254780222

254780222

DNA topoisomerase IV subunit B

GeneID in NCBI database:8209203Locus tag:CLIBASIA_00535
Protein GI in NCBI database:254780222Protein Accession:YP_003064635.1
Gene range:+(108048, 110108)Protein Length:686aa
Gene description:DNA topoisomerase IV subunit B
COG prediction:[L] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit
KEGG prediction:DNA topoisomerase IV subunit B; K02622 topoisomerase IV subunit B [EC:5.99.1.-]
SEED prediction:Topoisomerase IV subunit B (EC 5.99.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA topoisomerases, Type II, ATP-dependent;
Resistance to fluoroquinolones
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680------
MTDDSIDLFSTLPPQSQGSSEKLKKSGEIPDSPAFANQSASDNYDASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKLRLPGKLADCSQNIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT
ccccccccccccccHHHHHccccccccccccccccccccccccccHHHEEHHccHHHHHccccEEEccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEccEEccccccccccccEEEEEEEEEEEEccccccccEEEEEEcccHHHHHHEEEccEEEEEEEEccEEEEEEEEccEEccccEEEcccccccccEEEEEEcHHHccccccccHHHHHHHHHHHHHHccccEEEEEEccccccccccccEEEEEcccHHHHHHHHHHccccccccccEEEEEccccccccEEEEEEEEEccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccEEEEEEEEEcccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccHHHHHcccccccEEEEEEccccccHHHccHHHHHcHHHHHHHHHHHcccccccccHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEEEEEccEEEEEccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcc
ccHHHHcHHHHcccccccccHHHHHHHHcccHHHHccHHHcccccHHccEEccccHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEEccccccccEEccHccEEHHHHHHHcccEEcccccccccccccccccHHHHHHHcEEEEEEEEEEccEEEEEEEEccEEccccEEEEccccccEEEEEEEEcHHHHcccccccHHHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEccccHHHHHHHHHccccccccccEEEEEcccccccccEEEEEEEEccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccccccccccccHHHcEEccccccEEEccHHHHHHHHccHHHHHHHHHHcccccccccHHHccEcEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEccccEEEEccHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHcccHcccEEEEEEHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc
mtddsidlfstlppqsqgsseklkksgeipdspafanqsasdnydassirileglepvrmrpgmyiggtdEKALHHLFSEVIDNAMDEVIAGYANLIEVsldgngfltvvdngrgipvenhpkfpnksTLEIILTTLhaggkfdnstyeisgglHGVGISVVNALSDELHVTVARQNTifsqkfsrgiplsplekkekvrnkrgtritfrpdpkifgdkaGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIaekygipekeefyfpgglkTYLQTKLEnrslisseiftgktekkgthrgTVEWAIAWCeenpeitsYCNTiltdeggthesGLRVALTRGIKKYAELTQNKRAISIISDDLMISAVGILSVfirepefagqtktkLVSLDAQRTVENalrdpfdhylvqnpiEATKLLEWVIERSEERLRRRKQREVNRKTAIRklrlpgkladcsqniahGTELFIVegdsaggsakqarnrsnqavlPLRGKILNVASAGSEKIRNNQQIMDLVQALgcrtrsqyreedLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHlflispplfritqgtksvyaHDEEHKQKILEEFKKhgkgkieiSRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT
mtddsidlfstlppqsqgssEKLKKSGEIPDSpafanqsasdnyDASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGipvenhpkfpnKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARqntifsqkfsrgiplsplekkekvrnkrgtritfrpdpkifgdKAGFDAARLLKMTqskaylsgrvktcWSCDKEIAEkygipekeefYFPGGLKTYLQTKLENRSLIsseiftgktekkgthrGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKraisiisddlmISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALrdpfdhylvqnpieatklLEWVIERseerlrrrkqrevnrktairklrlpgkladcsqnIAHGTELFIVEGDSAGGSAKQArnrsnqavlplrGKILNVASagsekirnnqQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILEefkkhgkgkieISRFKGLGEMLASQLKETAMDANKRTLLRVEINkdlnslkdtqdsINKLMGTKADERFKFIQERASFIDDVGT
MTDDSIDLFSTLPPQSQGSSEKLKKSGEIPDSPAFANQSASDNYDASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIerseerlrrrkqrevnrKTAIRKLRLPGKLADCSQNIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT
************************************************IRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEI*****IPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQ*****SIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKLRLPGKLADCSQNIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKIL**********IEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT
MTDDSIDLFSTLP***************IPDSPAFANQSASDNYDASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKLRLPGKLADCSQNIAHGTELFIVEGDS************NQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT
MTDDSIDLFSTLPPQSQGSSEKLKKSGEIPDSPAFANQSASDNYDASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVN*KT**RKLRLPGKLADCSQNIAHGTELFIVEGDS*********NRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDDSIDLFSTLPPQSQGSSEKLKKSGEIPDSPAFANQSASDNYDASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKLRLPGKLADCSQNIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT
MTDDSIDLFSTLPPQSQGSSEKLKKSGEIPDSPAFANQSASDNYDASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKLRLPGKLADCSQNIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT
MTDDSIDLFSTLPPQSQGSSEKLKKSGEIPDSPAFANQSASDNYDASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKLRLPGKLADCSQNIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target686 DNA topoisomerase IV subunit B [Candidatus Liberibacter
254780814 803 DNA gyrase subunit B [Candidatus Liberibacter asia 1e-115
254780814803 DNA gyrase subunit B [Candidatus Liberibacter asia 3e-09
>gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score =  407 bits (1045), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 257/655 (39%), Positives = 374/655 (57%), Gaps = 33/655 (5%)

Query: 43  NYDASSIRILEGLEPVRMRPGMYIGGTD-EKALHHLFSEVIDNAMDEVIAGYANLIEVSL 101
           +YDA SI+IL+GL+ V+ RP MYIG TD E  LHH+  EV+DNA+DE + GYA++I V+L
Sbjct: 9   SYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTL 68

Query: 102 DGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISV 161
           + +G  TV DNGRGIP + H K    S  E+I+T LHAGGKF+  +Y++SGGLHGVG+SV
Sbjct: 69  NMDGSCTVSDNGRGIPTDLH-KEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSV 127

Query: 162 VNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAG 221
           VNALS  L + + R+  I+   F  GI  +PL       N  GT +TF P   IF  +  
Sbjct: 128 VNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQ-D 186

Query: 222 FDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQ-TKLENR 280
           F+   L    +  ++L+  V+     DK   E    P +   ++ GG++ ++       +
Sbjct: 187 FNYDTLQHRLRELSFLNSSVQISL-IDKRSPE----PREITMFYKGGIEAFVSYLDRHKK 241

Query: 281 SLISSEIFTGKTEKKGTHRG-TVEWAIAWCEENPE-ITSYCNTILTDEGGTHESGLRVAL 338
            L+ S I       +G+    +++ A+ W +   E +  + N I   +GGTH SGLR AL
Sbjct: 242 PLMQSPI-----RIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSAL 296

Query: 339 TRGIKKYAE--LTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTV 396
           TR I  Y E      K   S+I DD       +LS+ + +P F+ QTK KLVS + +  V
Sbjct: 297 TRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVV 356

Query: 397 ENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKL-RLPGKLAD 455
           E+ + D    +L ++P+EA  +++ V++ S  R   R+ R++ R+  +  +  LPGKLAD
Sbjct: 357 ESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLAD 416

Query: 456 CSQNIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMD 515
           CS+     +ELF+VEGDSAGGSAKQ R+R NQA+LPLRGKILNV  A  +K+ ++Q+I  
Sbjct: 417 CSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGT 476

Query: 516 LVQALGCRT-RSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFL 574
           L+ ALG    +  +    LRY K+IIMTDADVDGAHI +LLLTFF+++M  LI    L++
Sbjct: 477 LITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYI 536

Query: 575 ISPPLFRITQGTKSVYAHDEEH------KQKILEEFKKHGKGKIEISR-----FKGLGEM 623
           I PPL+ IT+G    Y  DEE        Q + EE +     K  IS+     F      
Sbjct: 537 IKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALK 596

Query: 624 LASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERA 678
           +   +K+   + +K  + +  I+   N   D +  IN  + +K   R  FI E++
Sbjct: 597 IDKLIKDFYPNHDKTFIEQAVISGVFNCESDQE--INVSLASKLANRLNFIAEKS 649

>gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 600 ILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSI 659
           +L+     G+  I + R+KGLGEM ASQL ET ++ + R+LLRV+I           D  
Sbjct: 722 LLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKI----TDASQADDLF 777

Query: 660 NKLMGTKADERFKFIQERA 678
           ++LMG + + R +FIQE +
Sbjct: 778 SRLMGDEVEPRREFIQENS 796

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target686 DNA topoisomerase IV subunit B [Candidatus Liberibacter
315122338681 DNA topoisomerase IV subunit B [Candidatus Liberibacter 1 0.0
163760282697 DNA topoisomerase IV subunit B [Hoeflea phototrophica D 1 0.0
222086041689 DNA topoisomerase IV, B subunit [Agrobacterium radiobac 1 0.0
227821835685 DNA topoisomerase IV subunit B [Sinorhizobium fredii NG 1 0.0
239833957732 DNA topoisomerase IV, B subunit [Ochrobactrum intermedi 1 0.0
159184842710 DNA topoisomerase IV subunit B [Agrobacterium tumefacie 1 0.0
86357804660 DNA topoisomerase IV subunit B [Rhizobium etli CFN 42] 1 0.0
116252261700 DNA topoisomerase IV subunit B [Rhizobium leguminosarum 1 0.0
209549430704 DNA topoisomerase IV subunit B [Rhizobium leguminosarum 1 0.0
325293012706 DNA gyrase subunit B [Agrobacterium sp. H13-3] Length = 1 0.0
>gi|315122338|ref|YP_004062827.1| DNA topoisomerase IV subunit B [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 681 Back     alignment and organism information
 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/680 (84%), Positives = 632/680 (92%)

Query: 3   DDSIDLFSTLPPQSQGSSEKLKKSGEIPDSPAFANQSASDNYDASSIRILEGLEPVRMRP 62
           DDSIDLFSTLPPQ++ SS+K + S ++  +    N + SDNYDASSIRILEGLEPVRMRP
Sbjct: 2   DDSIDLFSTLPPQNKESSKKFEDSDKLDSTNIHKNHTVSDNYDASSIRILEGLEPVRMRP 61

Query: 63  GMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVENHP 122
           GMYIGGTDEKALHHLFSEVIDNAMDEVIAG+A+LIEVSLD NGFLTVVDNGRGIPV+NHP
Sbjct: 62  GMYIGGTDEKALHHLFSEVIDNAMDEVIAGHADLIEVSLDNNGFLTVVDNGRGIPVDNHP 121

Query: 123 KFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQ 182
           KFP+KSTLEII+T LHAGGKFD+STYEISGGLHGVGISVVNALSDEL VTV RQNT+FSQ
Sbjct: 122 KFPDKSTLEIIMTKLHAGGKFDSSTYEISGGLHGVGISVVNALSDELEVTVMRQNTVFSQ 181

Query: 183 KFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVK 242
           +FSRGIPL PLEK  KVRNKRGT I FRPDPKIFG+ A F+A+RL+K+T+SKAYLSGRVK
Sbjct: 182 RFSRGIPLGPLEKIGKVRNKRGTSIKFRPDPKIFGENASFNASRLVKITKSKAYLSGRVK 241

Query: 243 TCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTV 302
           T WSCDK+IAEKY IPEK EFYFPGGLKTYLQT+L+NRSLISSEIFTGKTE+KG++ G++
Sbjct: 242 TYWSCDKQIAEKYNIPEKTEFYFPGGLKTYLQTRLKNRSLISSEIFTGKTERKGSNPGSI 301

Query: 303 EWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQNKRAISIISDDL 362
           EWAIAWCEE+PEITSYCNTILTDEGG+HESGLRVALTRGI+KYAELTQNKRA  I SDD+
Sbjct: 302 EWAIAWCEEDPEITSYCNTILTDEGGSHESGLRVALTRGIRKYAELTQNKRAALITSDDI 361

Query: 363 MISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWV 422
           MISAVGILSVFI EPEFAGQTKTKLVS DAQR VENALRDPFDHYLV+NP+E TKLLEWV
Sbjct: 362 MISAVGILSVFIPEPEFAGQTKTKLVSFDAQRIVENALRDPFDHYLVKNPVETTKLLEWV 421

Query: 423 IERSEERLRRRKQREVNRKTAIRKLRLPGKLADCSQNIAHGTELFIVEGDSAGGSAKQAR 482
           IERSEERLRRRKQ+EVNRKTA+RKLRLPGKLADCSQN+A GTELFIVEGDSAGGSAKQAR
Sbjct: 422 IERSEERLRRRKQKEVNRKTAMRKLRLPGKLADCSQNMAKGTELFIVEGDSAGGSAKQAR 481

Query: 483 NRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLVQALGCRTRSQYREEDLRYEKVIIMT 542
           NR+NQA+LPLRGKILNVASAG EKIR +QQI DL+QALGCRTRSQYREEDLRYEKVIIMT
Sbjct: 482 NRNNQAILPLRGKILNVASAGLEKIRTSQQISDLIQALGCRTRSQYREEDLRYEKVIIMT 541

Query: 543 DADVDGAHIASLLLTFFYQEMYDLIEQKHLFLISPPLFRITQGTKSVYAHDEEHKQKILE 602
           DADVDGAHIASLLLTFFYQEMY LIEQKHLFL+SPPLFRITQG++S+YA DEEHKQ+IL+
Sbjct: 542 DADVDGAHIASLLLTFFYQEMYGLIEQKHLFLVSPPLFRITQGSRSIYARDEEHKQEILK 601

Query: 603 EFKKHGKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKL 662
           +F++ G+GKIEI+RFKGLGEMLASQLKETAMDA KRTLLRVE+  D  S + T+DSI+KL
Sbjct: 602 DFREKGRGKIEINRFKGLGEMLASQLKETAMDATKRTLLRVELCSDQESFEKTKDSIHKL 661

Query: 663 MGTKADERFKFIQERASFID 682
           MGTKADERFKFIQERA+F+D
Sbjct: 662 MGTKADERFKFIQERATFVD 681


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163760282|ref|ZP_02167365.1| DNA topoisomerase IV subunit B [Hoeflea phototrophica DFL-43] Length = 697 Back     alignment and organism information
>gi|222086041|ref|YP_002544573.1| DNA topoisomerase IV, B subunit [Agrobacterium radiobacter K84] Length = 689 Back     alignment and organism information
>gi|227821835|ref|YP_002825805.1| DNA topoisomerase IV subunit B [Sinorhizobium fredii NGR234] Length = 685 Back     alignment and organism information
>gi|239833957|ref|ZP_04682285.1| DNA topoisomerase IV, B subunit [Ochrobactrum intermedium LMG 3301] Length = 732 Back     alignment and organism information
>gi|159184842|ref|NP_354616.2| DNA topoisomerase IV subunit B [Agrobacterium tumefaciens str. C58] Length = 710 Back     alignment and organism information
>gi|86357804|ref|YP_469696.1| DNA topoisomerase IV subunit B [Rhizobium etli CFN 42] Length = 660 Back     alignment and organism information
>gi|116252261|ref|YP_768099.1| DNA topoisomerase IV subunit B [Rhizobium leguminosarum bv. viciae 3841] Length = 700 Back     alignment and organism information
>gi|209549430|ref|YP_002281347.1| DNA topoisomerase IV subunit B [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 704 Back     alignment and organism information
>gi|325293012|ref|YP_004278876.1| DNA gyrase subunit B [Agrobacterium sp. H13-3] Length = 706 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target686 DNA topoisomerase IV subunit B [Candidatus Liberibacter
PRK05559631 PRK05559, PRK05559, DNA topoisomerase IV subunit B; Rev 0.0
PRK05644638 PRK05644, gyrB, DNA gyrase subunit B; Validated 0.0
TIGR01059654 TIGR01059, gyrB, DNA gyrase, B subunit 0.0
TIGR01055625 TIGR01055, parE_Gneg, DNA topoisomerase IV, B subunit, 1e-178
TIGR01058637 TIGR01058, parE_Gpos, DNA topoisomerase IV, B subunit, 1e-134
COG0187635 COG0187, GyrB, Type IIA topoisomerase (DNA gyrase/topo 0.0
smart00433594 smart00433, TOP2c, TopoisomeraseII 0.0
PRK14939 756 PRK14939, gyrB, DNA gyrase subunit B; Provisional 1e-164
PTZ00109903 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional 1e-99
PTZ00108 1388 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; P 2e-33
KOG0355 842 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [C 8e-61
PLN03128 1135 PLN03128, PLN03128, DNA topoisomerase 2; Provisional 9e-35
PLN03237 1465 PLN03237, PLN03237, DNA topoisomerase 2; Provisional 3e-27
cd03366114 cd03366, TOPRIM_TopoIIA_GyrB, TOPRIM_TopoIIA_GyrB: topo 2e-44
cd01030115 cd01030, TOPRIM_TopoIIA_like, TOPRIM_TopoIIA_like: topo 7e-42
cd03365120 cd03365, TOPRIM_TopoIIA, TOPRIM_TopoIIA: topoisomerase- 4e-17
cd0018883 cd00188, TOPRIM, Topoisomerase-primase domain 2e-05
pfam0175189 pfam01751, Toprim, Toprim domain 0.001
cd00822172 cd00822, TopoII_Trans_DNA_gyrase, TopoIIA_Trans_DNA_gyr 2e-41
pfam00204173 pfam00204, DNA_gyraseB, DNA gyrase B 6e-37
PHA02569602 PHA02569, 39, DNA topoisomerase II large subunit; Provi 9e-20
pfam0098665 pfam00986, DNA_gyraseB_C, DNA gyrase B subunit, carboxy 3e-17
PRK14939756 PRK14939, gyrB, DNA gyrase subunit B; Provisional 2e-13
PTZ00109903 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional 2e-09
PHA02569602 PHA02569, 39, DNA topoisomerase II large subunit; Provi 1e-16
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, 2e-12
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPases 7e-12
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; This 2e-07
cd00329107 cd00329, TopoII_MutL_Trans, MutL_Trans: transducer doma 2e-04
>gnl|CDD|180127 PRK05559, PRK05559, DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>gnl|CDD|180181 PRK05644, gyrB, DNA gyrase subunit B; Validated Back     alignment and domain information
>gnl|CDD|162180 TIGR01059, gyrB, DNA gyrase, B subunit Back     alignment and domain information
>gnl|CDD|130127 TIGR01055, parE_Gneg, DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>gnl|CDD|130130 TIGR01058, parE_Gpos, DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>gnl|CDD|30536 COG0187, GyrB, Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|128710 smart00433, TOP2c, TopoisomeraseII Back     alignment and domain information
>gnl|CDD|184903 PRK14939, gyrB, DNA gyrase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|185452 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional Back     alignment and domain information
>gnl|CDD|185451 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|35576 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|178674 PLN03128, PLN03128, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|178775 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|173786 cd03366, TOPRIM_TopoIIA_GyrB, TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to the Escherichia coli GyrB subunit Back     alignment and domain information
>gnl|CDD|173780 cd01030, TOPRIM_TopoIIA_like, TOPRIM_TopoIIA_like: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II Back     alignment and domain information
>gnl|CDD|173785 cd03365, TOPRIM_TopoIIA, TOPRIM_TopoIIA: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II Back     alignment and domain information
>gnl|CDD|173773 cd00188, TOPRIM, Topoisomerase-primase domain Back     alignment and domain information
>gnl|CDD|145089 pfam01751, Toprim, Toprim domain Back     alignment and domain information
>gnl|CDD|48467 cd00822, TopoII_Trans_DNA_gyrase, TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E Back     alignment and domain information
>gnl|CDD|143961 pfam00204, DNA_gyraseB, DNA gyrase B Back     alignment and domain information
>gnl|CDD|177398 PHA02569, 39, DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>gnl|CDD|144542 pfam00986, DNA_gyraseB_C, DNA gyrase B subunit, carboxyl terminus Back     alignment and domain information
>gnl|CDD|184903 PRK14939, gyrB, DNA gyrase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|185452 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional Back     alignment and domain information
>gnl|CDD|177398 PHA02569, 39, DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>gnl|CDD|145582 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|128669 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|28956 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|73195 cd00329, TopoII_MutL_Trans, MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 686 DNA topoisomerase IV subunit B [Candidatus Liberibacter
TIGR01059818 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA top 100.0
PRK05644725 gyrB DNA gyrase subunit B; Validated 100.0
PRK05559633 DNA topoisomerase IV subunit B; Reviewed 100.0
COG0187635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topois 100.0
PTZ00109941 DNA gyrase subunit b; Provisional 100.0
TIGR01058655 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IP 100.0
PTZ00108 1506 DNA topoisomerase II; Provisional 100.0
TIGR01055647 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IP 100.0
KOG0355 842 consensus 100.0
smart00433594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomerase II, 100.0
cd03366114 TOPRIM_TopoIIA_GyrB TOPRIM_TopoIIA_GyrB: topoisomerase- 100.0
cd01030115 TOPRIM_TopoIIA_like TOPRIM_TopoIIA_like: topoisomerase- 100.0
cd03365120 TOPRIM_TopoIIA TOPRIM_TopoIIA: topoisomerase-primase (T 100.0
cd0018883 TOPRIM Topoisomerase-primase domain. This is a nucleoti 96.27
pfam0175189 Toprim Toprim domain. This is a conserved region from D 96.02
cd0102781 TOPRIM_RNase_M5_like TOPRIM_ RNase M5_like: The topoiso 90.7
pfam00204173 DNA_gyraseB DNA gyrase B. This family represents the se 100.0
cd00822172 TopoII_Trans_DNA_gyrase TopoIIA_Trans_DNA_gyrase: Trans 100.0
cd03481153 TopoIIA_Trans_ScTopoIIA TopoIIA_Trans_ScTopoIIA: Transd 99.97
pfam0098665 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus. 99.83
PRK04184533 DNA topoisomerase VI subunit B; Validated 99.54
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, recom 99.19
TIGR01052662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 99.28
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 98.51
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttranslation 97.54
PRK05218612 heat shock protein 90; Provisional 97.29
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 97.0
PTZ00130 824 heat shock protein 90; Provisional 96.93
KOG1979694 consensus 96.83
KOG1977 1142 consensus 95.15
PRK00095612 mutL DNA mismatch repair protein; Reviewed 99.01
KOG1978672 consensus 97.34
TIGR00585367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 98.36
cd00329107 TopoII_MutL_Trans MutL_Trans: transducer domain, having 98.33
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 98.19
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 98.17
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 98.1
PRK10755355 sensor protein BasS/PmrB; Provisional 97.25
COG3920221 Signal transduction histidine kinase [Signal transducti 97.07
PRK03660146 anti-sigma F factor; Provisional 96.71
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein kina 94.8
PRK04069158 serine-protein kinase RsbW; Provisional 94.78
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 93.71
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 93.56
PRK11466912 hybrid sensory histidine kinase TorS; Provisional 93.42
TIGR01386483 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR 93.35
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 92.8
PRK13560807 hypothetical protein; Provisional 97.63
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Signal 97.63
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 96.52
PRK11644497 sensory histidine kinase UhpB; Provisional 96.07
COG4585365 Signal transduction histidine kinase [Signal transducti 95.83
COG0642336 BaeS Signal transduction histidine kinase [Signal trans 94.23
PRK10337446 sensor protein QseC; Provisional 97.62
PRK10815484 sensor protein PhoQ; Provisional 97.18
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 96.29
COG3850574 NarQ Signal transduction histidine kinase, nitrate/nitr 96.94
PRK10490 895 sensor protein KdpD; Provisional 96.93
PRK10604433 sensor protein RstB; Provisional 96.78
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 96.54
PRK11100475 sensory histidine kinase CreC; Provisional 96.48
PRK09467437 envZ osmolarity sensor protein; Provisional 96.45
PRK09470461 cpxA two-component sensor protein; Provisional 96.67
COG5000712 NtrY Signal transduction histidine kinase involved in n 95.43
COG3290537 CitA Signal transduction histidine kinase regulating ci 96.6
PRK09835482 sensor kinase CusS; Provisional 96.07
PRK09303378 adaptive-response sensory kinase; Validated 96.57
PRK11360607 sensory histidine kinase AtoS; Provisional 96.14
KOG0787414 consensus 94.82
PRK13837 831 two-component VirA-like sensor kinase; Provisional 92.51
PRK10364455 sensor protein ZraS; Provisional 95.82
PRK10547662 chemotaxis protein CheA; Provisional 92.53
COG4191603 Signal transduction histidine kinase regulating C4-dica 95.1
COG3851497 UhpB Signal transduction histidine kinase, glucose-6-ph 92.68
PRK10841947 hybrid sensory kinase in two-component regulatory syste 92.53
PRK13557538 histidine kinase; Provisional 92.88
>TIGR01059 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IPR005740 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IPR005737 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>KOG0355 consensus Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>cd03366 TOPRIM_TopoIIA_GyrB TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to the Escherichia coli GyrB subunit Back     alignment and domain information
>cd01030 TOPRIM_TopoIIA_like TOPRIM_TopoIIA_like: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II Back     alignment and domain information
>cd03365 TOPRIM_TopoIIA TOPRIM_TopoIIA: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II Back     alignment and domain information
>cd00188 TOPRIM Topoisomerase-primase domain Back     alignment and domain information
>pfam01751 Toprim Toprim domain Back     alignment and domain information
>cd01027 TOPRIM_RNase_M5_like TOPRIM_ RNase M5_like: The topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain found in Ribonuclease M5: (RNase M5) and other small primase-like proteins from bacteria and archaea Back     alignment and domain information
>pfam00204 DNA_gyraseB DNA gyrase B Back     alignment and domain information
>cd00822 TopoII_Trans_DNA_gyrase TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E Back     alignment and domain information
>cd03481 TopoIIA_Trans_ScTopoIIA TopoIIA_Trans_ScTopoIIA: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topo IIA Back     alignment and domain information
>pfam00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005734 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>KOG1979 consensus Back     alignment and domain information
>KOG1977 consensus Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>KOG1978 consensus Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>cd00329 TopoII_MutL_Trans MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>pfam02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR006290 Members of this family contain a sensor histidine kinase domain (IPR003661 from INTERPRO) and a domain found in bacterial signal proteins (IPR003660 from INTERPRO) Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>KOG0787 consensus Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target686 DNA topoisomerase IV subunit B [Candidatus Liberibacter
1ei1_A391 Dimerization Of E. Coli Dna Gyrase B Provides A Str 4e-92
1s16_A390 Crystal Structure Of E. Coli Topoisomerase Iv Pare 8e-79
1kij_A390 Crystal Structure Of The 43k Atpase Domain Of Therm 8e-78
3lnu_A408 Crystal Structure Of Pare Subunit Length = 408 2e-77
1qzr_A418 Crystal Structure Of The Atpase Region Of Saccharom 1e-47
1zxm_A400 Human Topo Iia AtpaseAMP-Pnp Length = 400 6e-47
1pvg_A418 Crystal Structure Of The Atpase Region Of Saccharom 1e-45
2xcr_B 726 The 3.5a Crystal Structure Of The Catalytic Core (B 2e-81
2xco_A 726 The 3.1a Crystal Structure Of The Catalytic Core (B 2e-81
3foe_C268 Structural Insight Into The Quinolone-Dna Cleavage 3e-72
2zjt_A247 Crystal Structure Of Dna Gyrase B' Domain Sheds Lig 1e-66
2xkk_A 767 Crystal Structure Of Moxifloxacin, Dna, And A. Baum 3e-66
2xkj_E 767 Crystal Structure Of Catalytic Core Of A. Baumannii 3e-66
3ig0_A242 Crystal Structure Of The Second Part Of The Mycobac 2e-65
2xcs_B 692 The 2.1a Crystal Structure Of S. Aureus Gyrase Comp 2e-63
3l4j_A 722 Topoisomerase Ii-Dna Cleavage Complex, Apo Length = 1e-42
2rgr_A 759 Topoisomerase Iia Bound To G-Segment Dna Length = 7 4e-41
1bgw_A 793 Topoisomerase Residues 410-1202 Length = 793 4e-41
1aj6_A219 Novobiocin-Resistant Mutant (R136h) Of The N-Termin 2e-73
3g7e_A203 Crystal Structure Of E. Coli Gyrase B Co-Complexed 1e-67
1kzn_A205 Crystal Structure Of E. Coli 24kda Domain In Comple 2e-67
3fv5_A201 Crystal Structure Of E. Coli Topoisomerase Iv Co-Co 2e-56
3g75_A184 Crystal Structure Of Staphylococcus Aureus Gyrase B 6e-50
1s14_A194 Crystal Structure Of Escherichia Coli Topoisomerase 5e-47
3nuh_B 420 A Domain Insertion In E. Coli Gyrb Adopts A Novel F 1e-40
3nuh_B420 A Domain Insertion In E. Coli Gyrb Adopts A Novel F 5e-25
>gi|7546302|pdb|1EI1|A Chain A, Dimerization Of E. Coli Dna Gyrase B Provides A Structural Mechanism For Activating The Atpase Catalytic Center Length = 391 Back     alignment and structure
 Score =  344 bits (881), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 137/380 (36%), Positives = 216/380 (56%), Gaps = 16/380 (4%)

Query: 49  IRILEGLEPVRMRPGMYIGGTDE-KALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFL 107
           I++L+GL+ VR RPGMYIG TD+   LHH+  EV+DNA+DE +AG+   I V++  +  +
Sbjct: 9   IKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSV 68

Query: 108 TVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSD 167
           +V D+GRGIP   HP+    S  E+I+T LHAGGKFD+++Y++SGGLHGVG+SVVNALS 
Sbjct: 69  SVQDDGRGIPTGIHPE-EGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQ 127

Query: 168 ELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGFDAARL 227
           +L + + R+  I  Q +  G+P +PL    +     GT + F P  + F +   F+   L
Sbjct: 128 KLELVIQREGKIHRQIYEHGVPQAPLAVTGETEK-TGTMVRFWPSLETFTNVTEFEYEIL 186

Query: 228 LKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRSLISSEI 287
            K  +  ++L   V       ++  E       + F++ GG+K +++   +N++ I   I
Sbjct: 187 AKRLRELSFLDSGVSIRLRDKRDGKE-------DHFHYEGGIKAFVEYLNKNKTPIHPNI 239

Query: 288 FTGKTEKKGTHRGTVEWAIAWCEEN-PEITSYCNTILTDEGGTHESGLRVALTRGIKKYA 346
           F   TEK G     VE A+ W +     I  + N I   +GGTH +G R A+TR +  Y 
Sbjct: 240 FYFSTEKDGI---GVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYM 296

Query: 347 ELTQ--NKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPF 404
           +      K  +S   DD     + ++SV + +P+F+ QTK KLVS + +  VE  + +  
Sbjct: 297 DKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELL 356

Query: 405 DHYLVQNPIEATKLLEWVIE 424
             YL++NP +A  ++  +I+
Sbjct: 357 AEYLLENPTDAKIVVGKIID 376


>gi|48425515|pdb|1S16|A Chain A, Crystal Structure Of E. Coli Topoisomerase Iv Pare 43kda Subunit Complexed With Adpnp Length = 390 Back     alignment and structure
>gi|21465844|pdb|1KIJ|A Chain A, Crystal Structure Of The 43k Atpase Domain Of Thermus Thermophilus Gyrase B In Complex With Novobiocin Length = 390 Back     alignment and structure
>gi|323462873|pdb|3LNU|A Chain A, Crystal Structure Of Pare Subunit Length = 408 Back     alignment and structure
>gi|37928124|pdb|1QZR|A Chain A, Crystal Structure Of The Atpase Region Of Saccharomyces Cerevisiae Topoisomerase Ii Bound To Icrf-187 (Dexrazoxane) Length = 418 Back     alignment and structure
>gi|75765928|pdb|1ZXM|A Chain A, Human Topo Iia AtpaseAMP-Pnp Length = 400 Back     alignment and structure
>gi|34810356|pdb|1PVG|A Chain A, Crystal Structure Of The Atpase Region Of Saccharomyces Cerevisiae Topoisomerase Ii Length = 418 Back     alignment and structure
>gi|302148634|pdb|2XCR|B Chain B, The 3.5a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Complexed With Gsk299423 And Dna Length = 726 Back     alignment and structure
>gi|302148632|pdb|2XCO|A Chain A, The 3.1a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Length = 726 Back     alignment and structure
>gi|224036404|pdb|3FOE|C Chain C, Structural Insight Into The Quinolone-Dna Cleavage Complex Of Type Iia Topoisomerases Length = 268 Back     alignment and structure
>gi|224983399|pdb|2ZJT|A Chain A, Crystal Structure Of Dna Gyrase B' Domain Sheds Lights On The Mechanism For T-Segment Navigation Length = 247 Back     alignment and structure
>gi|305677638|pdb|2XKK|A Chain A, Crystal Structure Of Moxifloxacin, Dna, And A. Baumannii Topo Iv (Pare-Parc Fusion Truncate) Length = 767 Back     alignment and structure
>gi|305677637|pdb|2XKJ|E Chain E, Crystal Structure Of Catalytic Core Of A. Baumannii Topo Iv (Pare-Parc Fusion Truncate) Length = 767 Back     alignment and structure
>gi|301598497|pdb|3IG0|A Chain A, Crystal Structure Of The Second Part Of The Mycobacterium Tuberculosis Dna Gyrase Reaction Core: The Toprim Domain At 2.1 A Resolution Length = 242 Back     alignment and structure
>gi|302148642|pdb|2XCS|B Chain B, The 2.1a Crystal Structure Of S. Aureus Gyrase Complex With Gsk299423 And Dna Length = 692 Back     alignment and structure
>gi|297039743|pdb|3L4J|A Chain A, Topoisomerase Ii-Dna Cleavage Complex, Apo Length = 722 Back     alignment and structure
>gi|163931058|pdb|2RGR|A Chain A, Topoisomerase Iia Bound To G-Segment Dna Length = 759 Back     alignment and structure
>gi|157830305|pdb|1BGW|A Chain A, Topoisomerase Residues 410-1202 Length = 793 Back     alignment and structure
>gi|157829905|pdb|1AJ6|A Chain A, Novobiocin-Resistant Mutant (R136h) Of The N-Terminal 24 Kda Fragment Of Dna Gyrase B Complexed With Novobiocin At 2.3 Angstroms Resolution Length = 219 Back     alignment and structure
>gi|288562964|pdb|3G7E|A Chain A, Crystal Structure Of E. Coli Gyrase B Co-Complexed With Inhibitor Length = 203 Back     alignment and structure
>gi|21730596|pdb|1KZN|A Chain A, Crystal Structure Of E. Coli 24kda Domain In Complex With Clorobiocin Length = 205 Back     alignment and structure
>gi|284793877|pdb|3FV5|A Chain A, Crystal Structure Of E. Coli Topoisomerase Iv Co-Complexed With Inhibitor Length = 201 Back     alignment and structure
>gi|288562960|pdb|3G75|A Chain A, Crystal Structure Of Staphylococcus Aureus Gyrase B Co- Complexed With Inhibitor Length = 184 Back     alignment and structure
>gi|48425513|pdb|1S14|A Chain A, Crystal Structure Of Escherichia Coli Topoisomerase Iv Pare 24kda Subunit Length = 194 Back     alignment and structure
>gi|302566245|pdb|3NUH|B Chain B, A Domain Insertion In E. Coli Gyrb Adopts A Novel Fold That Plays A Critical Role In Gyrase Function Length = 420 Back     alignment and structure
>gi|302566245|pdb|3NUH|B Chain B, A Domain Insertion In E. Coli Gyrb Adopts A Novel Fold That Plays A Critical Role In Gyrase Function Length = 420 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target686 DNA topoisomerase IV subunit B [Candidatus Liberibacter
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HE 1e-118
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coumarin 1e-100
1s16_A390 Topoisomerase IV subunit B; two-domain protein complexe 8e-85
1pvg_A418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 7e-75
3cwv_A369 DNA gyrase, B subunit, truncated; structural genomics, 7e-62
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; G 8e-48
2xkj_E 767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 2e-74
3k9f_C268 DNA topoisomerase 4 subunit B; quinolone, topoisomerase 9e-61
2xcs_B 692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 8e-55
1bjt_A 793 Topoisomerase II; quaternary change, DNA-binding, DNA t 1e-54
3m4i_A242 DNA gyrase subunit B; GYRB, toprim, type II topoisomera 6e-65
2zjt_A247 DNA gyrase subunit B; GYRB-CTD, toprim, tail, DNA topoi 9e-55
3l4j_A 757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 1e-56
3nuh_B 420 DNA gyrase subunit B; topoisomerase, supercoiling, spec 1e-56
3nuh_B420 DNA gyrase subunit B; topoisomerase, supercoiling, spec 2e-19
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B subun 3e-56
3g7e_A203 DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {E 4e-55
3g75_A184 DNA gyrase subunit B; antibiotic resistance, isomerase; 2e-44
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 8e-52
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 5e-24
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 5e-12
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein homolog 6e-06
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatc 8e-06
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA repa 7e-08
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Esc 0.001
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Length = 391 Back     alignment and structure
 Score =  420 bits (1082), Expect = e-118
 Identities = 145/402 (36%), Positives = 232/402 (57%), Gaps = 16/402 (3%)

Query: 41  SDNYDASSIRILEGLEPVRMRPGMYIGGTDE-KALHHLFSEVIDNAMDEVIAGYANLIEV 99
           S++ D+SSI++L+GL+ VR RPGMYIG TD+   LHH+  EV+DNA+DE +AG+   I V
Sbjct: 1   SNSSDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIV 60

Query: 100 SLDGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGI 159
           ++  +  ++V D+GRGIP   HP+    S  E+I+T LHAGGKFD+++Y++SGGLHGVG+
Sbjct: 61  TIHADNSVSVQDDGRGIPTGIHPE-EGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGV 119

Query: 160 SVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDK 219
           SVVNALS +L + + R+  I  Q +  G+P +PL    +   K GT + F P  + F + 
Sbjct: 120 SVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETE-KTGTMVRFWPSLETFTNV 178

Query: 220 AGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLEN 279
             F+   L K  +  ++L   V       ++        +++ F++ GG+K +++   +N
Sbjct: 179 TEFEYEILAKRLRELSFLDSGVSIRLRDKRD-------GKEDHFHYEGGIKAFVEYLNKN 231

Query: 280 RSLISSEIFTGKTEKKGTHRGTVEWAIAWCEE-NPEITSYCNTILTDEGGTHESGLRVAL 338
           ++ I   IF   TEK G     VE A+ W +     I  + N I   +GGTH +G R A+
Sbjct: 232 KTPIHPNIFYFSTEKDGI---GVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAM 288

Query: 339 TRGIKKYAELTQN--KRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTV 396
           TR +  Y +      K  +S   DD     + ++SV + +P+F+ QTK KLVS + +  V
Sbjct: 289 TRTLNAYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAV 348

Query: 397 ENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREV 438
           E  + +    YL++NP +A  ++  +I+ +  R   R+ RE+
Sbjct: 349 EQQMNELLAEYLLENPTDAKIVVGKIIDAARAREAARRAREM 390


>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Length = 390 Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Length = 390 Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Length = 418 Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, ATP-binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus dk 1622} Length = 369 Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Length = 400 Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Length = 767 Back     alignment and structure
>3k9f_C DNA topoisomerase 4 subunit B; quinolone, topoisomerase, protein-DNA cleavage complex; HET: DNA LFX; 2.90A {Streptococcus pneumoniae} PDB: 3fof_C* 3foe_C* Length = 268 Back     alignment and structure
>2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xcr_B* 2xcq_A* 2xco_A* Length = 692 Back     alignment and structure
>1bjt_A Topoisomerase II; quaternary change, DNA-binding, DNA topology; 2.50A {Saccharomyces cerevisiae} SCOP: e.11.1.1 PDB: 1bgw_A 2rgr_A* Length = 793 Back     alignment and structure
>3m4i_A DNA gyrase subunit B; GYRB, toprim, type II topoisomerase, tuberculosi quinolone binding site, DNA binding site, ATP-binding; HET: DNA; 1.95A {Mycobacterium tuberculosis} PDB: 3ig0_A* 2zjt_A* Length = 242 Back     alignment and structure
>2zjt_A DNA gyrase subunit B; GYRB-CTD, toprim, tail, DNA topoisomerase II, G- segment, T-segment, ATP-binding, nucleotide-binding; HET: DNA; 2.80A {Mycobacterium tuberculosis} Length = 247 Back     alignment and structure
>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Length = 757 Back     alignment and structure
>3nuh_B DNA gyrase subunit B; topoisomerase, supercoiling, specialization, isomera; HET: DNA; 3.10A {Escherichia coli} Length = 420 Back     alignment and structure
>3nuh_B DNA gyrase subunit B; topoisomerase, supercoiling, specialization, isomera; HET: DNA; 3.10A {Escherichia coli} Length = 420 Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Length = 201 Back     alignment and structure
>3g7e_A DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {Escherichia coli} PDB: 1kzn_A* 1aj6_A* Length = 203 Back     alignment and structure
>3g75_A DNA gyrase subunit B; antibiotic resistance, isomerase; HET: DNA B48; 2.30A {Staphylococcus aureus} PDB: 3g7b_A* Length = 184 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Length = 348 Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Length = 365 Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367 Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Length = 333 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target686 DNA topoisomerase IV subunit B [Candidatus Liberibacter
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HE 100.0
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coumarin 100.0
1s16_A390 Topoisomerase IV subunit B; two-domain protein complexe 100.0
1pvg_A418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 100.0
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; G 100.0
3cwv_A369 DNA gyrase, B subunit, truncated; structural genomics, 100.0
3nuh_B420 DNA gyrase subunit B; topoisomerase, supercoiling, spec 100.0
2xkj_E 767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 100.0
3k9f_C268 DNA topoisomerase 4 subunit B; quinolone, topoisomerase 100.0
3m4i_A242 DNA gyrase subunit B; GYRB, toprim, type II topoisomera 100.0
3l4j_A 757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 100.0
2xcs_B 692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 100.0
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B subun 100.0
3g7e_A203 DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {E 100.0
3g75_A184 DNA gyrase subunit B; antibiotic resistance, isomerase; 100.0
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA repa 99.56
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatc 99.41
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein homolog 99.39
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 99.0
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Esc 98.97
2cg9_A677 ATP-dependent molecular chaperone HSP82; chaperone comp 98.19
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP- 98.09
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, cytopl 98.05
1uyl_A236 HSP 86, heat shock protein HSP 90-alpha; ATPase, chaper 98.0
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycle, ca 97.9
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone, ATP 97.75
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, liga 97.72
3peh_A281 Endoplasmin homolog; structural genomics, structural ge 97.71
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 3.50 97.66
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; HET: 97.46
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1 97.46
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 100.0
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 99.69
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kin 97.63
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif r 97.62
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; 97.58
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, 97.33
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-bind 97.26
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase domain, A 97.25
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; 97.22
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, transf 97.14
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding domain, 97.05
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein (ENVZ 96.88
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduction, 96.69
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 96.56
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, selenom 96.48
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine kina 94.46
3ied_A272 Heat shock protein; HSP90, chaperone, structural genomi 97.62
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-sigma f 96.84
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, transf 96.21
1ixm_A192 SPO0B, protein (sporulation response regulatory protein 95.14
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, GHL AT 95.05
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 95.95
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
Probab=100.00  E-value=0  Score=897.12  Aligned_cols=386  Identities=38%  Similarity=0.656  Sum_probs=363.1

Q ss_pred             CCCCCHHHEEECCCCHHHHCCCCEEECCCCC-CCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEEECCCCCCCC
Q ss_conf             1236975602311210343269815467775-502202443666678777618997699998289839999669843444
Q gi|254780222|r   41 SDNYDASSIRILEGLEPVRMRPGMYIGGTDE-KALHHLFSEVIDNAMDEVIAGYANLIEVSLDGNGFLTVVDNGRGIPVE  119 (686)
Q Consensus        41 ~~~Y~~~~i~~L~glE~VrkRP~mYIGst~~-~GL~~i~~EIldNavDe~~~g~~~~I~V~i~~dg~IsV~ddGrGIPv~  119 (686)
                      +++|||++||+|+||||||+|||||||||+. +|||||||||||||+||++||||++|+|+|++||+|||+||||||||+
T Consensus         1 ~~~~d~~~i~~L~~lE~Vr~RP~mYiGs~~~~~Gl~~i~~Eil~Na~De~~~g~~~~I~V~i~~dgsisV~ddGrGIPv~   80 (391)
T 1ei1_A            1 SNSSDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTG   80 (391)
T ss_dssp             CCCCSGGGCEECCTTHHHHHCTHHHHCCSSSSHHHHHHHHHHHHHHHHHHHTTCCCEEEEEECTTSCEEEEECSSCCCCS
T ss_pred             CCCCCHHHCEEECCCHHHHCCCCCEECCCCCCCCCEEEEEEEEECHHHHHCCCCCCEEEEEECCCCEEEEEECCCCCCCC
T ss_conf             99789777846035227762998876468988722068888888432352149986799999279829999799867677


Q ss_pred             CCCCCCCCEEEEEEEEEEECCCCCCCCCEEEECCCCCHHHHHHHHEEEEEEEEEECCCEEEEEEEECCCEECCCEECCCC
Q ss_conf             17665787012345452002477777741563144538898762032126999941883899997279451131121676
Q gi|254780222|r  120 NHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKV  199 (686)
Q Consensus       120 ~h~k~~~~~~~Elif~~L~aggnfdd~~yk~sgGlnGvGaklvNalS~~f~Vev~r~gk~y~q~f~~g~~~~~~~~i~~~  199 (686)
                      +||+ +++|+||||||+||||||||+++|++||||||||||||||||++|+|+++|+|+.|+|+|++||+..++++++++
T Consensus        81 ~h~~-~~~~~~Elif~~L~tg~nfd~~~~~~sgG~nGvGakl~NalS~~f~v~~~~~gk~~~q~f~~g~~~~~~~~~~~~  159 (391)
T 1ei1_A           81 IHPE-EGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGET  159 (391)
T ss_dssp             BCTT-TSSBHHHHHHHSTTEESCSSSSSCSSCSCCSSCHHHHHHHTEEEEEEEEEETTEEEEEEEETTEESSCCEEEEEC
T ss_pred             CCCC-CCCCEEEEEEEEEECCCCCCCCCCEEECCCCCCCEEEEEEEECCEEEEEEECCEEEEEEEECCEECCCCEEECCC
T ss_conf             7666-685100899999713677799874331688765427999961555999996998999998099397884050575


Q ss_pred             CCCCCEEEEEEECHHHEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCEEEEEECCCCHHHHHCCCCC
Q ss_conf             77885399999842432001222289999988887530577359995164532224554112343158612221002467
Q gi|254780222|r  200 RNKRGTRITFRPDPKIFGDKAGFDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLEN  279 (686)
Q Consensus       200 ~~k~GT~ItF~PD~~iFg~~~~~d~~~l~~rl~~~A~L~~gl~i~~~~~~~~~~~~~~~~~~~f~~~~Gi~dyv~~~~~~  279 (686)
                       +++||+|+|+||+++|+....++.+.|.+|++++|||+|||+|.|++++.       +....|+|++||++|+++++..
T Consensus       160 -~~~gT~I~F~PD~~~F~~~~~~~~~~l~~r~~~~A~l~~gl~i~~~d~~~-------~~~~~~~~~~gl~~~~~~l~~~  231 (391)
T 1ei1_A          160 -EKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLDSGVSIRLRDKRD-------GKEDHFHYEGGIKAFVEYLNKN  231 (391)
T ss_dssp             -SCCEEEEEEEECTTTCCSCCSCCHHHHHHHHHHHHHHSTTCEEEEEETTT-------CCEEEECCCSHHHHHHHHHHHT
T ss_pred             -CCCCCEEEEEECHHHHCCCCCCCHHHHHHHHHHHHCCCCCCEEEEEEECC-------CCEEEEECCCCHHHHHHHHCCC
T ss_conf             -78975899997978817865566999999999985508997799996047-------8268887076499999986258


Q ss_pred             CCCCCCCCEEEEEEECCCEEEEEEEEEEECCCCCC-EEEEEEECCCCCCCEEECCHHHHHHHHHHHHHHHCC--CCCCCC
Q ss_conf             76667752033332148015589998541467774-278883000655752413046789999998763018--833222
Q gi|254780222|r  280 RSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPE-ITSYCNTILTDEGGTHESGLRVALTRGIKKYAELTQ--NKRAIS  356 (686)
Q Consensus       280 ~~~~~~~~~~~~~~~~~~~~~~veval~~~~~~~~-~~SFVN~I~T~~GGTHv~g~~~ai~k~i~~~~~~~~--~kk~~~  356 (686)
                      ..++++.++....+.+.   +.|+||++|++++.+ ++||||+|+|++|||||+||+++|+++|++|+++.+  ++++.+
T Consensus       232 ~~~~~~~~~~~~~~~~~---~~veva~~~~~~~~~~~~SfVN~I~T~~GGTHv~g~~~~l~~~i~~~~~k~~~~k~~~~~  308 (391)
T 1ei1_A          232 KTPIHPNIFYFSTEKDG---IGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKAKVS  308 (391)
T ss_dssp             SCBSSSCCEEEEEEETT---EEEEEEEEEBSSCCEEEEEEETTEECTTCBHHHHHHHHHHHHHHHHHHHHTTHHHHHCCC
T ss_pred             CCCCCCCCEEEEEEECC---EEEEEEEEECCCCCEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             87679976899976578---289999984488836899986322489997979999999999999998775440123456


Q ss_pred             CCCCCCCCCEEEEEEEEEEHHHCCCCCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             33222236426999977634560764466202523200001210158899977401356889999999999654544334
Q gi|254780222|r  357 IISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQR  436 (686)
Q Consensus       357 i~~~dIk~~L~~~Isv~I~nP~FesQTKekL~s~~~~~~v~~~i~~~l~~~l~~n~~~a~~I~~~~~~~a~~r~~~~k~k  436 (686)
                      ++++||+++|++||+|+|+||+|+||||++|+||++++++++.+++.|..||++||..++.|++++++++++|++|+++|
T Consensus       309 ~~~~~Ik~~l~~~vs~~i~nP~F~sQTKekL~s~~~~~~v~~~v~~~l~~~l~~n~~~a~~I~~k~i~~a~ar~~a~kar  388 (391)
T 1ei1_A          309 ATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREAARRAR  388 (391)
T ss_dssp             CCHHHHTTTEEEEEEEECSSCCBSSTTCCSBCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88889970949999998589967782017636974787889999999999999797999999999999999999998877


Q ss_pred             HH
Q ss_conf             44
Q gi|254780222|r  437 EV  438 (686)
Q Consensus       437 ~~  438 (686)
                      ++
T Consensus       389 el  390 (391)
T 1ei1_A          389 EM  390 (391)
T ss_dssp             TT
T ss_pred             CC
T ss_conf             04