254780217

254780217

DNA polymerase III subunit delta'

GeneID in NCBI database:8209198Locus tag:CLIBASIA_00510
Protein GI in NCBI database:254780217Protein Accession:YP_003064630.1
Gene range:-(104669, 105712)Protein Length:347aa
Gene description:DNA polymerase III subunit delta'
COG prediction:[L] ATPase involved in DNA replication
KEGG prediction:holB; DNA polymerase III subunit delta' (EC:2.7.7.7); K02341 DNA polymerase III subunit delta' [EC:2.7.7.7]
SEED prediction:DNA polymerase III delta prime subunit (EC 2.7.7.7)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Pyrimidine metabolism [PATH:las00240]
DNA replication [PATH:las03030]
Mismatch repair [PATH:las03430]
Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA-replication;
Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI
ccccccccccHHHHcccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHHHHccHHHcccEEEEEEcHHHccHHHHHHHHHHHHcccccEEEEEEEccHHHccHHHHHHHHEEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHcc
ccHHHcccccHHHHccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHccccEEEEEEEcccccccccccccccHHHHHHHHHHccccccccccEEEEEEcHHHccHHHHHHHHHHHHcccccEEEEEEEccHHHccHHHHcccEEEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHccccccEEEEEccc
midrafdpvynqrlfgheDIEKFLSQYYCSGRMHHALLFEGEQGIGKATlgfryaghvlqnpdfskapvrmcnpdpcspfvKQMASHALHDFLYLsyslnpktgkwrtvITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKArecndlyfrDFYAI
midrafdpvynqrlfgHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSyslnpktgkwrtvITVDEIRRIRYFlsltantgywRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLskarecndlyFRDFYAI
MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI
MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAAL*GQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI
MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI
MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI
MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI
MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target347 DNA polymerase III subunit delta' [Candidatus Liberibac
315122340347 DNA polymerase III subunit delta' [Candidatus Liberibac 1 1e-149
86357777341 DNA polymerase III subunit delta' [Rhizobium etli CFN 4 1 1e-80
222086012345 DNA polymerase III delta prime subunit protein [Agrobac 1 4e-80
327193415341 DNA polymerase III protein, delta prime subunit [Rhizob 1 1e-79
241204715341 DNA polymerase III subunit delta' [Rhizobium leguminosa 1 2e-79
218463773341 DNA polymerase III subunit delta' [Rhizobium etli Kim 5 1 6e-79
190891836341 DNA polymerase III protein, delta prime subunit [Rhizob 1 6e-79
116252222341 DNA polymerase III subunit delta' [Rhizobium leguminosa 1 4e-78
209549398341 DNA polymerase III subunit delta' [Rhizobium leguminosa 1 9e-76
15965356343 DNA polymerase III subunit delta' [Sinorhizobium melilo 1 1e-75
>gi|315122340|ref|YP_004062829.1| DNA polymerase III subunit delta' [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 347 Back     alignment and organism information
 Score =  531 bits (1367), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 256/347 (73%), Positives = 296/347 (85%)

Query: 1   MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQ 60
           MID   DP+YN++LFGHE+IE+FLSQYY SG+MHHA LFEGE+GIGKATLGF YA HVLQ
Sbjct: 1   MIDGILDPIYNRKLFGHEEIEEFLSQYYSSGKMHHAFLFEGEEGIGKATLGFHYARHVLQ 60

Query: 61  NPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRY 120
           NPDF  AP +MC+PDP SPFVKQMAS ALH+FLYLSY LN KTGK RTVITVDEIRRIR+
Sbjct: 61  NPDFRNAPSQMCSPDPNSPFVKQMASRALHNFLYLSYPLNVKTGKLRTVITVDEIRRIRH 120

Query: 121 FLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSR 180
           FLSLTA+ GYWRVI+IDPVDGMN NAANALLKSLEEPP+KV+FILISHAS  IL TIRSR
Sbjct: 121 FLSLTADKGYWRVIIIDPVDGMNNNAANALLKSLEEPPKKVVFILISHASRVILPTIRSR 180

Query: 181 CLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYI 240
           CLS+KF +LSE NLYKALE LKI+   SK D + IA+YGSV+RAIKIL+Y CDKII+SYI
Sbjct: 181 CLSVKFKTLSEKNLYKALENLKIVDLHSKIDLINIASYGSVSRAIKILNYGCDKIIASYI 240

Query: 241 DLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQ 300
           DL+H   ++  L KMQQI+DEL  QD+KIAFDF +EFI+KE+ K AK AALSG+LEEADQ
Sbjct: 241 DLMHAQEEKSLLYKMQQISDELSPQDKKIAFDFFVEFIMKEMFKGAKEAALSGKLEEADQ 300

Query: 301 IAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLYFRDFYAI 347
           I QIY S+ K+V +F +YNLDRRQ+IF+LL KAR+CN +Y R FYAI
Sbjct: 301 IVQIYSSVKKKVDSFYIYNLDRRQIIFYLLEKARDCNIIYERIFYAI 347


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357777|ref|YP_469669.1| DNA polymerase III subunit delta' [Rhizobium etli CFN 42] Length = 341 Back     alignment and organism information
>gi|222086012|ref|YP_002544544.1| DNA polymerase III delta prime subunit protein [Agrobacterium radiobacter K84] Length = 345 Back     alignment and organism information
>gi|327193415|gb|EGE60314.1| DNA polymerase III protein, delta prime subunit [Rhizobium etli CNPAF512] Length = 341 Back     alignment and organism information
>gi|241204715|ref|YP_002975811.1| DNA polymerase III subunit delta' [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 341 Back     alignment and organism information
>gi|218463773|ref|ZP_03503864.1| DNA polymerase III subunit delta' [Rhizobium etli Kim 5] Length = 341 Back     alignment and organism information
>gi|190891836|ref|YP_001978378.1| DNA polymerase III protein, delta prime subunit [Rhizobium etli CIAT 652] Length = 341 Back     alignment and organism information
>gi|116252222|ref|YP_768060.1| DNA polymerase III subunit delta' [Rhizobium leguminosarum bv. viciae 3841] Length = 341 Back     alignment and organism information
>gi|209549398|ref|YP_002281315.1| DNA polymerase III subunit delta' [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 341 Back     alignment and organism information
>gi|15965356|ref|NP_385709.1| DNA polymerase III subunit delta' [Sinorhizobium meliloti 1021] Length = 343 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target347 DNA polymerase III subunit delta' [Candidatus Liberibac
PRK09112351 PRK09112, PRK09112, DNA polymerase III subunit delta'; 2e-96
PRK07471365 PRK07471, PRK07471, DNA polymerase III subunit delta'; 8e-61
PRK14957 546 PRK14957, PRK14957, DNA polymerase III subunits gamma a 2e-14
KOG0990360 KOG0990, KOG0990, KOG0990, Replication factor C, subuni 4e-05
COG0470325 COG0470, HolB, ATPase involved in DNA replication [DNA 5e-28
TIGR00678188 TIGR00678, holB, DNA polymerase III, delta' subunit 2e-38
PRK05707328 PRK05707, PRK05707, DNA polymerase III subunit delta'; 9e-26
PRK08699325 PRK08699, PRK08699, DNA polymerase III subunit delta'; 3e-23
PRK08769319 PRK08769, PRK08769, DNA polymerase III subunit delta'; 2e-20
PRK06090319 PRK06090, PRK06090, DNA polymerase III subunit delta'; 3e-17
PRK06871325 PRK06871, PRK06871, DNA polymerase III subunit delta'; 3e-17
PRK14962 472 PRK14962, PRK14962, DNA polymerase III subunits gamma a 9e-17
PRK14963 504 PRK14963, PRK14963, DNA polymerase III subunits gamma a 1e-16
PRK14959 624 PRK14959, PRK14959, DNA polymerase III subunits gamma a 4e-15
PRK06964342 PRK06964, PRK06964, DNA polymerase III subunit delta'; 5e-15
PRK14953 486 PRK14953, PRK14953, DNA polymerase III subunits gamma a 1e-14
PRK07940394 PRK07940, PRK07940, DNA polymerase III subunit delta'; 3e-14
PRK08691 709 PRK08691, PRK08691, DNA polymerase III subunits gamma a 4e-14
TIGR02397355 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamm 1e-13
PRK05564313 PRK05564, PRK05564, DNA polymerase III subunit delta'; 1e-13
PRK06305 451 PRK06305, PRK06305, DNA polymerase III subunits gamma a 1e-13
PRK07993334 PRK07993, PRK07993, DNA polymerase III subunit delta'; 2e-13
PRK14956 484 PRK14956, PRK14956, DNA polymerase III subunits gamma a 3e-13
PRK08058329 PRK08058, PRK08058, DNA polymerase III subunit delta'; 4e-13
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits gamma a 6e-13
PRK14965 576 PRK14965, PRK14965, DNA polymerase III subunits gamma a 2e-12
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits gamma a 7e-12
PRK14955397 PRK14955, PRK14955, DNA polymerase III subunits gamma a 8e-12
PRK14969 527 PRK14969, PRK14969, DNA polymerase III subunits gamma a 1e-11
PRK06645 507 PRK06645, PRK06645, DNA polymerase III subunits gamma a 1e-11
PRK14960 702 PRK14960, PRK14960, DNA polymerase III subunits gamma a 2e-11
PRK14958 509 PRK14958, PRK14958, DNA polymerase III subunits gamma a 4e-11
PRK06647 563 PRK06647, PRK06647, DNA polymerase III subunits gamma a 1e-10
PRK14970367 PRK14970, PRK14970, DNA polymerase III subunits gamma a 4e-10
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits gamma a 4e-10
PRK08451 535 PRK08451, PRK08451, DNA polymerase III subunits gamma a 8e-09
PRK09111 598 PRK09111, PRK09111, DNA polymerase III subunits gamma a 1e-08
PRK14952 584 PRK14952, PRK14952, DNA polymerase III subunits gamma a 3e-08
KOG0991333 KOG0991, KOG0991, KOG0991, Replication factor C, subuni 8e-06
PRK00440319 PRK00440, rfc, replication factor C small subunit; Revi 0.001
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisional 0.002
COG2812 515 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [ 8e-23
PRK14961363 PRK14961, PRK14961, DNA polymerase III subunits gamma a 7e-19
PRK07399314 PRK07399, PRK07399, DNA polymerase III subunit delta'; 1e-15
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits gamma a 4e-15
PRK06581263 PRK06581, PRK06581, DNA polymerase III subunit delta'; 6e-13
PRK07133 725 PRK07133, PRK07133, DNA polymerase III subunits gamma a 9e-10
KOG0989346 KOG0989, KOG0989, KOG0989, Replication factor C, subuni 3e-09
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits gamma a 2e-08
PRK14964 491 PRK14964, PRK14964, DNA polymerase III subunits gamma a 6e-08
PRK14949 944 PRK14949, PRK14949, DNA polymerase III subunits gamma a 1e-07
PRK07132299 PRK07132, PRK07132, DNA polymerase III subunit delta'; 3e-07
PRK05917290 PRK05917, PRK05917, DNA polymerase III subunit delta'; 1e-06
PRK07276290 PRK07276, PRK07276, DNA polymerase III subunit delta'; 2e-06
PRK05818261 PRK05818, PRK05818, DNA polymerase III subunit delta'; 1e-04
PRK04132846 PRK04132, PRK04132, replication factor C small subunit; 1e-04
PRK04195 482 PRK04195, PRK04195, replication factor C large subunit; 2e-04
PRK14954 620 PRK14954, PRK14954, DNA polymerase III subunits gamma a 8e-11
PRK05896 605 PRK05896, PRK05896, DNA polymerase III subunits gamma a 6e-10
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits gamma a 2e-07
PRK08485206 PRK08485, PRK08485, DNA polymerase III subunit delta'; 9e-07
PRK05563 559 PRK05563, PRK05563, DNA polymerase III subunits gamma a 9e-07
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits gamma a 2e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits gamma a 8e-04
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits gamma a 6e-04
KOG2035351 KOG2035, KOG2035, KOG2035, Replication factor C, subuni 8e-04
>gnl|CDD|169667 PRK09112, PRK09112, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|180989 PRK07471, PRK07471, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|184921 PRK14957, PRK14957, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|36208 KOG0990, KOG0990, KOG0990, Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|73174 COG0470, HolB, ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161993 TIGR00678, holB, DNA polymerase III, delta' subunit Back     alignment and domain information
>gnl|CDD|180215 PRK05707, PRK05707, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|181538 PRK08699, PRK08699, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|181551 PRK08769, PRK08769, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|180394 PRK06090, PRK06090, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|180738 PRK06871, PRK06871, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|184926 PRK14962, PRK14962, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|180779 PRK06964, PRK06964, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|184917 PRK14953, PRK14953, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|181175 PRK07940, PRK07940, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|169554 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|162839 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>gnl|CDD|180132 PRK05564, PRK05564, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|180523 PRK06305, PRK06305, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|181190 PRK07993, PRK07993, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|184920 PRK14956, PRK14956, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|181214 PRK08058, PRK08058, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|183438 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184929 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184935 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184919 PRK14955, PRK14955, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184933 PRK14969, PRK14969, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|180643 PRK06645, PRK06645, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184924 PRK14960, PRK14960, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184922 PRK14958, PRK14958, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|180644 PRK06647, PRK06647, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184934 PRK14970, PRK14970, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184915 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|181430 PRK08451, PRK08451, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|181656 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184916 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|36209 KOG0991, KOG0991, KOG0991, Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|179026 PRK00440, rfc, replication factor C small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|177379 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|32641 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|184925 PRK14961, PRK14961, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|180959 PRK07399, PRK07399, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|184914 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|180629 PRK06581, PRK06581, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|180856 PRK07133, PRK07133, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|36207 KOG0989, KOG0989, KOG0989, Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|180790 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184928 PRK14964, PRK14964, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184913 PRK14949, PRK14949, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|180855 PRK07132, PRK07132, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|102059 PRK05917, PRK05917, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|180916 PRK07276, PRK07276, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|180274 PRK05818, PRK05818, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|179744 PRK04132, PRK04132, replication factor C small subunit; Provisional Back     alignment and domain information
>gnl|CDD|179778 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|180308 PRK05896, PRK05896, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184912 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|181445 PRK08485, PRK08485, DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>gnl|CDD|180131 PRK05563, PRK05563, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|181191 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|181106 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|180790 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|37246 KOG2035, KOG2035, KOG2035, Replication factor C, subunit RFC3 [Energy production and conversion, Replication, recombination and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 347 DNA polymerase III subunit delta' [Candidatus Liberibac
PRK09112352 DNA polymerase III subunit delta'; Validated 100.0
PRK07471363 DNA polymerase III subunit delta'; Validated 100.0
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08058329 DNA polymerase III subunit delta'; Validated 100.0
PRK05707328 DNA polymerase III subunit delta'; Validated 100.0
PRK07993334 DNA polymerase III subunit delta'; Validated 100.0
PRK05564313 DNA polymerase III subunit delta'; Validated 100.0
PRK06871324 DNA polymerase III subunit delta'; Validated 100.0
PRK06964342 DNA polymerase III subunit delta'; Validated 100.0
PRK08769319 DNA polymerase III subunit delta'; Validated 100.0
PRK06090319 DNA polymerase III subunit delta'; Validated 100.0
PRK08699325 DNA polymerase III subunit delta'; Validated 100.0
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 100.0
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 100.0
KOG0991333 consensus 99.94
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07940395 DNA polymerase III subunit delta'; Validated 100.0
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 100.0
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 100.0
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 100.0
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 100.0
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 100.0
PRK07399314 DNA polymerase III subunit delta'; Validated 100.0
PRK07276290 DNA polymerase III subunit delta'; Validated 100.0
PRK12402337 replication factor C small subunit 2; Reviewed 100.0
PRK05917290 DNA polymerase III subunit delta'; Validated 100.0
PRK07132303 DNA polymerase III subunit delta'; Validated 100.0
PRK00440318 rfc replication factor C small subunit; Reviewed 100.0
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 100.0
KOG0989346 consensus 100.0
PRK13342417 recombination factor protein RarA; Reviewed 99.97
PRK04195403 replication factor C large subunit; Provisional 99.95
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.94
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 99.93
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.93
KOG0990360 consensus 99.91
KOG2035351 consensus 99.9
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.84
KOG2028554 consensus 99.82
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.74
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.62
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 99.51
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.5
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.31
KOG1969 877 consensus 99.27
PRK03992390 proteasome-activating nucleotidase; Provisional 99.14
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 99.03
CHL00176 631 ftsH cell division protein; Validated 99.02
CHL00095 823 clpC Clp protease ATP binding subunit 99.0
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 99.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 98.98
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.94
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.93
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.92
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.92
PRK10865 857 protein disaggregation chaperone; Provisional 98.89
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.86
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.85
PRK05574336 holA DNA polymerase III subunit delta; Reviewed 98.83
PRK08487328 DNA polymerase III subunit delta; Validated 98.75
KOG1970 634 consensus 98.74
KOG0730693 consensus 98.71
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.7
CHL00195491 ycf46 Ycf46; Provisional 98.67
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 98.66
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 98.56
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 98.55
PRK08903227 hypothetical protein; Validated 98.5
PRK06893229 DNA replication initiation factor; Validated 98.5
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.48
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 98.48
KOG0734 752 consensus 98.46
PRK05642234 DNA replication initiation factor; Validated 98.42
PRK08084235 DNA replication initiation factor; Provisional 98.41
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 98.39
PTZ00112650 origin recognition complex 1 protein; Provisional 98.38
PRK08727233 hypothetical protein; Validated 98.37
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.32
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 98.31
KOG0733 802 consensus 98.31
KOG1968 871 consensus 98.31
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 98.3
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.21
KOG0733802 consensus 98.0
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.97
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 97.95
KOG0731 774 consensus 97.95
PRK06620214 hypothetical protein; Validated 97.91
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 97.89
KOG0738491 consensus 97.88
COG1221403 PspF Transcriptional regulators containing an AAA-type 97.87
PRK04841 903 transcriptional regulator MalT; Provisional 97.87
PRK09087226 hypothetical protein; Validated 97.81
pfam00931285 NB-ARC NB-ARC domain. 97.77
PRK05022510 anaerobic nitric oxide reductase transcription regulato 97.7
KOG0740428 consensus 97.67
pfam05621302 TniB Bacterial TniB protein. This family consists of se 97.63
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 97.58
KOG0737386 consensus 97.55
KOG0732 1080 consensus 97.5
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 97.48
KOG0736 953 consensus 97.47
KOG0729435 consensus 97.38
COG1466334 HolA DNA polymerase III, delta subunit [DNA replication 97.36
KOG0735952 consensus 97.35
KOG0739439 consensus 97.32
KOG2227529 consensus 97.3
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 97.11
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 96.76
KOG1514767 consensus 96.75
TIGR02030340 BchI-ChlI magnesium chelatase ATPase subunit I; InterPr 96.61
COG3899 849 Predicted ATPase [General function prediction only] 95.98
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 95.14
KOG4658 889 consensus 95.13
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 94.66
PRK05818262 DNA polymerase III subunit delta'; Validated 100.0
PRK05629331 hypothetical protein; Validated 98.41
pfam06144172 DNA_pol3_delta DNA polymerase III, delta subunit. DNA p 98.17
PRK12422455 chromosomal replication initiation protein; Provisional 97.94
PRK06585343 holA DNA polymerase III subunit delta; Reviewed 97.86
KOG0735 952 consensus 97.47
KOG0730 693 consensus 96.96
) and delta prime (holB) subunits are distinct proteins encoded by separate genes. The delta prime subunit (holB) exhibits sequence homology to the tau and gamma subunits (dnaX), but the delta subunit (holA) does not demonstrate this same homology with dnaX. The delta, delta prime, gamma, chi and psi subunits form the gamma complex sub-assembly of DNA polymerase III holoenzyme, which couples ATP to assemble the ring-shaped beta subunit around DNA forming a DNA sliding clamp. Both delta and delta prime are monomeric in their native state, and they bind each other tightly to form a 1:1 complex. Neither delta nor delta prime alone binds tightly to the gamma subunit . ; GO: 0003677 DNA binding, 0003891 delta DNA polymerase activity, 0006260 DNA replication, 0043625 delta DNA polymerase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01128">TIGR01128331 holA DNA polymerase III, delta subunit; InterPro: IPR00 93.21
PRK06581263 DNA polymerase III subunit delta'; Validated 99.96
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.04
CHL00181287 cbbX CbbX; Provisional 98.99
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 98.93
pfam00004131 AAA ATPase family associated with various cellular acti 98.88
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.77
PRK10865857 protein disaggregation chaperone; Provisional 98.76
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 98.76
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.71
KOG1051898 consensus 98.67
KOG0743457 consensus 98.67
COG0714329 MoxR-like ATPases [General function prediction only] 98.63
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 98.61
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.52
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.51
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.5
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.45
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 98.44
CHL00095823 clpC Clp protease ATP binding subunit 98.41
KOG0742630 consensus 98.38
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 98.38
KOG2004 906 consensus 98.31
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.24
smart00382148 AAA ATPases associated with a variety of cellular activ 98.06
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 98.04
KOG0744423 consensus 97.94
pfam00493327 MCM MCM2/3/5 family. 97.88
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 97.83
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 97.77
smart00350509 MCM minichromosome maintenance proteins. 97.73
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 97.69
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 97.66
KOG2170344 consensus 97.65
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.51
PRK11608325 pspF phage shock protein operon transcriptional activat 97.48
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 97.47
KOG0741 744 consensus 97.47
PRK09183258 transposase/IS protein; Provisional 97.33
KOG0728404 consensus 97.32
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 97.28
KOG1808 1856 consensus 97.28
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 97.18
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.17
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 97.13
KOG0741744 consensus 97.1
PRK13695174 putative NTPase; Provisional 97.1
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.1
KOG0652424 consensus 96.99
PRK10365441 transcriptional regulatory protein ZraR; Provisional 96.93
KOG0478804 consensus 96.93
PRK06526254 transposase; Provisional 96.85
PRK10875 607 recD exonuclease V subunit alpha; Provisional 96.85
KOG0727408 consensus 96.84
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 96.75
PRK08181269 transposase; Validated 96.7
PRK12377248 putative replication protein; Provisional 96.68
KOG2543438 consensus 96.54
smart00487201 DEXDc DEAD-like helicases superfamily. 96.53
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 96.53
PRK10536262 hypothetical protein; Provisional 96.53
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 96.49
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.48
KOG0726440 consensus 96.47
COG1241682 MCM2 Predicted ATPase involved in replication control, 96.39
COG2204464 AtoC Response regulator containing CheY-like receiver, 96.25
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.17
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 95.93
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 95.85
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 95.79
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 95.73
PRK10416499 cell division protein FtsY; Provisional 95.73
PRK00771433 signal recognition particle protein Srp54; Provisional 95.67
KOG0477854 consensus 95.59
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 95.59
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA mismat 95.49
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.47
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.46
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 95.4
PRK11823454 DNA repair protein RadA; Provisional 95.32
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 95.31
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 95.22
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS prot 95.19
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 95.11
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.08
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.97
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 94.89
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.81
pfam01591223 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a 94.74
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 94.71
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The MutS 94.61
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes. Th 94.45
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 94.43
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 94.43
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS prot 94.41
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS prot 94.24
KOG1051 898 consensus 94.2
pfam00488234 MutS_V MutS domain V. This domain is found in proteins 94.2
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein 94.11
KOG2456477 consensus 94.0
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS prot 93.95
KOG18051100 consensus 93.8
KOG0922 674 consensus 93.69
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanisms] 93.67
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS family 93.64
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 93.62
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 93.55
PRK00279215 adk adenylate kinase; Reviewed 93.52
PTZ00111 916 DNA replication licensing factor MCM4; Provisional 93.31
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 93.2
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 93.04
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 93.03
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 92.92
COG1674858 FtsK DNA segregation ATPase FtsK/SpoIIIE and related pr 92.89
PRK06851368 hypothetical protein; Provisional 92.84
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 92.84
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS prot 92.84
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 92.66
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 92.53
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 92.5
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 92.06
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 91.8
COG5635 824 Predicted NTPase (NACHT family) [Signal transduction me 91.79
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 91.78
PRK04132 863 replication factor C small subunit; Provisional 91.31
COG5019373 CDC3 Septin family protein [Cell division and chromosom 91.27
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 91.18
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 91.04
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 91.04
COG3910233 Predicted ATPase [General function prediction only] 90.93
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 90.85
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 90.84
KOG0480764 consensus 90.8
COG0305435 DnaB Replicative DNA helicase [DNA replication, recombi 90.79
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 90.28
PRK04132863 replication factor C small subunit; Provisional 99.89
PRK08485204 DNA polymerase III subunit delta'; Validated 99.55
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 98.52
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 96.78
PRK10789569 putative multidrug transporter membrane\ATP-binding com 96.69
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 96.63
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 96.44
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 96.39
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 96.35
KOG1803649 consensus 96.28
PRK10790593 putative multidrug transporter membrane\ATP-binding com 96.28
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 96.24
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 96.2
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 96.04
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 95.98
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.93
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.8
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 95.37
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 95.2
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.76
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 94.7
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 94.25
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 94.12
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.94
COG4988559 CydD ABC-type transport system involved in cytochrome b 93.29
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 93.26
PRK13235274 nifH nitrogenase reductase; Reviewed 92.67
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 92.37
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 91.72
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are 91.52
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 91.23
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 90.92
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 98.58
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 98.5
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 98.16
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 98.13
pfam07726131 AAA_3 ATPase family associated with various cellular ac 97.93
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 97.83
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 97.74
PRK09862506 putative ATP-dependent protease; Provisional 97.41
KOG0745564 consensus 97.29
PRK13531 498 regulatory ATPase RavA; Provisional 96.86
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 96.72
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 96.65
PRK13768253 GTPase; Provisional 96.39
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 95.95
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 95.59
pfam04851103 ResIII Type III restriction enzyme, res subunit. 95.51
PRK10867453 signal recognition particle protein; Provisional 95.28
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 94.3
COG2842297 Uncharacterized ATPase, putative transposase [General f 93.32
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 93.11
PRK07773 868 replicative DNA helicase; Validated 92.66
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 92.6
cd02032267 Bchl_like This family of proteins contains bchL and chl 91.97
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 91.61
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 90.75
PRK04296197 thymidine kinase; Provisional 90.42
PRK06749428 replicative DNA helicase; Provisional 90.25
PRK07452326 DNA polymerase III subunit delta; Validated 98.38
PRK13765 637 ATP-dependent protease Lon; Provisional 98.29
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 97.64
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 97.59
KOG0736953 consensus 97.29
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 97.22
KOG0651388 consensus 96.77
PRK11545177 gntK gluconate kinase 1; Provisional 96.75
PRK07952242 DNA replication protein DnaC; Validated 96.71
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.65
PRK08116262 hypothetical protein; Validated 96.62
PRK06067241 flagellar accessory protein FlaH; Validated 96.34
pfam06309127 Torsin Torsin. This family consists of several eukaryot 96.3
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 96.24
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 96.13
PRK06921265 hypothetical protein; Provisional 95.76
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 95.74
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 95.74
PRK13764605 ATPase; Provisional 95.72
PRK04220306 2-phosphoglycerate kinase; Provisional 95.6
PRK08939306 primosomal protein DnaI; Reviewed 95.58
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 95.37
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 95.24
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.23
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 95.1
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 94.96
TIGR00764 662 lon_rel ATP-dependent protease, putative; InterPro: IPR 94.94
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 94.94
COG1855604 ATPase (PilT family) [General function prediction only] 94.93
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 94.86
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 94.68
PRK09435325 arginine/ornithine transport system ATPase; Provisional 94.67
PRK04328250 hypothetical protein; Provisional 94.57
PRK05748448 replicative DNA helicase; Provisional 94.55
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 94.54
KOG3347176 consensus 94.52
PRK07263453 consensus 94.43
PRK12338320 hypothetical protein; Provisional 94.41
PRK08506473 replicative DNA helicase; Provisional 94.3
PRK08840464 replicative DNA helicase; Provisional 94.21
PRK05595444 replicative DNA helicase; Provisional 94.17
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 94.17
PRK08082453 consensus 94.16
PRK06321472 replicative DNA helicase; Provisional 94.09
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 94.08
PRK09302501 circadian clock protein KaiC; Reviewed 94.02
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 93.94
PRK10436461 hypothetical protein; Provisional 93.92
PRK12337492 2-phosphoglycerate kinase; Provisional 93.9
PRK13900332 type IV secretion system ATPase VirB11; Provisional 93.89
PRK03846198 adenylylsulfate kinase; Provisional 93.73
PRK08006471 replicative DNA helicase; Provisional 93.68
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 93.68
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 93.59
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 93.35
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 93.13
PRK08694468 consensus 92.94
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 92.94
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 92.67
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 92.54
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular motor. Mu 92.5
PRK13833323 conjugal transfer protein TrbB; Provisional 92.49
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 92.46
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosins. My 92.42
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 92.41
PRK13946195 shikimate kinase; Provisional 92.38
PRK13851343 type IV secretion system protein VirB11; Provisional 92.29
PRK06696227 uridine kinase; Validated 92.22
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific type X 92.16
cd00124 679 MYSc Myosin motor domain. This catalytic (head) domain 92.02
pfam00063 679 Myosin_head Myosin head (motor domain). 91.89
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. In v 91.61
PRK06904472 replicative DNA helicase; Validated 91.51
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 91.5
TIGR00954788 3a01203 Peroxysomal long chain fatty acyl transporter; 91.49
PRK10646153 putative ATPase; Provisional 91.42
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. Myos 91.24
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 91.18
PRK05480209 uridine kinase; Provisional 91.08
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. Myos 90.93
COG0802149 Predicted ATPase or kinase [General function prediction 90.87
PRK13948182 shikimate kinase; Provisional 90.62
PHA00729228 NTP-binding motif containing protein 90.6
cd01379 653 MYSc_type_III Myosin motor domain, type III myosins. My 90.53
PRK13894320 conjugal transfer ATPase TrbB; Provisional 90.48
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. Myos 90.47
pfam05272198 VirE Virulence-associated protein E. This family contai 90.41
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. Myosin 90.28
KOG1942456 consensus 98.16
PRK07914320 hypothetical protein; Reviewed 97.39
KOG2680454 consensus 97.31
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 96.73
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 96.71
PRK00300208 gmk guanylate kinase; Provisional 96.63
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, LssB fa 96.06
PRK06835330 DNA replication protein DnaC; Validated 96.0
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 95.94
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.84
cd01394218 radB RadB. The archaeal protein radB shares similarity 95.73
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.65
PRK09302 501 circadian clock protein KaiC; Reviewed 95.54
cd03115173 SRP The signal recognition particle (SRP) mediates the 95.5
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 95.41
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 95.34
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 95.23
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 95.14
pfam00625182 Guanylate_kin Guanylate kinase. 95.02
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 94.86
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 94.78
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 94.76
PRK12339197 2-phosphoglycerate kinase; Provisional 94.75
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 94.71
PRK03839180 putative kinase; Provisional 94.7
TIGR00416481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 94.68
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.57
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 94.5
PRK07004460 replicative DNA helicase; Provisional 94.47
cd01124187 KaiC KaiC is a circadian clock protein primarily found 94.36
PRK13542224 consensus 94.31
PRK08118167 topology modulation protein; Reviewed 94.1
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 94.0
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 93.97
PRK07261171 topology modulation protein; Provisional 93.95
PRK09825176 idnK D-gluconate kinase; Provisional 93.9
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 93.68
pfam06745231 KaiC KaiC. This family represents a conserved region wi 93.61
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 93.61
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 93.47
PRK02496185 adk adenylate kinase; Provisional 93.47
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 93.42
PTZ00088225 adenylate kinase 1; Provisional 93.28
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 93.25
PRK05541176 adenylylsulfate kinase; Provisional 93.14
PRK09165484 replicative DNA helicase; Provisional 93.12
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 93.1
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 93.09
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 92.94
PRK03731172 aroL shikimate kinase II; Reviewed 92.89
PRK09270230 frcK putative fructose transport system kinase; Reviewe 92.77
PRK00131175 aroK shikimate kinase; Reviewed 92.75
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 92.63
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 92.59
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 92.47
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 92.44
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 92.26
pfam00406186 ADK Adenylate kinase. 92.08
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 92.07
PRK00889175 adenylylsulfate kinase; Provisional 92.0
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 91.86
PRK13947171 shikimate kinase; Provisional 91.71
KOG1533290 consensus 91.69
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 91.66
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 91.63
cd01918149 HprK_C HprK/P, the bifunctional histidine-containing pr 91.45
PRK05057172 aroK shikimate kinase I; Reviewed 91.43
PRK05636507 replicative DNA helicase; Provisional 91.4
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 91.33
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 91.3
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 91.0
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 90.99
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 90.9
COG1100219 GTPase SAR1 and related small G proteins [General funct 90.85
PRK13949169 shikimate kinase; Provisional 90.66
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 90.62
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 90.5
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 94.03
PRK09354350 recA recombinase A; Provisional 90.27
cd03114148 ArgK-like The function of this protein family is unkown 93.05
CHL00072271 chlL photochlorophyllide reductase subunit L 91.01
PRK12608379 transcription termination factor Rho; Provisional 90.71
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information