254780218

254780218

thymidylate kinase

GeneID in NCBI database:8209199Locus tag:CLIBASIA_00515
Protein GI in NCBI database:254780218Protein Accession:YP_003064631.1
Gene range:-(105715, 106392)Protein Length:225aa
Gene description:thymidylate kinase
COG prediction:[F] Thymidylate kinase
KEGG prediction:tmk; thymidylate kinase (EC:2.7.4.9); K00943 dTMP kinase [EC:2.7.4.9]
SEED prediction:Thymidylate kinase (EC 2.7.4.9)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:pyrimidine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI
cccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHccEEEEEccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHccccccccccHccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHHcccccccccc
mnsglfisfegiegagkTTHISLLKRFLQrknydvhvtrepggtpaAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRfldssyayqgerdssqhlfLDSLQEisvqevmpdctiildlpvdiglkrvqnryslresacldyferkdVMIHEKRRQIFLDIarnqpdrchivdsahsFQSVATNILNIVWELVQKrvsplsskkdi
MNSGLFISfegiegagKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNryslresacldyferkdVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVqkrvsplsskkdi
MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDefgaeaeaivfaaaRLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI
*NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQ************YFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELV*************
MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKR**********
*NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS**ESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI
MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI
MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target225 thymidylate kinase [Candidatus Liberibacter asiaticus s
315122339227 thymidylate kinase [Candidatus Liberibacter solanacearu 1 2e-95
209549399226 thymidylate kinase [Rhizobium leguminosarum bv. trifoli 1 7e-60
241204716236 thymidylate kinase [Rhizobium leguminosarum bv. trifoli 1 2e-59
116252223226 thymidylate kinase [Rhizobium leguminosarum bv. viciae 1 4e-59
190891837236 thymidylate kinase protein [Rhizobium etli CIAT 652] Le 1 2e-58
218682276226 thymidylate kinase [Rhizobium etli CIAT 894] Length = 2 1 4e-58
86357778236 thymidylate kinase protein [Rhizobium etli CFN 42] Leng 1 3e-57
222086013227 thymidylate kinase [Agrobacterium radiobacter K84] Leng 1 4e-57
218463772220 thymidylate kinase [Rhizobium etli Kim 5] Length = 220 1 4e-56
222148589221 thymidylate kinase [Agrobacterium vitis S4] Length = 22 1 1e-55
>gi|315122339|ref|YP_004062828.1| thymidylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 227 Back     alignment and organism information
 Score =  352 bits (902), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 163/224 (72%), Positives = 195/224 (87%)

Query: 1   MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60
           MNSGLFISFEGIEG GKTTHIS L  FL++ NYDV +TREPGGTP AEAARHVLL+ GVD
Sbjct: 1   MNSGLFISFEGIEGVGKTTHISHLAGFLKKNNYDVQITREPGGTPVAEAARHVLLTGGVD 60

Query: 61  EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120
           EFGA AE+I+F++ RLDHVENVIRPAL+EGKILLCDRFLDSSYAYQGE+D  +  FLDSL
Sbjct: 61  EFGAYAESILFSSIRLDHVENVIRPALIEGKILLCDRFLDSSYAYQGEKDDFKKTFLDSL 120

Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180
           Q++S Q ++PDCTIILDLPVD+GL+R+++RYSL++++ LDYFERKD ++HEKRR+IFLDI
Sbjct: 121 QQVSTQGIVPDCTIILDLPVDVGLQRIRHRYSLKKNSSLDYFERKDWIVHEKRRRIFLDI 180

Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKD 224
           AR+QP+RC IVD+ H FQ VA +ILNIVWEL+QKR  P   K D
Sbjct: 181 ARDQPERCRIVDATHPFQDVAAHILNIVWELMQKRSFPRPPKGD 224


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209549399|ref|YP_002281316.1| thymidylate kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 226 Back     alignment and organism information
>gi|241204716|ref|YP_002975812.1| thymidylate kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 236 Back     alignment and organism information
>gi|116252223|ref|YP_768061.1| thymidylate kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 226 Back     alignment and organism information
>gi|190891837|ref|YP_001978379.1| thymidylate kinase protein [Rhizobium etli CIAT 652] Length = 236 Back     alignment and organism information
>gi|218682276|ref|ZP_03529877.1| thymidylate kinase [Rhizobium etli CIAT 894] Length = 226 Back     alignment and organism information
>gi|86357778|ref|YP_469670.1| thymidylate kinase protein [Rhizobium etli CFN 42] Length = 236 Back     alignment and organism information
>gi|222086013|ref|YP_002544545.1| thymidylate kinase [Agrobacterium radiobacter K84] Length = 227 Back     alignment and organism information
>gi|218463772|ref|ZP_03503863.1| thymidylate kinase [Rhizobium etli Kim 5] Length = 220 Back     alignment and organism information
>gi|222148589|ref|YP_002549546.1| thymidylate kinase [Agrobacterium vitis S4] Length = 221 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target225 thymidylate kinase [Candidatus Liberibacter asiaticus s
PRK13973213 PRK13973, PRK13973, thymidylate kinase; Provisional 9e-74
PRK00698205 PRK00698, tmk, thymidylate kinase; Validated 3e-56
cd01672200 cd01672, TMPK, Thymidine monophosphate kinase (TMPK), a 9e-50
TIGR00041195 TIGR00041, DTMP_kinase, thymidylate kinase 6e-42
pfam02223186 pfam02223, Thymidylate_kin, Thymidylate kinase 2e-37
PRK13976209 PRK13976, PRK13976, thymidylate kinase; Provisional 9e-34
PLN02924220 PLN02924, PLN02924, thymidylate kinase 8e-09
KOG3327208 KOG3327, KOG3327, KOG3327, Thymidylate kinase/adenylate 2e-07
COG0125208 COG0125, Tmk, Thymidylate kinase [Nucleotide transport 2e-50
PRK13974212 PRK13974, PRK13974, thymidylate kinase; Provisional 8e-26
PRK13975196 PRK13975, PRK13975, thymidylate kinase; Provisional 9e-16
PRK07933213 PRK07933, PRK07933, thymidylate kinase; Validated 1e-06
>gnl|CDD|184429 PRK13973, PRK13973, thymidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|179089 PRK00698, tmk, thymidylate kinase; Validated Back     alignment and domain information
>gnl|CDD|30190 cd01672, TMPK, Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>gnl|CDD|161676 TIGR00041, DTMP_kinase, thymidylate kinase Back     alignment and domain information
>gnl|CDD|145402 pfam02223, Thymidylate_kin, Thymidylate kinase Back     alignment and domain information
>gnl|CDD|184431 PRK13976, PRK13976, thymidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178512 PLN02924, PLN02924, thymidylate kinase Back     alignment and domain information
>gnl|CDD|38537 KOG3327, KOG3327, KOG3327, Thymidylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30474 COG0125, Tmk, Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|172477 PRK13974, PRK13974, thymidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184430 PRK13975, PRK13975, thymidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|181172 PRK07933, PRK07933, thymidylate kinase; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 225 thymidylate kinase [Candidatus Liberibacter asiaticus s
PRK13973216 thymidylate kinase; Provisional 100.0
PRK00698204 tmk thymidylate kinase; Validated 100.0
PRK13974212 thymidylate kinase; Provisional 100.0
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 100.0
PRK13976202 thymidylate kinase; Provisional 100.0
TIGR00041211 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thy 100.0
PRK07933213 thymidylate kinase; Validated 100.0
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 100.0
PRK13975198 thymidylate kinase; Provisional 100.0
pfam02223186 Thymidylate_kin Thymidylate kinase. 100.0
KOG3327208 consensus 100.0
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 99.96
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 99.86
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 99.7
PRK02496185 adk adenylate kinase; Provisional 99.67
PRK00279215 adk adenylate kinase; Reviewed 99.62
TIGR01359189 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006 99.5
KOG3877393 consensus 99.5
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 99.43
PRK13808297 adenylate kinase; Provisional 99.42
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 99.39
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 99.36
PRK00889175 adenylylsulfate kinase; Provisional 99.36
PRK00131175 aroK shikimate kinase; Reviewed 99.34
KOG3079195 consensus 99.33
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 99.32
PRK06217185 hypothetical protein; Validated 99.31
PRK06761281 hypothetical protein; Provisional 99.28
pfam03976229 PPK2 Polyphosphate kinase 2 (PPK2). Inorganic polyphosp 99.27
PRK05541176 adenylylsulfate kinase; Provisional 99.27
TIGR01360191 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Mem 99.25
PRK03839180 putative kinase; Provisional 99.23
PRK04182178 cytidylate kinase; Provisional 99.23
PRK05480209 uridine kinase; Provisional 99.21
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 99.21
PRK08356195 hypothetical protein; Provisional 99.18
PRK01184183 hypothetical protein; Provisional 99.18
PRK03731172 aroL shikimate kinase II; Reviewed 99.18
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 99.13
PRK03846198 adenylylsulfate kinase; Provisional 99.13
PRK05057172 aroK shikimate kinase I; Reviewed 99.1
PRK06696227 uridine kinase; Validated 99.09
PRK13946195 shikimate kinase; Provisional 99.08
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 99.07
PRK08233182 hypothetical protein; Provisional 99.06
PRK09825176 idnK D-gluconate kinase; Provisional 99.04
PRK13947171 shikimate kinase; Provisional 99.02
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 99.01
PRK00300208 gmk guanylate kinase; Provisional 99.0
KOG4235244 consensus 98.99
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 98.98
PRK13948182 shikimate kinase; Provisional 98.96
PRK13949169 shikimate kinase; Provisional 98.94
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 98.93
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 98.92
PRK00625173 shikimate kinase; Provisional 98.92
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 98.92
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 98.92
PRK08118167 topology modulation protein; Reviewed 98.91
PRK06762166 hypothetical protein; Provisional 98.9
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 98.9
PRK07261171 topology modulation protein; Provisional 98.86
PRK11545177 gntK gluconate kinase 1; Provisional 98.84
PRK04040189 adenylate kinase; Provisional 98.82
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 98.81
PTZ00301210 uridine kinase; Provisional 98.78
PRK00081199 coaE dephospho-CoA kinase; Reviewed 98.75
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 98.73
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 98.71
pfam01202158 SKI Shikimate kinase. 98.71
PRK04220306 2-phosphoglycerate kinase; Provisional 98.66
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 98.65
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 98.65
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 98.63
pfam00625182 Guanylate_kin Guanylate kinase. 98.62
COG2326270 Uncharacterized conserved protein [Function unknown] 98.62
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 98.61
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 98.48
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 98.46
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 98.44
KOG3062281 consensus 98.4
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 98.4
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 98.39
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 98.37
TIGR02322183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 98.34
PRK03333 394 coaE dephospho-CoA kinase/unknown domain fusion protein 98.34
KOG3354191 consensus 98.3
KOG3220225 consensus 98.16
PRK12339197 2-phosphoglycerate kinase; Provisional 98.05
COG3172187 NadR Predicted ATPase/kinase involved in NAD metabolism 98.04
COG3709192 Uncharacterized component of phosphonate metabolism [In 98.04
KOG0635207 consensus 98.02
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 97.94
KOG3078235 consensus 97.93
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 97.92
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 97.92
PRK12338320 hypothetical protein; Provisional 97.91
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 97.84
KOG3308225 consensus 97.73
pfam03668 284 ATP_bind_2 P-loop ATPase protein family. This family co 97.68
PRK12337492 2-phosphoglycerate kinase; Provisional 97.63
PRK05416 292 hypothetical protein; Provisional 97.38
COG3911183 Predicted ATPase [General function prediction only] 97.21
PRK05439312 pantothenate kinase; Provisional 96.56
pfam01591223 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a 96.52
TIGR01188 343 drrA daunorubicin resistance ABC transporter, ATP-bindi 96.14
pfam08303169 tRNA_lig_kinase tRNA ligase kinase domain. This domain 95.93
PTZ00088225 adenylate kinase 1; Provisional 99.17
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 99.13
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 99.01
pfam00406186 ADK Adenylate kinase. 98.97
PRK07667190 uridine kinase; Provisional 98.91
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 98.81
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 98.54
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 98.45
PRK06547184 hypothetical protein; Provisional 98.41
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 98.39
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 98.34
pfam01121179 CoaE Dephospho-CoA kinase. This family catalyses the ph 98.28
PRK07429 331 phosphoribulokinase; Provisional 98.26
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 98.1
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 98.05
COG0645170 Predicted kinase [General function prediction only] 98.03
KOG3347176 consensus 98.03
KOG0780 483 consensus 97.84
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 97.82
COG4639168 Predicted kinase [General function prediction only] 97.79
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) ca 97.73
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 97.71
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.66
KOG0781587 consensus 97.53
TIGR00235220 udk uridine kinase; InterPro: IPR000764 Uridine kinase 97.37
COG1341 398 Predicted GTPase or GTP-binding protein [General functi 97.32
TIGR01526346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 97.27
KOG4238 627 consensus 97.2
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.17
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 97.15
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.08
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 96.45
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.33
KOG0730693 consensus 96.22
TIGR01663526 PNK-3'Pase polynucleotide kinase 3'-phosphatase; InterP 95.87
KOG0065 1391 consensus 94.94
pfam01712146 dNK Deoxynucleoside kinase. This family consists of var 99.14
PRK00023225 cmk cytidylate kinase; Provisional 98.81
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and metabol 98.72
PRK09270230 frcK putative fructose transport system kinase; Reviewe 98.58
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 98.35
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 98.13
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 98.01
PRK10416499 cell division protein FtsY; Provisional 97.99
PRK00771 433 signal recognition particle protein Srp54; Provisional 97.81
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 97.76
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 97.75
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.73
PRK10867 453 signal recognition particle protein; Provisional 97.67
PRK13695174 putative NTPase; Provisional 97.54
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 97.51
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.5
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.4
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 97.37
PRK09435325 arginine/ornithine transport system ATPase; Provisional 97.3
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.2
cd03114148 ArgK-like The function of this protein family is unkown 97.14
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 97.14
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 97.12
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 97.08
CHL00181287 cbbX CbbX; Provisional 96.95
COG1855 604 ATPase (PilT family) [General function prediction only] 96.9
PRK13764 605 ATPase; Provisional 96.9
cd03116159 MobB Molybdenum is an essential trace element in the fo 96.89
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 96.75
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.59
PRK06851 368 hypothetical protein; Provisional 96.56
PRK06851368 hypothetical protein; Provisional 96.56
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 96.53
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.53
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 96.48
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 96.44
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 96.43
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.4
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 96.39
TIGR01186 372 proV glycine betaine/L-proline transport ATP binding su 96.39
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 96.39
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.35
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 96.33
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.32
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.31
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.29
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 96.27
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 96.27
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 96.27
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.27
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 96.27
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 96.26
COG4240300 Predicted kinase [General function prediction only] 96.26
PRK10789569 putative multidrug transporter membrane\ATP-binding com 96.25
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 96.24
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 96.24
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 96.24
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.24
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.23
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.22
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 96.21
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 96.21
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 96.21
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 96.2
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 96.18
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 96.18
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.18
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 96.17
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 96.17
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.16
COG3839338 MalK ABC-type sugar transport systems, ATPase component 96.16
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 96.15
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.15
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 96.14
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.13
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 96.13
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 96.13
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.13
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 96.12
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 96.11
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 96.1
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.1
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.09
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 96.09
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 96.09
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 96.09
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 96.09
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 96.09
PRK10790593 putative multidrug transporter membrane\ATP-binding com 96.08
PRK09984262 phosphonate/organophosphate ester transporter subunit; 96.08
cd01394218 radB RadB. The archaeal protein radB shares similarity 96.08
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 96.07
PRK07940 395 DNA polymerase III subunit delta'; Validated 96.06
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.05
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 96.04
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.04
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 96.03
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 96.03
PRK12402337 replication factor C small subunit 2; Reviewed 96.02
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.02
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 96.02
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 96.01
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 96.01
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.01
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 96.0
TIGR00630956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 96.0
PHA02519387 plasmid partition protein SopA; Reviewed 95.99
PRK03695245 vitamin B12-transporter ATPase; Provisional 95.99
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.99
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.98
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.97
cd03234226 ABCG_White The White subfamily represents ABC transport 95.96
cd02034116 CooC The accessory protein CooC, which contains a nucle 95.96
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.96
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 95.96
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 95.95
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 95.95
PRK10744257 phosphate transporter subunit; Provisional 95.94
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.93
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.93
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.93
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 95.93
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 95.93
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 95.92
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.91
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.9
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 95.9
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 95.9
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.9
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.9
KOG0055 1228 consensus 95.89
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.87
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.86
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.86
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.85
PRK13544208 consensus 95.84
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 95.84
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 95.84
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.83
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 95.83
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 95.82
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 95.81
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.81
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 95.81
COG4619223 ABC-type uncharacterized transport system, ATPase compo 95.81
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 95.8
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 95.8
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.8
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 95.79
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 95.79
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 95.79
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.79
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.78
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 95.78
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 95.77
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 95.76
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.75
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 95.75
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 95.75
PRK10908222 cell division protein FtsE; Provisional 95.74
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.72
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 95.72
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.71
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 95.71
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.7
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.7
smart00382148 AAA ATPases associated with a variety of cellular activ 95.69
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 95.69
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 95.68
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 95.67
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 95.67
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 95.67
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.66
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 95.65
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 95.65
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 95.64
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 95.64
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 95.63
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 95.63
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 95.63
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 95.63
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 95.63
PRK13542224 consensus 95.62
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 95.62
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 95.62
COG4133209 CcmA ABC-type transport system involved in cytochrome c 95.61
PRK13849231 putative crown gall tumor protein VirC1; Provisional 95.6
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 95.59
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 95.59
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.58
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 95.58
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 95.58
TIGR00150147 TIGR00150 conserved hypothetical protein TIGR00150; Int 95.57
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 95.57
PRK12374231 putative dithiobiotin synthetase; Provisional 95.57
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 95.56
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 95.56
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 95.54
PRK08116262 hypothetical protein; Validated 95.53
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.52
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components [Intr 95.51
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.51
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 95.5
COG4185187 Uncharacterized protein conserved in bacteria [Function 95.5
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 95.5
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 95.49
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 95.48
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 95.48
COG1660286 Predicted P-loop-containing kinase [General function pr 95.46
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 95.46
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 95.45
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 95.45
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 95.44
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 95.42
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 95.42
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 95.42
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 95.41
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 95.41
PRK09183258 transposase/IS protein; Provisional 95.41
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 95.41
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 95.4
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 95.4
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 95.4
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 95.38
PRK12377248 putative replication protein; Provisional 95.38
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 95.36
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 95.35
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.35
PRK06067241 flagellar accessory protein FlaH; Validated 95.34
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 95.33
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 95.32
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 95.31
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 95.31
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.31
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 95.31
PRK11147 632 ABC transporter ATPase component; Reviewed 95.29
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.29
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 95.29
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.29
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 95.28
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.28
PRK13235274 nifH nitrogenase reductase; Reviewed 95.27
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 95.24
PRK13536306 nodulation factor exporter subunit NodI; Provisional 95.23
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 95.23
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 95.22
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.21
PRK13230292 nitrogenase reductase-like protein; Reviewed 95.21
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 95.21
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 95.2
KOG2004 906 consensus 95.2
PRK07952242 DNA replication protein DnaC; Validated 95.18
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 95.18
pfam06745231 KaiC KaiC. This family represents a conserved region wi 95.16
pfam00931285 NB-ARC NB-ARC domain. 95.15
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 95.15
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 95.14
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 95.14
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 95.13
KOG1805 1100 consensus 95.12
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 95.11
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 95.1
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.1
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 95.1
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 95.09
PRK08181269 transposase; Validated 95.09
PRK07399314 DNA polymerase III subunit delta'; Validated 95.08
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 95.08
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 95.08
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 95.08
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 95.08
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 95.06
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 95.03
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 95.03
PRK11147632 ABC transporter ATPase component; Reviewed 95.03
pfam07726131 AAA_3 ATPase family associated with various cellular ac 95.02
PRK13409 590 putative ATPase RIL; Provisional 95.02
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 95.01
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 94.98
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 94.96
PRK13232273 nifH nitrogenase reductase; Reviewed 94.96
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 94.96
PRK06526254 transposase; Provisional 94.95
COG4175 386 ProV ABC-type proline/glycine betaine transport system, 94.94
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 94.94
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 94.93
PRK00635 1809 excinuclease ABC subunit A; Provisional 94.92
PRK00349944 uvrA excinuclease ABC subunit A; Reviewed 94.91
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 94.91
PRK04195 403 replication factor C large subunit; Provisional 94.9
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 94.89
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 94.89
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 94.88
PRK10636638 putative ABC transporter ATP-binding protein; Provision 94.84
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 94.84
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 94.83
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, reco 94.82
cd02040270 NifH NifH gene encodes component II (iron protein) of n 94.76
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 94.75
PRK00635 1809 excinuclease ABC subunit A; Provisional 94.74
KOG00551228 consensus 94.73
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 94.71
PRK00784 492 cobyric acid synthase; Provisional 94.7
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 94.7
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fold [G 94.69
TIGR01184230 ntrCD nitrate ABC transporter, ATP-binding proteins C a 94.66
PRK08939306 primosomal protein DnaI; Reviewed 94.66
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 94.66
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 94.65
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 94.63
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 94.63
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 94.62
COG4988559 CydD ABC-type transport system involved in cytochrome b 94.62
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 94.58
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 94.55
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 94.54
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 94.53
cd02032267 Bchl_like This family of proteins contains bchL and chl 94.53
PRK13236295 nitrogenase reductase; Reviewed 94.5
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 94.48
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 94.46
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 94.46
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 94.44
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 94.43
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 94.38
PRK10646153 putative ATPase; Provisional 94.38
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 94.37
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 94.31
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttransla 94.3
KOG0057591 consensus 94.3
KOG0744423 consensus 94.28
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 94.26
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 94.25
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 98.68
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 98.3
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.81
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 98.66
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 98.51
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 98.17
pfam00693279 Herpes_TK Thymidine kinase from herpesvirus. 97.95
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 97.94
PRK13768253 GTPase; Provisional 97.49
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 96.98
KOG1532 366 consensus 96.78
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.65
PRK13342 417 recombination factor protein RarA; Reviewed 96.52
KOG1533290 consensus 96.31
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.25
TIGR02768 888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 96.03
PRK13341 726 recombination factor protein RarA/unknown domain fusion 95.98
PRK13889 992 conjugal transfer relaxase TraA; Provisional 95.71
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 95.16
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 94.51
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 97.46
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA mismat 94.88
COG4167267 SapF ABC-type antimicrobial peptide transport system, A 94.82
TIGR00313 502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 94.63
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thymidylate kinase (2 Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>pfam02223 Thymidylate_kin Thymidylate kinase Back     alignment and domain information
>KOG3327 consensus Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006266 This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase Back     alignment and domain information
>KOG3877 consensus Back     alignment and domain information
>TIGR01351 adk adenylate kinases; InterPro: IPR006259 Most members of this family are known or believed to be adenylate kinase Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>KOG3079 consensus Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892 Proteins in this family are believed to be cytidylate kinase Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>pfam03976 PPK2 Polyphosphate kinase 2 (PPK2) Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Members of this family are adenylate kinase, 2 Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK05480 uridine kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG4235 consensus Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information