccharomyces Cerevisiae Length = 401 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target262 hypothetical protein CLIBASIA_00500 [Candidatus Liberib
1j6o_A268 TATD-related deoxyribonuclease; structural genomics, TM 5e-60
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Ho 2e-55
3e2v_A401 3'-5'-exonuclease; structural genomics, hydrolase, PSI- 2e-44
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NESG, Z 2e-41
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc I 3e-41
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK 8e-41
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seattle s 1e-39
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, 2e-38
1bf6_A291 Phosphotriesterase homology protein; hypothetical prote 3e-35
3f4c_A332 Organophosphorus hydrolase; alpha-beta barrel, amidohyd 3e-35
3gg7_A254 Uncharacterized metalloprotein; structural genomics, un 3e-34
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promiscuous 5e-33
3guw_A261 Uncharacterized protein AF_1765; alpha-beta protein, st 2e-29
3ojg_A330 Phosphotriesterase; (beta/alpha)8 barrel, lactonase, hy 1e-28
3k2g_A364 Resiniferatoxin-binding, phosphotriesterase- related pr 3e-26
2ob3_A330 Parathion hydrolase; metalloenzyme, TIM barrel, nerve a 8e-26
2qpx_A376 Predicted metal-dependent hydrolase of the TIM- barrel 1e-15
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protein str 6e-08
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; struct 8e-04
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase, alp 6e-26
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Length = 268 Back     alignment and structure
 Score =  226 bits (576), Expect = 5e-60
 Identities = 90/258 (34%), Positives = 143/258 (55%), Gaps = 2/258 (0%)

Query: 2   LIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSV 61
           ++DTH HL    FD+DR+ VI    + N+  ++ + + ++D    + L +     IFCSV
Sbjct: 13  MVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDR-IFCSV 71

Query: 62  GTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRI 121
           G HP  A E  E  ++ L   A   +VVAIGETGLD + N    E QK VF+  IE +  
Sbjct: 72  GVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGK 131

Query: 122 TGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMIT 181
             +PLV+H R A  +   IL+ E        VIH FSS  + A   ++LG  +   G +T
Sbjct: 132 LNLPLVVHIRDAYSEAYEILRTE-SLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVT 190

Query: 182 FPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYED 241
           +PK +ALR + + + ++ +++ETD P++ P   +GKRNEP Y+    + +++   V    
Sbjct: 191 YPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAK 250

Query: 242 LMEETTKNALKLFSKISE 259
           + E TT+NA ++F ++ E
Sbjct: 251 VDEATTENARRIFLEVKE 268


>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Length = 301 Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.50A {Saccharomyces cerevisiae YJM789} Length = 401 Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural genomics, PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Length = 265 Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Length = 264 Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX research center for structural genomics, NYSGXRC, structural genomics, PSI; 1.90A {Escherichia coli K12} SCOP: c.1.9.12 Length = 265 Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infectious disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Length = 325 Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Length = 259 Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Length = 291 Back     alignment and structure
>3f4c_A Organophosphorus hydrolase; alpha-beta barrel, amidohydrolase, binuclear metal enzyme, glycerol-bound; HET: KCX; 2.07A {Geobacillus stearothermophilus 10} PDB: 3f4d_A* Length = 332 Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} Length = 254 Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Length = 314 Back     alignment and structure
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Length = 261 Back     alignment and structure
>3ojg_A Phosphotriesterase; (beta/alpha)8 barrel, lactonase, hydrolase; HET: KCX HL4; 1.60A {Geobacillus kaustophilus} PDB: 3f4c_A* 3f4d_A* Length = 330 Back     alignment and structure
>3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} Length = 364 Back     alignment and structure
>2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Length = 330 Back     alignment and structure
>2qpx_A Predicted metal-dependent hydrolase of the TIM- barrel fold; YP_805737.1, putative metal-dependent hydrolase, structural genomics; HET: KCX MSE; 1.40A {Lactobacillus casei atcc 334} Length = 376 Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Length = 363 Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Length = 272 Back     alignment and structure
>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Length = 339 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target262 hypothetical protein CLIBASIA_00500 [Candidatus Liberib
1j6o_A268 TATD-related deoxyribonuclease; structural genomics, TM 100.0
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc I 100.0
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK 100.0
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Ho 100.0
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NESG, Z 100.0
3e2v_A401 3'-5'-exonuclease; structural genomics, hydrolase, PSI- 100.0
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seattle s 100.0
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, 100.0
3gg7_A254 Uncharacterized metalloprotein; structural genomics, un 100.0
3guw_A261 Uncharacterized protein AF_1765; alpha-beta protein, st 100.0
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promiscuous 100.0
1bf6_A291 Phosphotriesterase homology protein; hypothetical prote 100.0
3ojg_A330 Phosphotriesterase; (beta/alpha)8 barrel, lactonase, hy 100.0
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase, alp 99.97
2ob3_A330 Parathion hydrolase; metalloenzyme, TIM barrel, nerve a 99.97
3k2g_A364 Resiniferatoxin-binding, phosphotriesterase- related pr 99.96
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; struct 99.78
3irs_A291 Uncharacterized protein BB4693; structural genomics, PS 99.6
2gwg_A350 4-oxalomesaconate hydratase; TIM-barrel like protein, s 99.53
2ffi_A288 2-pyrone-4,6-dicarboxylic acid hydrolase, putative; TIM 99.49
2wm1_A336 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; 99.38
2hbv_A334 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase; 99.26
2f6k_A307 Metal-dependent hydrolase; metal dependent hydrolyse, a 99.22
2dvt_A327 Thermophilic reversible gamma-resorcylate decarboxylase 99.17
3ij6_A312 Uncharacterized metal-dependent hydrolase; structural g 99.14
2qah_A303 2-pyrone-4,6-dicarboxylic acid hydrolase; structural ge 99.01
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, prote 97.53
2vun_A386 Enamidase; nicotinate degradation, binuclear metal cent 97.47
2i5g_A325 Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, structura 97.41
2z26_A347 Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX 95.2
2qpx_A376 Predicted metal-dependent hydrolase of the TIM- barrel 99.46
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protein str 98.44
1p1m_A406 Hypothetical protein TM0936; putative metal dependent h 97.4
1itu_A369 Renal dipeptidase; glycoprotein, membrane-bound, zinc p 96.2
3ly0_A364 Dipeptidase AC. metallo peptidase. merops family M19; s 94.99
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidazole c 94.21
3neh_A318 Renal dipeptidase family protein; structural genomics, 94.17
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, adenine 92.99
1j5s_A463 Uronate isomerase; TM0064, structural genomics, JCSG, P 92.58
2pgf_A371 Adenosine deaminase; metallo-dependent hydrolase, struc 92.3
3id7_A400 Dipeptidase; streptomyces coelicolor A3(2), hydrolase; 91.93
3ou8_A326 Adenosine deaminase; structural genomics, PSI-2, protei 90.89
2yxo_A267 Histidinol phosphatase; metal-dependent, hydrolase; 1.6 96.88
1m65_A245 Hypothetical protein YCDX; structural genomics, beta-al 94.9
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, stru 95.5
2wje_A247 CPS4B, tyrosine-protein phosphatase CPSB; capsule bioge 93.47
3b40_A417 PVDM, probable dipeptidase; structural genomics, hydrol 95.16
2rag_A417 Dipeptidase; aminohydrolase, structural genomics, NYSGX 90.97
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Back     alignment and structure
Probab=100.00  E-value=0  Score=528.69  Aligned_cols=257  Identities=35%  Similarity=0.568  Sum_probs=246.2

Q ss_pred             CEEEEECCCCCHHHHCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             91686138887565226899999999869989999167987789999999855723321124454433446788998853
Q gi|254780215|r    1 MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVPLIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELV   80 (262)
Q Consensus         1 M~iD~H~HL~~~~~~~d~~~~i~~a~~~gv~~~i~~~~~~~~~~~~~~l~~~~p~~i~~a~GiHP~~~~~~~~~~~~~l~   80 (262)
                      ||||+||||+...|++|+++++++|.++||.+++++|+++++|.+++++++++| .+++|+|+|||++.+..+++++.+.
T Consensus        12 ~lIDtH~HL~~~~~~~d~~~vl~~a~~~gv~~ii~~~~~~~~~~~~~~l~~~~~-~v~~a~GiHP~~~~~~~~~~~~~l~   90 (268)
T 1j6o_A           12 HMVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSD-RIFCSVGVHPHDAKEVPEDFIEHLE   90 (268)
T ss_dssp             CEEEEEECTTSGGGTTTHHHHHHTTTTTTEEEEEEECSSHHHHHHHHHHHTTCT-TEEEEECCCGGGGGGCCTTHHHHHH
T ss_pred             CEEEECCCCCCHHHCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHCCC-CEEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             779853478972446599999999998899889990599999999999984589-6688746898863657677899999


Q ss_pred             HHCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEECHHHHHHHHHHHHHHHHCCCCCCCCEECCCC
Q ss_conf             10013332100446775533221110246789999876642044203300023335799985310003675331121464
Q gi|254780215|r   81 CLASHPRVVAIGETGLDRYHNAHTIEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSS  160 (262)
Q Consensus        81 ~l~~~~~~~aIGEiGLD~~~~~~~~e~Q~~vF~~ql~lA~e~~~pv~iH~r~a~~~~l~iL~~~~~~~~~~~i~H~FsG~  160 (262)
                      .++..++++|||||||||+++.++.+.|+++|++||++|+++++||+||||+|+++++++|+++.. ...++|+|||+|+
T Consensus        91 ~~~~~~~~vaIGEiGLD~~~~~~~~~~Q~~~F~~ql~lA~~~~~Pv~iH~r~a~~~~~~il~~~~~-~~~~~i~H~fsG~  169 (268)
T 1j6o_A           91 KFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESL-PEKRGVIHAFSSD  169 (268)
T ss_dssp             HHTTSTTEEEEEEEEEETTTCSSCHHHHHHHHHHHHHHHHHHTCCEEEEEESCHHHHHHHHHHSCC-CSSCEEETTCCSC
T ss_pred             HHHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHCC-CCCCEEEEECCCC
T ss_conf             987308789983466664545237899999999999999861998799710068999999998258-7667589854898


Q ss_pred             HHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHH
Q ss_conf             02344321035202023322113332233332105667179830786678777688758824499999999987289989
Q gi|254780215|r  161 QKLADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPAYVVNTAKALAKEKDVSYE  240 (262)
Q Consensus       161 ~~~~~~~l~~g~y~S~~g~i~~~~~~~~~e~v~~iPldriLlETDsP~l~p~~~r~~~n~P~~i~~~~~~iA~i~~~~~e  240 (262)
                      .+++++++++||||||||.+|++++++++++++.+|+||||+||||||++|.|+||++|+|++|+.|++.+|+++|++.+
T Consensus       170 ~e~~~~~l~~G~y~s~~g~~~~~~~~~~~~~v~~iPldrlLlETDaP~l~p~~~~g~~n~P~~l~~v~~~iA~i~~~~~e  249 (268)
T 1j6o_A          170 YEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEA  249 (268)
T ss_dssp             HHHHHHHHHHTEEEEECGGGGCTTCHHHHHHHHHHCGGGEEECCCBTSCCCGGGTTSCCCGGGHHHHHHHHHHHHTSCHH
T ss_pred             HHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHH
T ss_conf             99999999789959855764400089999999847865068745898777655578879759999999999988498999


Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999998425687
Q gi|254780215|r  241 DLMEETTKNALKLFSKISE  259 (262)
Q Consensus       241 ei~~~~~~N~~~~f~~~~~  259 (262)
                      ++++++++|+++||+++++
T Consensus       250 ~v~~~~~~N~~~lF~~~k~  268 (268)
T 1j6o_A          250 KVDEATTENARRIFLEVKE  268 (268)
T ss_dssp             HHHHHHHHHHHHHHHSCCC
T ss_pred             HHHHHHHHHHHHHHHHHCC
T ss_conf             9999999999999998429



>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX research center for structural genomics, NYSGXRC, structural genomics, PSI; 1.90A {Escherichia coli K12} SCOP: c.1.9.12 Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural genomics, PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure