254780223

254780223

ABC transporter permease

GeneID in NCBI database:8209204Locus tag:CLIBASIA_00540
Protein GI in NCBI database:254780223Protein Accession:YP_003064636.1
Gene range:+(110290, 111372)Protein Length:360aa
Gene description:ABC transporter permease
COG prediction:[R] Predicted permease
KEGG prediction:ABC transporter permease
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED7 TM-Helix
HMMTOP7 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS7 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MRETMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENKEKISSNF
ccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccEEcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
mretmlnpqGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFtswpiyssfiskkeessTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANqhgipvprwlsdipggmwaselwtkhlshpqslkiLSETFlktngidfiprfASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAmipggapiSFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDktlrpflvggpiklpflptffglvggvrtMGLLGLFIGPVLMALIAVIWKESIMAIKENKEKISSNF
mretmlnpQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENkekissnf
MRETMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENKEKISSNF
***********MRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKES***************
MRETMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENKEKISSNF
***TMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIK**********
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRETMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENKEKISSNF
MRETMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENKEKISSNF
MRETMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENKEKISSNF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target360 ABC transporter permease [Candidatus Liberibacter asiat
315122337361 ABC transporter permease [Candidatus Liberibacter solan 1 1e-143
227820705391 predicted transmembrane protein [Sinorhizobium fredii N 1 1e-95
307306991391 protein of unknown function UPF0118 [Sinorhizobium meli 1 2e-93
195970204436 ABC transporter permease [Sinorhizobium meliloti 1021] 1 3e-93
260466876413 protein of unknown function UPF0118 [Mesorhizobium oppo 1 2e-91
13476905411 hypothetical protein mlr8361 [Mesorhizobium loti MAFF30 1 3e-91
150395339391 hypothetical protein Smed_0111 [Sinorhizobium medicae W 1 8e-91
319784191401 hypothetical protein Mesci_4507 [Mesorhizobium ciceri b 1 3e-90
222149993349 permease [Agrobacterium vitis S4] Length = 349 1 3e-90
325293121412 permease [Agrobacterium sp. H13-3] Length = 412 1 1e-89
>gi|315122337|ref|YP_004062826.1| ABC transporter permease [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 361 Back     alignment and organism information
 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 261/356 (73%), Positives = 296/356 (83%), Gaps = 2/356 (0%)

Query: 1   MRETMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSWPIYSSFISKKEESST 60
           MRE +LNPQ IMRW I+FI+L  +YFLKGFFAPVL+ALIIGF SWPIYS FISK+E+S T
Sbjct: 1   MREIILNPQRIMRWTIIFIVLACIYFLKGFFAPVLTALIIGFASWPIYSLFISKEEKSFT 60

Query: 61  FLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGIPVPRWLSDIPGG-MWA 119
             A IAT++V+ LFI+PLLF  YY  LE+K L S V L N+ GIP P WLS IPGG +WA
Sbjct: 61  LEATIATLTVILLFIIPLLFFSYYTTLEIKNLASYVALVNEKGIPKPSWLSHIPGGGVWA 120

Query: 120 SELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDYCLSIIFMIIALFFFYR 179
             LWTK+LS PQSL  L+E  L TNG  F  +F S F     DY LSIIFM+IALFFFYR
Sbjct: 121 G-LWTKYLSPPQSLMTLTENILTTNGTQFTLKFVSYFSNCIFDYLLSIIFMLIALFFFYR 179

Query: 180 DGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIAIGEGLVLGSAYWLAGVP 239
           DG S+S QLDSLG +L P YW+KISRI+P+VIRSTF+GMT+IAIGEGLVLGSAYW+AGVP
Sbjct: 180 DGLSMSLQLDSLGGYLLPVYWEKISRIIPRVIRSTFVGMTVIAIGEGLVLGSAYWIAGVP 239

Query: 240 SHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCLFLWGAIELFIVDKTLRPF 299
           S+ ALGVITAIMAMIPGGAP+SFT VSIYL+IKG+I NA  LF WGAIELFIVDKTLRPF
Sbjct: 240 SYTALGVITAIMAMIPGGAPVSFTVVSIYLVIKGSITNAILLFSWGAIELFIVDKTLRPF 299

Query: 300 LVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAVIWKESIMAIKENKEK 355
           LVGGPI+LPFLPTFFGLVGGVRTMGLLGLFIGPV+MAL+ VIWKESI+AI+EN  K
Sbjct: 300 LVGGPIRLPFLPTFFGLVGGVRTMGLLGLFIGPVIMALMTVIWKESILAIRENNLK 355


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820705|ref|YP_002824675.1| predicted transmembrane protein [Sinorhizobium fredii NGR234] Length = 391 Back     alignment and organism information
>gi|307306991|ref|ZP_07586730.1| protein of unknown function UPF0118 [Sinorhizobium meliloti BL225C] Length = 391 Back     alignment and organism information
>gi|195970204|ref|NP_384592.2| ABC transporter permease [Sinorhizobium meliloti 1021] Length = 436 Back     alignment and organism information
>gi|260466876|ref|ZP_05813060.1| protein of unknown function UPF0118 [Mesorhizobium opportunistum WSM2075] Length = 413 Back     alignment and organism information
>gi|13476905|ref|NP_108474.1| hypothetical protein mlr8361 [Mesorhizobium loti MAFF303099] Length = 411 Back     alignment and organism information
>gi|150395339|ref|YP_001325806.1| hypothetical protein Smed_0111 [Sinorhizobium medicae WSM419] Length = 391 Back     alignment and organism information
>gi|319784191|ref|YP_004143667.1| hypothetical protein Mesci_4507 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 401 Back     alignment and organism information
>gi|222149993|ref|YP_002550950.1| permease [Agrobacterium vitis S4] Length = 349 Back     alignment and organism information
>gi|325293121|ref|YP_004278985.1| permease [Agrobacterium sp. H13-3] Length = 412 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target360 ABC transporter permease [Candidatus Liberibacter asiat
pfam01594327 pfam01594, UPF0118, Domain of unknown function DUF20 2e-17
TIGR02872341 TIGR02872, spore_ytvI, sporulation integral membrane pr 9e-05
COG0628355 COG0628, PerM, Predicted permease [General function pre 6e-23
PRK10983368 PRK10983, PRK10983, putative inner membrane protein; Pr 2e-07
>gnl|CDD|110588 pfam01594, UPF0118, Domain of unknown function DUF20 Back     alignment and domain information
>gnl|CDD|163054 TIGR02872, spore_ytvI, sporulation integral membrane protein YtvI Back     alignment and domain information
>gnl|CDD|30973 COG0628, PerM, Predicted permease [General function prediction only] Back     alignment and domain information
>gnl|CDD|182881 PRK10983, PRK10983, putative inner membrane protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 360 ABC transporter permease [Candidatus Liberibacter asiat
COG0628355 yhhT Predicted permease, member of the PurR regulon [Ge 100.0
pfam01594327 UPF0118 Domain of unknown function DUF20. This transmem 100.0
PRK10983363 putative inner membrane protein; Provisional 100.0
PRK12287344 tqsA putative transport protein; Reviewed 100.0
TIGR02872350 spore_ytvI sporulation integral membrane protein YtvI; 100.0
COG0628355 yhhT Predicted permease, member of the PurR regulon [Ge 99.32
pfam01594327 UPF0118 Domain of unknown function DUF20. This transmem 99.12
KOG2365808 consensus 99.46
PRK12287344 tqsA putative transport protein; Reviewed 98.95
TIGR02872350 spore_ytvI sporulation integral membrane protein YtvI; 98.19
PRK10983363 putative inner membrane protein; Provisional 97.99
>COG0628 yhhT Predicted permease, member of the PurR regulon [General function prediction only] Back     alignment and domain information
>pfam01594 UPF0118 Domain of unknown function DUF20 Back     alignment and domain information
>PRK10983 putative inner membrane protein; Provisional Back     alignment and domain information
>PRK12287 tqsA putative transport protein; Reviewed Back     alignment and domain information
>TIGR02872 spore_ytvI sporulation integral membrane protein YtvI; InterPro: IPR014227 This entry contains the sporulation protein YtvI Back     alignment and domain information
>COG0628 yhhT Predicted permease, member of the PurR regulon [General function prediction only] Back     alignment and domain information
>pfam01594 UPF0118 Domain of unknown function DUF20 Back     alignment and domain information
>KOG2365 consensus Back     alignment and domain information
>PRK12287 tqsA putative transport protein; Reviewed Back     alignment and domain information
>TIGR02872 spore_ytvI sporulation integral membrane protein YtvI; InterPro: IPR014227 This entry contains the sporulation protein YtvI Back     alignment and domain information
>PRK10983 putative inner membrane protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00