254780225

254780225

peptidyl-tRNA hydrolase

GeneID in NCBI database:8209206Locus tag:CLIBASIA_00550
Protein GI in NCBI database:254780225Protein Accession:YP_003064638.1
Gene range:+(113144, 113713)Protein Length:189aa
Gene description:peptidyl-tRNA hydrolase
COG prediction:[J] Peptidyl-tRNA hydrolase
KEGG prediction:pth; peptidyl-tRNA hydrolase (EC:3.1.1.29); K01056 peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
SEED prediction:Peptidyl-tRNA hydrolase (EC 3.1.1.29)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Translation termination factors bacterial;
Cell division-ribosomal stress proteins cluster;
Sporulation-associated proteins with broader functions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSFLNHIVSVRK
cEEEEEcccccHHHHcccccHHHHHHHHHHHHHccccccccEEEEEEEEEEccEEEEEEEccccccccHHHHHHHHHHcccccHHHEEEEEEcccccccEEEEEccccccccccHHHHHHHHcccccEEEEEEcccccccccEEHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccc
cEEEEEcccccHHHHHcHcHHHHHHHHHHHHHccccccHcccEEEEEEEEEcccEEEEEEcccHccccHHHHHHHHHHHccccHHHEEEEEEEcccccccEEEEEcccccccHHHHHHHHHcccccccEEEEEEccccccccHHHEcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccc
mfivaglgnpgheycenrhnigfmcidrihsfhffpawKKKFHAEISEGQLDGLRTilikpqtfmnlsgQSLLEVMnfyklpnlenylvihddldldfgtlrlktgggdaghnglKSISEKcgknykrlrigigrppdtAHIIRHVlgnfssperyfllPIIDNIARSLpllakredvSFLNHIVSVRK
mfivaglgnpghEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTgggdaghnglksisEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLlakredvsflnhivsvrk
MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSFLNHIVSVRK
MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSFLNHIV****
MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSFLNHIVSVRK
MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSFLNHIVS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSFLNHIVSVRK
MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSFLNHIVSVRK
MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSFLNHIVSVRK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
315122335196 peptidyl-tRNA hydrolase [Candidatus Liberibacter solana 1 2e-75
49473973193 peptidyl-tRNA hydrolase [Bartonella quintana str. Toulo 1 3e-50
319898491192 Peptidyl-tRNA hydrolase [Bartonella clarridgeiae 73] Le 1 7e-50
319403818197 Peptidyl-tRNA hydrolase [Bartonella rochalimae ATCC BAA 1 3e-49
319406825196 Peptidyl-tRNA hydrolase [Bartonella sp. 1-1C] Length = 1 2e-48
319405259197 Peptidyl-tRNA hydrolase [Bartonella sp. AR 15-3] Length 1 3e-48
312114467 713 peptidyl-tRNA hydrolase [Rhodomicrobium vannielii ATCC 1 4e-46
121602644193 peptidyl-tRNA hydrolase [Bartonella bacilliformis KC583 1 2e-45
209550347243 peptidyl-tRNA hydrolase [Rhizobium leguminosarum bv. tr 1 4e-45
110634507239 peptidyl-tRNA hydrolase [Mesorhizobium sp. BNC1] Length 1 7e-45
>gi|315122335|ref|YP_004062824.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 196 Back     alignment and organism information
 Score =  285 bits (730), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 159/186 (85%), Gaps = 1/186 (0%)

Query: 1   MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIK 60
           MFIVAGLGNPG+EY ENRHNIGFMC+DRIHSFH FP+WKKKF AEISE  LD +R IL+K
Sbjct: 1   MFIVAGLGNPGNEYSENRHNIGFMCVDRIHSFHSFPSWKKKFSAEISEKHLDDIRIILLK 60

Query: 61  PQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISE 120
           PQTFMNLSG+SL+EV+NFYKL +L+N L+IHD+LDL  G LRLKTGGGDAGHNGLKSISE
Sbjct: 61  PQTFMNLSGKSLIEVINFYKL-SLQNCLIIHDELDLSLGILRLKTGGGDAGHNGLKSISE 119

Query: 121 KCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSF 180
           KCGKNYKRLRIGIGRP +  ++I+HVL +F   E+  L PI+DNIAR +PLL K+ED  F
Sbjct: 120 KCGKNYKRLRIGIGRPQNKEYVIKHVLSDFYPSEQSVLFPILDNIARHIPLLVKKEDDLF 179

Query: 181 LNHIVS 186
           LN++V 
Sbjct: 180 LNYVVQ 185


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|49473973|ref|YP_032015.1| peptidyl-tRNA hydrolase [Bartonella quintana str. Toulouse] Length = 193 Back     alignment and organism information
>gi|319898491|ref|YP_004158584.1| Peptidyl-tRNA hydrolase [Bartonella clarridgeiae 73] Length = 192 Back     alignment and organism information
>gi|319403818|emb|CBI77402.1| Peptidyl-tRNA hydrolase [Bartonella rochalimae ATCC BAA-1498] Length = 197 Back     alignment and organism information
>gi|319406825|emb|CBI80458.1| Peptidyl-tRNA hydrolase [Bartonella sp. 1-1C] Length = 196 Back     alignment and organism information
>gi|319405259|emb|CBI78870.1| Peptidyl-tRNA hydrolase [Bartonella sp. AR 15-3] Length = 197 Back     alignment and organism information
>gi|312114467|ref|YP_004012063.1| peptidyl-tRNA hydrolase [Rhodomicrobium vannielii ATCC 17100] Length = 713 Back     alignment and organism information
>gi|121602644|ref|YP_989278.1| peptidyl-tRNA hydrolase [Bartonella bacilliformis KC583] Length = 193 Back     alignment and organism information
>gi|209550347|ref|YP_002282264.1| peptidyl-tRNA hydrolase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 243 Back     alignment and organism information
>gi|110634507|ref|YP_674715.1| peptidyl-tRNA hydrolase [Mesorhizobium sp. BNC1] Length = 239 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
PRK05426189 PRK05426, PRK05426, peptidyl-tRNA hydrolase; Provisiona 4e-66
COG0193190 COG0193, Pth, Peptidyl-tRNA hydrolase [Translation, rib 6e-58
cd00462171 cd00462, PTH, Peptidyl-tRNA hydrolase (PTH) is a monome 8e-55
TIGR00447188 TIGR00447, pth, peptidyl-tRNA hydrolase 2e-42
cd02406191 cd02406, CRS2, Chloroplast RNA splicing 2 (CRS2) is a n 5e-33
KOG2255224 KOG2255, KOG2255, KOG2255, Peptidyl-tRNA hydrolase [Tra 2e-28
pfam01195184 pfam01195, Pept_tRNA_hydro, Peptidyl-tRNA hydrolase 1e-60
>gnl|CDD|180073 PRK05426, PRK05426, peptidyl-tRNA hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|30542 COG0193, Pth, Peptidyl-tRNA hydrolase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73208 cd00462, PTH, Peptidyl-tRNA hydrolase (PTH) is a monomeric protein that cleaves the ester bond linking the nascent peptide and tRNA when peptidyl-tRNA is released prematurely from the ribosome Back     alignment and domain information
>gnl|CDD|129539 TIGR00447, pth, peptidyl-tRNA hydrolase Back     alignment and domain information
>gnl|CDD|48347 cd02406, CRS2, Chloroplast RNA splicing 2 (CRS2) is a nuclear-encoded protein required for the splicing of group II introns in the chloroplast Back     alignment and domain information
>gnl|CDD|37466 KOG2255, KOG2255, KOG2255, Peptidyl-tRNA hydrolase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144695 pfam01195, Pept_tRNA_hydro, Peptidyl-tRNA hydrolase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
cd02406191 CRS2 Chloroplast RNA splicing 2 (CRS2) is a nuclear-enc 100.0
COG0193190 Pth Peptidyl-tRNA hydrolase [Translation, ribosomal str 100.0
PRK05426189 peptidyl-tRNA hydrolase; Provisional 100.0
TIGR00447193 pth peptidyl-tRNA hydrolase; InterPro: IPR001328 Peptid 100.0
pfam01195184 Pept_tRNA_hydro Peptidyl-tRNA hydrolase. 100.0
cd00462171 PTH Peptidyl-tRNA hydrolase (PTH) is a monomeric protei 100.0
KOG2255224 consensus 100.0
>cd02406 CRS2 Chloroplast RNA splicing 2 (CRS2) is a nuclear-encoded protein required for the splicing of group II introns in the chloroplast Back     alignment and domain information
>COG0193 Pth Peptidyl-tRNA hydrolase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05426 peptidyl-tRNA hydrolase; Provisional Back     alignment and domain information
>TIGR00447 pth peptidyl-tRNA hydrolase; InterPro: IPR001328 Peptidyl-tRNA hydrolase (3 Back     alignment and domain information
>pfam01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase Back     alignment and domain information
>cd00462 PTH Peptidyl-tRNA hydrolase (PTH) is a monomeric protein that cleaves the ester bond linking the nascent peptide and tRNA when peptidyl-tRNA is released prematurely from the ribosome Back     alignment and domain information
>KOG2255 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
2pth_A193 Peptidyl-Trna Hydrolase From Escherichia Coli Lengt 5e-39
2jrc_A204 Solution Structure Of Peptidyl-Trna Hydrolase From 8e-38
1ryn_A202 Structure Of The Chloroplast Group Ii Intron Splici 2e-37
2z2i_A191 Crystal Structure Of Peptidyl-Trna Hydrolase From M 3e-37
1rym_A212 Structure Of The Group Ii Intron Splicing Factor Cr 8e-37
1ryb_A205 Crystal Structure Of The Chloroplast Group Ii Intro 2e-36
3kjz_A191 Crystal Structure Of Native Peptidyl-Trna Hydrolase 3e-36
>gi|157835761|pdb|2PTH|A Chain A, Peptidyl-Trna Hydrolase From Escherichia Coli Length = 193 Back     alignment and structure
 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 69/190 (36%), Positives = 95/190 (50%), Gaps = 4/190 (2%)

Query: 2   FIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKK-KFHAEISEGQLDGLRTILIK 60
            ++ GL NPG EY   RHN G   +D +      P  ++ KF    S   L G    L+ 
Sbjct: 3   KLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLV 62

Query: 61  PQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISE 120
           P TFMNLSG+++  + +F+++   E  LV HD+LDL  G  + K GGG  GHNGLK I  
Sbjct: 63  PTTFMNLSGKAVAAMASFFRINPDE-ILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIIS 121

Query: 121 KCG--KNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDV 178
           K G   N+ RLRIGIG P D   ++  VLG     E+  +   ID  AR   +       
Sbjct: 122 KLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLT 181

Query: 179 SFLNHIVSVR 188
              N + + +
Sbjct: 182 KATNRLHAFK 191


>gi|189095922|pdb|2JRC|A Chain A, Solution Structure Of Peptidyl-Trna Hydrolase From Mycobacterium Tuberculosis H37rv Length = 204 Back     alignment and structure
>gi|40889732|pdb|1RYN|A Chain A, Structure Of The Chloroplast Group Ii Intron Splicing Factor Crs2 Length = 202 Back     alignment and structure
gi|157836744|pdb|2Z2I|A Chain A, Crystal Structure Of Peptidyl-Trna Hydrolase From Mycobacterium Tuberculosis Length = 191 Back     alignment and structure
>gi|40889731|pdb|1RYM|A Chain A, Structure Of The Group Ii Intron Splicing Factor Crs2 Length = 212 Back     alignment and structure
>gi|270047872|pdb|1RYB|A Chain A, Crystal Structure Of The Chloroplast Group Ii Intron Splicing Factor Crs2 Length = 205 Back     alignment and structure
>gi|303324919|pdb|3KJZ|A Chain A, Crystal Structure Of Native Peptidyl-Trna Hydrolase From Mycobacterium Smegmatis Length = 191 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
2z2i_A191 PTH, peptidyl-tRNA hydrolase; protein synthesis; 1.98A 2e-37
2pth_A193 Peptidyl-tRNA hydrolase; 1.20A {Escherichia coli K12} S 4e-35
1ryb_A205 CRS2; alpha-beta, hydrolase; 1.70A {Zea mays} SCOP: c.5 3e-34
>2z2i_A PTH, peptidyl-tRNA hydrolase; protein synthesis; 1.98A {Mycobacterium tuberculosis H37RV} PDB: 2z2j_A 2z2k_A 2jrc_A Length = 191 Back     alignment and structure
 Score =  150 bits (380), Expect = 2e-37
 Identities = 73/184 (39%), Positives = 106/184 (57%), Gaps = 3/184 (1%)

Query: 3   IVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAW-KKKFHAEISEGQLDGLRTILIKP 61
           +V GLGNPG  Y   RHN+GF+  D + +         K+  AE++ G+  G   +L KP
Sbjct: 6   LVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKP 65

Query: 62  QTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEK 121
           + +MN SG+ +  +  FY +    N +VIHDDLDL+FG +RLK GGG+ GHNGL+S+   
Sbjct: 66  RCYMNESGRQIGPLAKFYSVA-PANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAA 124

Query: 122 CG-KNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSF 180
            G K+++R+RIGIGRPP        VL NF+  ER  +  I +  A +  LL ++     
Sbjct: 125 LGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPA 184

Query: 181 LNHI 184
            N +
Sbjct: 185 QNRV 188


>2pth_A Peptidyl-tRNA hydrolase; 1.20A {Escherichia coli K12} SCOP: c.56.3.1 Length = 193 Back     alignment and structure
>1ryb_A CRS2; alpha-beta, hydrolase; 1.70A {Zea mays} SCOP: c.56.3.1 PDB: 1rym_A 1ryn_A Length = 205 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
2pth_A193 Peptidyl-tRNA hydrolase; 1.20A {Escherichia coli K12} S 100.0
2z2i_A191 PTH, peptidyl-tRNA hydrolase; protein synthesis; 1.98A 100.0
1ryb_A205 CRS2; alpha-beta, hydrolase; 1.70A {Zea mays} SCOP: c.5 100.0
>2pth_A Peptidyl-tRNA hydrolase; 1.20A {Escherichia coli K12} SCOP: c.56.3.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=471.93  Aligned_cols=188  Identities=36%  Similarity=0.592  Sum_probs=181.2

Q ss_pred             CEEEEECCCCCHHHHCCCCCHHHHHHHHHHHHHCCCCC-CCCCCEEEEEECCCCEEEEEEECCCHHHHCCHHHHHHHHCC
Q ss_conf             98999858787366067410489999999998279854-44321278851479748999823340200337999999405
Q gi|254780225|r    1 MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAW-KKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFY   79 (189)
Q Consensus         1 m~livGLGNPG~~y~~TRHNvG~~~ld~l~~~~~~~~~-~~k~~~~~~~~~~~~~~v~l~kP~tyMN~SG~sv~~~~~~~   79 (189)
                      |+|||||||||++|++||||||||++|.|++.+++++. ++++.+.+++..+.+.+|+|+||+||||+||+||++++++|
T Consensus         2 mkLivGLGNPG~~Y~~TRHNiG~~~ld~la~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~kP~tyMN~SG~~v~~~~~~~   81 (193)
T 2pth_A            2 IKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFF   81 (193)
T ss_dssp             CCEEEECCCCSTTTTTSGGGHHHHHHHHHHHHHTCCCEEEGGGTEEEEEEEETTEEEEEEEECSCGGGTHHHHHHHHHHH
T ss_pred             EEEEEECCCCCHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCEEEEEECCCEECCCCHHHHHHHHHH
T ss_conf             79999768995122718507899999999998499823355542588888888926999956865658526599999984


Q ss_pred             CCCCCCCEEEEEECCCCCCCCEEEECCCCCCCCCHHHHHHHCCCC--CEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             756633348984044323382366111588873103333310687--313667506898776702424378988899999
Q gi|254780225|r   80 KLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGK--NYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYF  157 (189)
Q Consensus        80 ~i~~~~~ilVihDdldL~~G~irlk~~Gg~gGHNGlksI~~~lg~--~f~RlRIGIG~P~~~~~v~~yVL~~f~~~E~~~  157 (189)
                      +++ +++|+|||||+|||+|++|+|.+||+|||||||||+++||+  +|+|||||||||+.++++++|||++|+++|++.
T Consensus        82 ~i~-~~~ilVihDDldlp~G~irlk~~Gs~gGHNGlkSI~~~LG~~~~f~RlRIGIGrp~~~~~v~~yVL~~fs~~E~~~  160 (193)
T 2pth_A           82 RIN-PDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKL  160 (193)
T ss_dssp             TCC-GGGEEEEEEETTSCTTCEEEEESCCCTTCHHHHHHHHHTTSCCCSEEEEEECCCCSSHHHHHHHHTSCCCHHHHHH
T ss_pred             CCC-HHHEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             999-7899999655657888712047997777898689999858975624388750899887863020379989999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCC
Q ss_conf             99999999999999980998999998633589
Q gi|254780225|r  158 LLPIIDNIARSLPLLAKREDVSFLNHIVSVRK  189 (189)
Q Consensus       158 i~~~i~~~~~~i~~~~~~~~~~~mn~~n~~~k  189 (189)
                      ++++++.++++++.++.++++.|||++|+++.
T Consensus       161 l~~~i~~~~~~l~~~i~~g~~~amn~~Ns~k~  192 (193)
T 2pth_A          161 IDEAIDEAARCTEMWFTDGLTKATNRLHAFKA  192 (193)
T ss_dssp             HHHHHHHHHHHHHHHHHHCHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCC
T ss_conf             99999999999999997699999999847377



>2z2i_A PTH, peptidyl-tRNA hydrolase; protein synthesis; 1.98A {Mycobacterium tuberculosis H37RV} PDB: 2z2j_A 2z2k_A 2jrc_A 3kjz_A Back     alignment and structure
>1ryb_A CRS2; alpha-beta, hydrolase; 1.70A {Zea mays} SCOP: c.56.3.1 PDB: 1rym_A 1ryn_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
d2ptha_193 c.56.3.1 (A:) Peptidyl-tRNA hydrolase {Escherichia coli 3e-36
d1ryba_191 c.56.3.1 (A:) Chloroplast group II intron splicing fact 2e-33
>d2ptha_ c.56.3.1 (A:) Peptidyl-tRNA hydrolase {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Peptidyl-tRNA hydrolase-like
family: Peptidyl-tRNA hydrolase-like
domain: Peptidyl-tRNA hydrolase
species: Escherichia coli [TaxId: 562]
 Score =  144 bits (365), Expect = 3e-36
 Identities = 67/192 (34%), Positives = 94/192 (48%), Gaps = 4/192 (2%)

Query: 1   MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFP-AWKKKFHAEISEGQLDGLRTILI 59
           + ++ GL NPG EY   RHN G   +D +      P   + KF    S   L G    L+
Sbjct: 2   IKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLL 61

Query: 60  KPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSIS 119
            P TFMNLSG+++  + +F+++   +  LV HD+LDL  G  + K GGG  GHNGLK I 
Sbjct: 62  VPTTFMNLSGKAVAAMASFFRIN-PDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDII 120

Query: 120 EKC--GKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKRED 177
            K     N+ RLRIGIG P D   ++  VLG     E+  +   ID  AR   +      
Sbjct: 121 SKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGL 180

Query: 178 VSFLNHIVSVRK 189
               N + + + 
Sbjct: 181 TKATNRLHAFKA 192


>d1ryba_ c.56.3.1 (A:) Chloroplast group II intron splicing factor Crs2 {Maize (Zea mays) [TaxId: 4577]} Length = 191 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
d2ptha_193 Peptidyl-tRNA hydrolase {Escherichia coli [TaxId: 562]} 100.0
d1ryba_191 Chloroplast group II intron splicing factor Crs2 {Maize 100.0
>d2ptha_ c.56.3.1 (A:) Peptidyl-tRNA hydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Peptidyl-tRNA hydrolase-like
family: Peptidyl-tRNA hydrolase-like
domain: Peptidyl-tRNA hydrolase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=468.18  Aligned_cols=188  Identities=36%  Similarity=0.592  Sum_probs=180.9

Q ss_pred             CEEEEECCCCCHHHHCCCCCHHHHHHHHHHHHHCCCCC-CCCCCEEEEEECCCCEEEEEEECCCHHHHCCHHHHHHHHCC
Q ss_conf             98999858787366067410489999999998279854-44321278851479748999823340200337999999405
Q gi|254780225|r    1 MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAW-KKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFY   79 (189)
Q Consensus         1 m~livGLGNPG~~y~~TRHNvG~~~ld~l~~~~~~~~~-~~k~~~~~~~~~~~~~~v~l~kP~tyMN~SG~sv~~~~~~~   79 (189)
                      |+|||||||||++|++||||||||++|.||+.++.+++ .+++.++++...+.+.+++|+||+||||+||++|++++++|
T Consensus         2 mklivGLGNPG~~Y~~TRHNiG~~~ld~la~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~kP~tyMN~SG~~v~~~~~~~   81 (193)
T d2ptha_           2 IKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFF   81 (193)
T ss_dssp             CCEEEECCCCSTTTTTSGGGHHHHHHHHHHHHHTCCCEEEGGGTEEEEEEEETTEEEEEEEECSCGGGTHHHHHHHHHHH
T ss_pred             EEEEEECCCCCHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCEEEEEECCEECCCCCHHHHHHHHHH
T ss_conf             79999778994011739507899999999998599944334664021135406734999965500202543379999983


Q ss_pred             CCCCCCCEEEEEECCCCCCCCEEEECCCCCCCCCHHHHHHHCCC-C-CEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             75663334898404432338236611158887310333331068-7-313667506898776702424378988899999
Q gi|254780225|r   80 KLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCG-K-NYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYF  157 (189)
Q Consensus        80 ~i~~~~~ilVihDdldL~~G~irlk~~Gg~gGHNGlksI~~~lg-~-~f~RlRIGIG~P~~~~~v~~yVL~~f~~~E~~~  157 (189)
                      +++ +++|+|||||+|||+|++|+|.+||+|||||||||+++|| + +|+|||||||||+.+.++++|||++|+++|++.
T Consensus        82 ~i~-~~~ilVihDDldl~~G~irlk~~Gs~gGHNGlkSI~~~LG~~~~f~RlriGIG~P~~~~~v~~yVL~~fs~~E~~~  160 (193)
T d2ptha_          82 RIN-PDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKL  160 (193)
T ss_dssp             TCC-GGGEEEEEEETTSCTTCEEEEESCCCTTCHHHHHHHHHTTSCCCSEEEEEECCCCSSHHHHHHHHTSCCCHHHHHH
T ss_pred             CCC-HHHEEEEECCHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHEEEEECCCCCCCCCCCCEECCCCCHHHHHH
T ss_conf             899-7895878611013589733225998666554899999862330021022101488666972566079979999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCC
Q ss_conf             99999999999999980998999998633589
Q gi|254780225|r  158 LLPIIDNIARSLPLLAKREDVSFLNHIVSVRK  189 (189)
Q Consensus       158 i~~~i~~~~~~i~~~~~~~~~~~mn~~n~~~k  189 (189)
                      ++.+++.++++++.++.++++.|||++|+++.
T Consensus       161 l~~~i~~~~~~i~~~i~~g~~~amn~~N~~k~  192 (193)
T d2ptha_         161 IDEAIDEAARCTEMWFTDGLTKATNRLHAFKA  192 (193)
T ss_dssp             HHHHHHHHHHHHHHHHHHCHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCC
T ss_conf             99999999999999997799999999858588



>d1ryba_ c.56.3.1 (A:) Chloroplast group II intron splicing factor Crs2 {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 189 peptidyl-tRNA hydrolase [Candidatus Liberibacter a
1ryb_A_205 (A:) CRS2; alpha-beta, hydrolase; 1.70A {Zea mays} 2e-54
2z2i_A_191 (A:) PTH, peptidyl-tRNA hydrolase; protein synthes 9e-54
2pth_A_193 (A:) Peptidyl-tRNA hydrolase; 1.20A {Escherichia c 1e-52
>1ryb_A (A:) CRS2; alpha-beta, hydrolase; 1.70A {Zea mays}Length = 205 Back     alignment and structure
 Score =  205 bits (524), Expect = 2e-54
 Identities = 57/186 (30%), Positives = 98/186 (52%), Gaps = 3/186 (1%)

Query: 1   MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIK 60
            +++AGLGNPG++Y   RHN+GF  +DRI +         +  + +  G +  +  +++K
Sbjct: 17  PWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITMNTIQSKSLLGIGSIGEVPVLVVK 76

Query: 61  PQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISE 120
           PQ++MN SG+++  +  +Y++  L + L+I+DD  L  G LRL+  GG   HNGL+++ E
Sbjct: 77  PQSYMNYSGEAIGPLAAYYQV-PLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIE 135

Query: 121 KCG--KNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDV 178
                + + RL IGIG PP        +L  FSS ER  +   ++    ++  L  +   
Sbjct: 136 HLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDAVRTLVLKGFS 195

Query: 179 SFLNHI 184
                 
Sbjct: 196 GSTERF 201


>2z2i_A (A:) PTH, peptidyl-tRNA hydrolase; protein synthesis; 1.98A {Mycobacterium tuberculosis H37RV} PDB: 2z2j_A 2z2k_A 2jrc_ALength = 191 Back     alignment and structure
>2pth_A (A:) Peptidyl-tRNA hydrolase; 1.20A {Escherichia coli K12}Length = 193 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target189 peptidyl-tRNA hydrolase [Candidatus Liberibacter asiati
2pth_A_193 Peptidyl-tRNA hydrolase; 1.20A {Escherichia coli K 100.0
1ryb_A_205 CRS2; alpha-beta, hydrolase; 1.70A {Zea mays} (A:) 100.0
2z2i_A_191 PTH, peptidyl-tRNA hydrolase; protein synthesis; 1 100.0
>2pth_A (A:) Peptidyl-tRNA hydrolase; 1.20A {Escherichia coli K12} Back     alignment and structure
Probab=100.00  E-value=0  Score=471.77  Aligned_cols=188  Identities=36%  Similarity=0.592  Sum_probs=182.4

Q ss_pred             CEEEEECCCCCHHHHCCCCCHHHHHHHHHHHHHCCCCC-CCCCCEEEEEECCCCEEEEEEECCCHHHHCCHHHHHHHHCC
Q ss_conf             98999858787366067410489999999998279854-44321278851479748999823340200337999999405
Q gi|254780225|r    1 MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAW-KKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFY   79 (189)
Q Consensus         1 m~livGLGNPG~~y~~TRHNvG~~~ld~l~~~~~~~~~-~~k~~~~~~~~~~~~~~v~l~kP~tyMN~SG~sv~~~~~~~   79 (189)
                      |||||||||||++|++|||||||+++|.||+.+++++. .+++.+.++++.+.+.+++|+||+||||+||+||++++++|
T Consensus         2 m~li~GLGNPG~~Y~~TRHNiGf~~ld~la~~~~~~~~~~~~~~~~~~~~~~~~~~v~L~kp~TyMN~SG~~V~~~~~~~   81 (193)
T 2pth_A            2 IKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFF   81 (193)
T ss_dssp             CCEEEECCCCSTTTTTSGGGHHHHHHHHHHHHHTCCCEEEGGGTEEEEEEEETTEEEEEEEECSCGGGTHHHHHHHHHHH
T ss_pred             EEEEEECCCCCHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCEEEEEECCEECCCCCHHHHHHHHHH
T ss_conf             79999768994111728507899999999998599843334664021124306735999965500213643069999983


Q ss_pred             CCCCCCCEEEEEECCCCCCCCEEEECCCCCCCCCHHHHHHHCCCC--CEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             756633348984044323382366111588873103333310687--313667506898776702424378988899999
Q gi|254780225|r   80 KLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGK--NYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYF  157 (189)
Q Consensus        80 ~i~~~~~ilVihDdldL~~G~irlk~~Gg~gGHNGlksI~~~lg~--~f~RlRIGIG~P~~~~~v~~yVL~~f~~~E~~~  157 (189)
                      +|+ +++++|||||+|+|+|++|+|.+||++||||||||+++||+  ||+|||||||||+.++++++|||++|+++|++.
T Consensus        82 ki~-~~~ilVihDdldlp~G~irlk~gGs~~GHNGlkSI~~~lgt~~~f~RlrIGIGrP~~~~~v~~yVL~~F~~~E~~~  160 (193)
T 2pth_A           82 RIN-PDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKL  160 (193)
T ss_dssp             TCC-GGGEEEEEEETTSCTTCEEEEESCCCTTCHHHHHHHHHTTSCCCSEEEEEECCCCSSHHHHHHHHTSCCCHHHHHH
T ss_pred             CCC-HHHEEEEECCHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCEECCCCCHHHHHH
T ss_conf             899-8995766501013699723435998555343899999973122232211110488667981576269979999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCC
Q ss_conf             99999999999999980998999998633589
Q gi|254780225|r  158 LLPIIDNIARSLPLLAKREDVSFLNHIVSVRK  189 (189)
Q Consensus       158 i~~~i~~~~~~i~~~~~~~~~~~mn~~n~~~k  189 (189)
                      |+++++.++++++.++.++++.+||++|+.+|
T Consensus       161 l~~~i~~~~~~l~~~~~~~~~~~mn~~n~~~~  192 (193)
T 2pth_A          161 IDEAIDEAARCTEMWFTDGLTKATNRLHAFKA  192 (193)
T ss_dssp             HHHHHHHHHHHHHHHHHHCHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCC
T ss_conf             99999999999999997799999999858488



>1ryb_A (A:) CRS2; alpha-beta, hydrolase; 1.70A {Zea mays} Back     alignment and structure
>2z2i_A (A:) PTH, peptidyl-tRNA hydrolase; protein synthesis; 1.98A {Mycobacterium tuberculosis H37RV} PDB: 2z2j_A 2z2k_A 2jrc_A Back     alignment and structure