254780226

254780226

translation-associated GTPase

GeneID in NCBI database:8209207Locus tag:CLIBASIA_00555
Protein GI in NCBI database:254780226Protein Accession:YP_003064639.1
Gene range:+(113918, 115021)Protein Length:367aa
Gene description:translation-associated GTPase
COG prediction:[J] Predicted GTPase, probable translation factor
KEGG prediction:translation-associated GTPase; K06942
SEED prediction:GTP-binding and nucleic acid-binding protein YchF
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Universal GTPases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------
MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIVKDGDILHFRFNV
cccEEEEEEcccccHHHHHHHHHcccccccccccccEEEEEEEEEEcccccccHHHcccccccccccEEEEEEccccccccccccHHHHHHHHHHHHccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHHHHHccccEEEEEHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHcEEEEEEEEHHHHHHcccHHHHHHcccEEEcccEEEEccccEEEEEEcc
ccccccEEccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccccccEEEEEEHHHHHHcccccccccHHHHHHHHHHccEEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHcccEEEEEEHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHEcccccEEEEEEEccccccccccEEEcccccccEEEEEEEEHHHHHHcccHHHHHHccccEEcccEEEEEcccEEEEEEcc
mgfkcgiiglpnvgkstLFNALTRTAsaqaanypfctiepnsgevavpdprmhKLAEIaeskdlvptrmsfvDIAGlvrgaskgeglgNQFLAHIREVDAIIHVLRCfkdeniihvegridpindieTIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVRSLLesldsdaipifkslnlltakpilyicnvsehdckkgniYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITyftvgpketrawtiprgtnaqkaAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKardegkeyivkdgdiLHFRFNV
mgfkcgiiglpnvGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEiaeskdlvptrMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDEniihvegridpindieTIETELMLSDLERLERLFEKNkkyrnhkseeiVLLQSIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPketrawtiprgtnaqKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAkeagkardegkeyivkdgdilhfrfnv
MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLERLFEKNKKYRNHKseeivllqsiissslrlieeGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNaemiiisaaieaeisQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVamggenaakeagkaRDEGKEYIVKDGDILHFRFNV
*GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLER*****************LLQSIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIVKDGDILHFRFNV
MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGEN***********GKEYIVKDGDILHFRFNV
*GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIVKDGDILHFRFNV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIVKDGDILHFRFNV
MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIVKDGDILHFRFNV
MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIVKDGDILHFRFNV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target367 translation-associated GTPase [Candidatus Liberibacter
254780648335 GTPase ObgE [Candidatus Liberibacter asiaticus str 4e-12
255764471 470 GTP-binding protein EngA [Candidatus Liberibacter 6e-05
254780809440 tRNA modification GTPase TrmE [Candidatus Liberiba 0.005
>gi|254780648|ref|YP_003065061.1| GTPase ObgE [Candidatus Liberibacter asiaticus str. psy62] Length = 335 Back     alignment 
 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 19/108 (17%)

Query: 6   GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLV 65
           GIIGLPN GKST   ++TR A  + A+YPF T+ PN G V                K+ +
Sbjct: 163 GIIGLPNAGKSTFLASVTR-AKPKIADYPFTTLYPNLGIVK------------EGYKEFI 209

Query: 66  PTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENI 113
                  DI G+++ A +G G+G++FL H      ++H++    +EN+
Sbjct: 210 -----LADIPGIIKNAHQGAGIGDRFLKHTERTHVLLHIVSAL-EENV 251
>gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Back     alignment 
 Score = 40.0 bits (92), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 1  MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCT 37
          M +   I+G PNVGKSTLFN L +   A   N+P  T
Sbjct: 1  MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGIT 37
>gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Back     alignment 
 Score = 33.5 bits (75), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 2   GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCT 37
           G+K  I+G  N GKS+LFNAL +   A   + P  T
Sbjct: 219 GYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTT 254

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target367 translation-associated GTPase [Candidatus Liberibacter
315122334367 translation-associated GTPase [Candidatus Liberibacter 1 0.0
150397466367 GTP-dependent nucleic acid-binding protein EngD [Sinorh 1 1e-156
15966110367 translation-associated GTPase [Sinorhizobium meliloti 1 1 1e-155
241205735367 GTP-dependent nucleic acid-binding protein EngD [Rhizob 1 1e-154
86282735431 putative GTP-binding protein [Rhizobium etli CFN 42] Le 1 1e-153
162329633367 translation-associated GTPase [Rhizobium etli CFN 42] L 1 1e-153
190892774367 putative GTP-binding protein [Rhizobium etli CIAT 652] 1 1e-153
218674103367 translation-associated GTPase [Rhizobium etli GR56] Len 1 1e-153
116253221371 GTP-dependent nucleic acid-binding protein EngD [Rhizob 1 1e-153
209550350367 GTP-dependent nucleic acid-binding protein EngD [Rhizob 1 1e-153
>gi|315122334|ref|YP_004062823.1| translation-associated GTPase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 367 Back     alignment and organism information
 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/367 (88%), Positives = 353/367 (96%)

Query: 1   MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAE 60
           MGFKCGI+GLPNVGKSTLFNALTRTA+AQAANYPFCTIEPNSGEVAVPDPRMHKLAEIA+
Sbjct: 1   MGFKCGIVGLPNVGKSTLFNALTRTATAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAK 60

Query: 61  SKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRI 120
           SKDLVPT MSF+DIAG+VRGASKGEGLGNQFLA+IREVDAIIHVLRCF DENIIHVEGRI
Sbjct: 61  SKDLVPTSMSFIDIAGIVRGASKGEGLGNQFLANIREVDAIIHVLRCFDDENIIHVEGRI 120

Query: 121 DPINDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVR 180
           +PINDIETIETELMLSDLERLERLFEKNKK++NHKSE I L QSIISSSLRLIEEGK VR
Sbjct: 121 NPINDIETIETELMLSDLERLERLFEKNKKHKNHKSENIQLTQSIISSSLRLIEEGKTVR 180

Query: 181 SLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMIII 240
           SLL+SLDSDA+ IFKS NLLTAKP+LYICNVSE DCKKGN++TEA+Q+LA+QQNAEMIII
Sbjct: 181 SLLQSLDSDALSIFKSFNLLTAKPMLYICNVSESDCKKGNMHTEAIQKLATQQNAEMIII 240

Query: 241 SAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWTIP 300
           SAAIE EISQLPEEERALFME+L +S+SGLELLIRSGYRLLDLITYFTVGPKETRAWTI 
Sbjct: 241 SAAIEEEISQLPEEERALFMEDLGVSVSGLELLIRSGYRLLDLITYFTVGPKETRAWTIL 300

Query: 301 RGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIVKDGDI 360
           RGTNAQKAAG IH+DFE+GFIRALTISY+DY+AMGGE AAKE+GKARDEGK+YIVKDGDI
Sbjct: 301 RGTNAQKAAGFIHSDFERGFIRALTISYEDYIAMGGERAAKESGKARDEGKDYIVKDGDI 360

Query: 361 LHFRFNV 367
           +HFRFNV
Sbjct: 361 MHFRFNV 367



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397466|ref|YP_001327933.1| GTP-dependent nucleic acid-binding protein EngD [Sinorhizobium medicae WSM419] Length = 367 Back     alignment and organism information
>gi|15966110|ref|NP_386463.1| translation-associated GTPase [Sinorhizobium meliloti 1021] Length = 367 Back     alignment and organism information
>gi|241205735|ref|YP_002976831.1| GTP-dependent nucleic acid-binding protein EngD [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 367 Back     alignment and organism information
>gi|86282735|gb|ABC91798.1| putative GTP-binding protein [Rhizobium etli CFN 42] Length = 431 Back     alignment and organism information
>gi|162329633|ref|YP_470525.2| translation-associated GTPase [Rhizobium etli CFN 42] Length = 367 Back     alignment and organism information
>gi|190892774|ref|YP_001979316.1| putative GTP-binding protein [Rhizobium etli CIAT 652] Length = 367 Back     alignment and organism information
>gi|218674103|ref|ZP_03523772.1| translation-associated GTPase [Rhizobium etli GR56] Length = 367 Back     alignment and organism information
>gi|116253221|ref|YP_769059.1| GTP-dependent nucleic acid-binding protein EngD [Rhizobium leguminosarum bv. viciae 3841] Length = 371 Back     alignment and organism information
>gi|209550350|ref|YP_002282267.1| GTP-dependent nucleic acid-binding protein EngD [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 367 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target367 translation-associated GTPase [Candidatus Liberibacter
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed 0.0
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provisional 1e-137
KOG1491391 KOG1491, KOG1491, KOG1491, Predicted GTP-binding protei 1e-105
TIGR00092368 TIGR00092, TIGR00092, GTP-binding protein YchF 1e-100
PRK09602396 PRK09602, PRK09602, translation-associated GTPase; Revi 2e-34
COG1163365 COG1163, DRG, Predicted GTPase [General function predic 1e-14
COG0012372 COG0012, COG0012, Predicted GTPase, probable translatio 1e-136
cd01900274 cd01900, YchF, YchF subfamily 1e-115
cd01881176 cd01881, Obg_like, The Obg-like subfamily consists of f 5e-46
pfam0607184 pfam06071, YchF-GTPase_C, Protein of unknown function ( 2e-43
cd0486783 cd04867, TGS_YchF_C, TGS_YchF_C: This subfamily represe 8e-40
cd0493876 cd04938, TGS_Obg-like, TGS_Obg-like: The C-terminal TGS 4e-10
cd0161660 cd01616, TGS, The TGS domain, named after the ThrRS, GT 1e-06
cd01899318 cd01899, Ygr210, Ygr210 subfamily 5e-29
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 2e-24
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 1e-22
cd01898170 cd01898, Obg, Obg subfamily 1e-20
COG0536369 COG0536, Obg, Predicted GTPase [General function predic 2e-20
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 8e-20
PRK12296500 PRK12296, obgE, GTPase CgtA; Reviewed 3e-19
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 9e-18
cd01896233 cd01896, DRG, The developmentally regulated GTP-binding 2e-16
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 2e-16
KOG1487358 KOG1487, KOG1487, KOG1487, GTP-binding protein DRG1 (OD 3e-07
COG2262411 COG2262, HflX, GTPases [General function prediction onl 6e-05
KOG1489366 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protei 9e-14
cd00880163 cd00880, Era_like, Era (E 1e-12
KOG1486364 KOG1486, KOG1486, KOG1486, GTP-binding protein DRG2 (OD 8e-10
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 2e-06
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [Inorgan 2e-05
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 9e-05
COG1159298 COG1159, Era, GTPase [General function prediction only] 6e-04
cd01878204 cd01878, HflX, HflX subfamily 0.002
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 5e-06
cd01879158 cd01879, FeoB, Ferrous iron transport protein B (FeoB) 6e-06
cd01894157 cd01894, EngA1, EngA1 subfamily 7e-06
cd01856171 cd01856, YlqF, YlqF 2e-05
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 2e-05
PRK00089292 PRK00089, era, GTPase Era; Reviewed 3e-05
pfam02421188 pfam02421, FeoB_N, Ferrous iron transport protein B 5e-05
cd01897168 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein p 6e-05
cd04163168 cd04163, Era, Era subfamily 1e-04
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding 2e-04
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed 3e-04
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 3e-04
cd04164157 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain pr 4e-04
COG1161322 COG1161, COG1161, Predicted GTPases [General function p 4e-04
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 4e-04
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase Trm 6e-04
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 8e-04
COG0486454 COG0486, ThdF, Predicted GTPase [General function predi 0.001
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 0.001
COG1084346 COG1084, COG1084, Predicted GTPase [General function pr 0.002
cd01849155 cd01849, YlqF_related_GTPase, YlqF-related GTPases 0.002
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 0.002
PRK09554 772 PRK09554, feoB, ferrous iron transport protein B; Revie 0.002
cd04178172 cd04178, Nucleostemin_like, Nucleostemin-like 0.004
>gnl|CDD|181981 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|185530 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|36704 KOG1491, KOG1491, KOG1491, Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|129200 TIGR00092, TIGR00092, GTP-binding protein YchF Back     alignment and domain information
>gnl|CDD|181982 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|31357 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|30362 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133300 cd01900, YchF, YchF subfamily Back     alignment and domain information
>gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|114773 pfam06071, YchF-GTPase_C, Protein of unknown function (DUF933) Back     alignment and domain information
>gnl|CDD|133440 cd04867, TGS_YchF_C, TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown Back     alignment and domain information
>gnl|CDD|133441 cd04938, TGS_Obg-like, TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF Back     alignment and domain information
>gnl|CDD|133435 cd01616, TGS, The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information
>gnl|CDD|133299 cd01899, Ygr210, Ygr210 subfamily Back     alignment and domain information
>gnl|CDD|183415 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|162989 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|133298 cd01898, Obg, Obg subfamily Back     alignment and domain information
>gnl|CDD|30882 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|183417 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|183414 PRK12296, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|133296 cd01896, DRG, The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>gnl|CDD|183416 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|36700 KOG1487, KOG1487, KOG1487, GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|36702 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|36699 KOG1486, KOG1486, KOG1486, GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|30719 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133279 cd01878, HflX, HflX subfamily Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|133280 cd01879, FeoB, Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily Back     alignment and domain information
>gnl|CDD|57927 cd01856, YlqF, YlqF Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|145523 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|133297 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>gnl|CDD|133363 cd04163, Era, Era subfamily Back     alignment and domain information
>gnl|CDD|163345 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|179996 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|133364 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>gnl|CDD|31355 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|161878 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|30833 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|31281 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|57924 cd01849, YlqF_related_GTPase, YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|181948 PRK09554, feoB, ferrous iron transport protein B; Reviewed Back     alignment and domain information
>gnl|CDD|57931 cd04178, Nucleostemin_like, Nucleostemin-like Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 367 translation-associated GTPase [Candidatus Liberibacter
PRK09601364 translation-associated GTPase; Reviewed 100.0
PTZ00258392 GTP-binding protein; Provisional 100.0
TIGR00092390 TIGR00092 GTP-binding protein YchF; InterPro: IPR004396 100.0
COG0012372 Predicted GTPase, probable translation factor [Translat 100.0
KOG1491391 consensus 100.0
PRK09602396 translation-associated GTPase; Reviewed 100.0
COG1163365 DRG Predicted GTPase [General function prediction only] 100.0
KOG1486364 consensus 99.98
KOG1487358 consensus 99.94
cd01900274 YchF YchF subfamily. YchF is a member of the Obg family 100.0
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg-like 100.0
cd01896233 DRG The developmentally regulated GTP-binding protein ( 100.0
PRK12297429 obgE GTPase ObgE; Reviewed 100.0
PRK12298380 obgE GTPase ObgE; Reviewed 100.0
PRK12299334 obgE GTPase ObgE; Reviewed 100.0
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 99.98
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 99.96
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 99.87
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.56
PRK12296495 obgE GTPase ObgE; Reviewed 100.0
KOG1489366 consensus 99.96
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 98.71
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 98.59
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 98.57
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 98.36
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 98.35
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 98.35
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 98.32
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 98.29
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 98.23
cd04123162 Rab21 Rab21 subfamily. The localization and function of 98.23
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 98.21
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 98.21
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 98.21
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 98.2
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 98.17
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 98.17
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 98.17
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 98.16
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 98.15
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 98.15
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 98.14
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 98.14
KOG0073185 consensus 98.12
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 98.12
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 98.12
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 98.11
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 98.11
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 98.11
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 98.1
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 98.09
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 98.07
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 98.07
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 98.07
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 98.07
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 98.04
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 98.03
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 98.02
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 98.01
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 97.99
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 97.99
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 97.98
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 97.98
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 97.98
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 97.98
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 97.98
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 97.97
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 97.97
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 97.95
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 97.94
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 97.94
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 97.93
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 97.93
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 97.92
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 97.92
PTZ00132209 GTP-binding nuclear protein; Provisional 97.88
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 97.83
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 97.79
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily o 96.86
KOG0078207 consensus 96.62
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 95.55
KOG0394210 consensus 94.17
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 93.26
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 91.81
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 90.99
TIGR02729296 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014 100.0
COG0536369 Obg Predicted GTPase [General function prediction only] 100.0
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 99.89
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 99.86
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 99.84
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 99.84
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 99.83
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 99.83
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 99.8
PRK00089296 era GTP-binding protein Era; Reviewed 99.79
COG1160444 Predicted GTPases [General function prediction only] 99.75
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.73
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.71
PRK04213195 GTP-binding protein; Provisional 99.7
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.7
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.7
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.68
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.65
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.63
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.61
PRK11058426 putative GTPase HflX; Provisional 99.61
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.6
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.59
COG1159298 Era GTPase [General function prediction only] 99.57
COG2262411 HflX GTPases [General function prediction only] 99.44
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 99.4
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.39
pfam01926106 MMR_HSR1 GTPase of unknown function. 99.39
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 99.38
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.35
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.29
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 99.23
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 99.23
COG0486454 ThdF Predicted GTPase [General function prediction only 99.22
KOG1490 620 consensus 99.07
COG1160444 Predicted GTPases [General function prediction only] 99.04
cd04105203 SR_beta Signal recognition particle receptor, beta subu 99.04
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.01
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.0
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 98.99
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 98.97
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 98.97
KOG1423379 consensus 98.95
cd00881189 GTP_translation_factor GTP translation factor family. T 98.94
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 98.9
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 98.82
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 98.81
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 98.81
PTZ00133182 ADP-ribosylation factor; Provisional 98.78
KOG0410410 consensus 98.76
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 98.75
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 98.73
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 98.73
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 98.71
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 98.7
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 98.7
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 98.69
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 98.65
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 98.59
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 98.58
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 98.43
pfam00350168 Dynamin_N Dynamin family. 98.36
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 98.07
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 97.95
KOG0090238 consensus 97.88
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 97.81
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 97.79
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 97.78
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 97.77
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 97.6
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 97.42
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 97.38
KOG0075186 consensus 97.09
CHL00189 770 infB translation initiation factor 2; Provisional 96.99
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 96.97
PRK12312 610 infB translation initiation factor IF-2; Provisional 96.91
PRK05306 839 infB translation initiation factor IF-2; Validated 96.85
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 96.81
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 96.77
KOG0074185 consensus 96.72
KOG0070181 consensus 96.65
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 96.45
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 96.37
PRK05433 601 GTP-binding protein LepA; Provisional 96.29
PRK04000410 translation initiation factor IF-2 subunit gamma; Valid 96.29
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 96.15
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 96.14
PRK12735396 elongation factor Tu; Reviewed 96.0
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 95.89
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 95.87
KOG0084205 consensus 95.79
PRK00741 526 prfC peptide chain release factor 3; Provisional 95.72
PRK00049397 elongation factor Tu; Reviewed 95.61
KOG0076197 consensus 95.54
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 95.43
PRK13351 687 elongation factor G; Reviewed 95.37
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.15
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 95.08
PTZ00141443 elongation factor 1 alpha; Provisional 94.66
KOG0468 971 consensus 94.4
KOG0462 650 consensus 94.24
CHL00071409 tufA elongation factor Tu 94.22
PRK12317426 elongation factor 1-alpha; Reviewed 94.2
PRK12736394 elongation factor Tu; Reviewed 93.81
PRK00007 693 elongation factor G; Reviewed 93.61
PTZ00327460 eukaryotic translation initiation factor 2 gamma subuni 93.59
PTZ00336449 elongation factor 1-alpha; Provisional 93.57
PRK12739 693 elongation factor G; Reviewed 93.2
PRK07560 730 elongation factor EF-2; Reviewed 93.13
PRK10218 607 GTP-binding protein; Provisional 92.61
KOG0091213 consensus 91.47
KOG1707 625 consensus 90.85
pfam0607184 YchF-GTPase_C Protein of unknown function (DUF933). Thi 100.0
cd0486783 TGS_YchF_C TGS_YchF_C: This subfamily represents TGS do 100.0
cd0493876 TGS_Obg-like TGS_Obg-like: The C-terminal TGS domain of 99.72
cd0166976 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of 99.71
cd0166675 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP 99.25
cd0161660 TGS The TGS domain, named after the ThrRS, GTPase, and 98.89
cd0166860 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, a 98.67
pfam0282460 TGS TGS domain. The TGS domain is named after ThrRS, GT 98.6
TIGR00691 741 spoT_relA RelA/SpoT family protein; InterPro: IPR004811 98.56
PRK11092 702 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bi 98.56
PRK10872 743 relA GDP/GTP pyrophosphokinase; Provisional 98.5
COG0317 701 SpoT Guanosine polyphosphate pyrophosphohydrolases/synt 98.42
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 99.83
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 99.83
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 99.69
PRK00454196 engB GTPase EngB; Reviewed 99.6
KOG1191531 consensus 98.96
KOG1424562 consensus 98.43
KOG2484435 consensus 98.42
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 98.04
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-envelope 98.0
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 97.99
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 97.93
COG1100219 GTPase SAR1 and related small G proteins [General funct 97.78
TIGR00475 627 selB selenocysteine-specific translation elongation fac 97.76
KOG2423572 consensus 97.74
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 97.7
pfam05049375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 97.67
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 97.67
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 97.55
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 97.5
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 97.47
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 97.37
COG3596296 Predicted GTPase [General function prediction only] 97.3
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 97.16
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 97.12
KOG2485335 consensus 97.02
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 96.94
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 96.85
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 96.66
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 96.49
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 96.44
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 96.23
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 96.19
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 96.15
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 96.14
TIGR00993 772 3a0901s04IAP86 chloroplast protein import component Toc 96.1
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 96.1
KOG1954532 consensus 96.07
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 95.88
KOG0395196 consensus 95.3
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represents Ara 95.28
KOG0448 749 consensus 95.17
PRK10512 615 selenocysteinyl-tRNA-specific translation factor; Provi 94.05
PRK04004 592 translation initiation factor IF-2; Validated 93.63
TIGR00991328 3a0901s02IAP34 GTP-binding protein; InterPro: IPR005688 92.71
PRK07261171 topology modulation protein; Provisional 92.18
COG1341398 Predicted GTPase or GTP-binding protein [General functi 91.92
PRK08118167 topology modulation protein; Reviewed 91.82
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 91.44
KOG0092200 consensus 91.42
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 99.49
COG1084346 Predicted GTPase [General function prediction only] 99.46
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 98.93
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 98.87
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 98.86
PRK09563282 rbgA ribosomal biogenesis GTPase; Reviewed 98.84
COG1161322 Predicted GTPases [General function prediction only] 98.82
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to the hu 98.81
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 98.26
COG0218200 Predicted GTPase [General function prediction only] 98.06
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 95.53
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 94.86
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 94.78
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 94.62
COG5019373 CDC3 Septin family protein [Cell division and chromosom 93.65
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 92.6
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 92.21
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 98.9
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 98.83
PRK13796367 GTP-binding protein YqeH; Provisional 98.06
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 97.39
TIGR00650123 MG442 GTP-binding conserved hypothetical protein; Inter 97.33
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 96.4
PRK13695174 putative NTPase; Provisional 96.3
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 96.27
COG0488 530 Uup ATPase components of ABC transporters with duplicat 96.14
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.13
COG4172 534 ABC-type uncharacterized transport system, duplicated A 95.78
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate vesicl 95.58
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 95.42
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.41
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.38
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 95.36
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.21
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.2
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 95.18
PRK13768253 GTPase; Provisional 95.11
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.1
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 95.02
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 95.01
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 94.98
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 94.97
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 94.97
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 94.88
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 94.85
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 94.84
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 94.83
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 94.82
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 94.81
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 94.8
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 94.73
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 94.73
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.72
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 94.7
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 94.68
PRK10790593 putative multidrug transporter membrane\ATP-binding com 94.63
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 94.57
PRK09435325 arginine/ornithine transport system ATPase; Provisional 94.54
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 94.51
PRK11147 632 ABC transporter ATPase component; Reviewed 94.48
PRK10789569 putative multidrug transporter membrane\ATP-binding com 94.47
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.45
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.44
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 94.43
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.4
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 94.37
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 94.27
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 94.23
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 94.22
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.19
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.16
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 94.14
KOG0054 1381 consensus 94.13
PRK11147632 ABC transporter ATPase component; Reviewed 94.1
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 94.1
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 94.1
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 94.08
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 94.05
cd03246173 ABCC_Protease_Secretion This family represents the ABC 94.03
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 94.01
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 94.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 93.96
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 93.96
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 93.94
cd03234226 ABCG_White The White subfamily represents ABC transport 93.92
KOG0057591 consensus 93.91
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 93.86
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 93.83
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 93.81
PRK00081199 coaE dephospho-CoA kinase; Reviewed 93.8
PRK13544208 consensus 93.78
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 93.75
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 93.75
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 93.74
pfam04317443 DUF463 YcjX-like family, DUF463. Some members of this f 93.73
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 93.71
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 93.7
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 93.68
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 93.68
PRK08356195 hypothetical protein; Provisional 93.62
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.61
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 93.59
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 93.57
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 93.56
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 93.56
PRK10636638 putative ABC transporter ATP-binding protein; Provision 93.54
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 93.53
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 93.5
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 93.48
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 93.47
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 93.43
KOG1249572 consensus 93.41
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 93.4
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 93.39
PRK13542224 consensus 93.36
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.33
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 93.31
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 93.3
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 93.29
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 93.25
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 93.24
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 93.24
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.24
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 93.23
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 93.23
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 93.22
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 93.21
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 93.2
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.2
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 93.19
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 93.16
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.16
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 93.16
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 93.14
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 93.13
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 93.12
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 93.11
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 93.1
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 93.1
PTZ00243 1560 ABC transporter; Provisional 93.09
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 93.08
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.08
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 93.07
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 93.04
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 93.01
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 93.01
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.01
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 93.01
pfam03266168 DUF265 Protein of unknown function, DUF265. 92.99
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 92.97
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 92.97
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 92.97
PRK09984262 phosphonate/organophosphate ester transporter subunit; 92.9
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 92.88
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 92.86
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 92.86
cd03116159 MobB Molybdenum is an essential trace element in the fo 92.85
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 92.85
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 92.83
PRK10908222 cell division protein FtsE; Provisional 92.82
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 92.82
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 92.81
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.81
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.81
PRK03695245 vitamin B12-transporter ATPase; Provisional 92.8
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 92.79
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 92.78
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 92.74
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 92.71
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 92.71
COG4988559 CydD ABC-type transport system involved in cytochrome b 92.64
PRK13409 590 putative ATPase RIL; Provisional 92.54
COG4987573 CydC ABC-type transport system involved in cytochrome b 92.52
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 92.52
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 92.51
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 92.38
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 92.38
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 92.3
PRK09700510 D-allose transporter ATP-binding protein; Provisional 92.2
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 92.2
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.19
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 92.19
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 92.17
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 92.13
PRK13543