254780227

254780227

pyrophosphate--fructose-6-phosphate 1-phosphotransferase

GeneID in NCBI database:8209208Locus tag:CLIBASIA_00560
Protein GI in NCBI database:254780227Protein Accession:YP_003064640.1
Gene range:+(115253, 116533)Protein Length:426aa
Gene description:pyrophosphate--fructose-6-phosphate 1-phosphotransferase
COG prediction:none
KEGG prediction:pfk; pyrophosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90); K00895 pyrophosphate--fructose-6-phosphate 1-phosphotransferase [EC:2.7.1.90]
SEED prediction:Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, alpha subunit (EC 2.7.1.90)
Pathway involved in KEGG:Fructose and mannose metabolism [PATH:las00051]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGRVFDTNTPWFSDILRHTGQKS
cccHHHHHHHccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHcccccEEcccccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHHHHHHccccEEEEEEcHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccEEEccHHHHHccccccccHHHHHHHHHHcccccc
ccccccccccHHHHHHHcccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEccccHHHHHHHHHccccEcccccccccHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccEEEEccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccEEcccccHHHHHHHHHHHHHcccccEEEccccEEccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccEEEEEEcHHHHcccccccccHHHHHHHHHHccccc
MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLtaggiapcLSSIIGMLINHYNKILPKAELIYYRFGyqglllddkitITEDMRQNAEQLLSyggspignsrvkltnfsdcikrglikkdenplevSAHHLMQSGVTILHtiggddtntTACDLLRYLKeknynitvvglpktidndiipihqSLGALTAAQVSACffdnisnersatprslIIHEVMGRNCGWLTAYSAHCYLNMiqdrnyidgfifspdfkgidgvylpemsfNLEVEIERLSKVMEKKGSVAIFVSEgacrdvimdnrlssgekikrdsfghilldkmnvgswfADKFANMIKAERSIVQKsgyfarsapsgsedlSLIKKMVVLAVDSAisgisgvtgederenNILRIIKfedirggrvfdtntpwfsdilrhtgqks
MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLsyggspignsrVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAifvsegacrdvIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAisgisgvtgederennilriikfedirggrvfdtntpwfsdilrhtgqks
MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGRVFDTNTPWFSDILRHTGQKS
*******ISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDN**********DSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGRVFDTNTPWFSDILRHTGQ**
MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGRVFDTNTPWFSDILRHTGQKS
*****SYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGRVFDTNTPWFSDILRH*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGRVFDTNTPWFSDILRHTGQKS
MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGRVFDTNTPWFSDILRHTGQKS
MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGRVFDTNTPWFSDILRHTGQKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target426 pyrophosphate--fructose-6-phosphate 1-phosphotransferas
315122333400 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 1 0.0
222149150404 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 1 1e-145
227822665404 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 1 1e-143
222086458403 6-phosphofructokinase protein [Agrobacterium radiobacte 1 1e-143
159185054403 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 1 1e-142
150397307404 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 1 1e-142
15965943404 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 1 1e-141
325293480403 pyrophosphate-fructose-6-phosphate 1-phosphotransferase 1 1e-140
190892599403 6-phosphofructokinase protein [Rhizobium etli CIAT 652] 1 1e-139
218673807403 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 1 1e-139
>gi|315122333|ref|YP_004062822.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 400 Back     alignment and organism information
 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/399 (81%), Positives = 371/399 (92%)

Query: 27  MVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDM 86
           MV HKVAFLTAGGIAPCLSS+IGMLI+ YN+ILP+AELI YR GYQGLLLDDKI I+ DM
Sbjct: 1   MVKHKVAFLTAGGIAPCLSSVIGMLISRYNEILPEAELIAYRSGYQGLLLDDKIEISHDM 60

Query: 87  RQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIG 146
           RQNAE+LLSYGGSPIGNSR+KLTN +DCIKR LIK++ENPLEV+AH+LM++ VTILHTIG
Sbjct: 61  RQNAEKLLSYGGSPIGNSRIKLTNINDCIKRNLIKENENPLEVAAHNLMKNNVTILHTIG 120

Query: 147 GDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISN 206
           GDDTNTTACDLL YLKEK YNITVVGLPKTIDNDI+PIHQSLGALTAA+VSA FFDNISN
Sbjct: 121 GDDTNTTACDLLNYLKEKGYNITVVGLPKTIDNDIVPIHQSLGALTAAKVSAQFFDNISN 180

Query: 207 ERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEM 266
           ERSA+P+SLIIHEVMGRNCGWLTAY+A  YL+MI+DR+Y++G IFSP+FK IDG+YLPEM
Sbjct: 181 ERSASPKSLIIHEVMGRNCGWLTAYAARSYLDMIRDRDYVNGLIFSPEFKAIDGIYLPEM 240

Query: 267 SFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNV 326
           SFNLE E ERL+ +MEKKGSVA+FVSEGACRDVI+ +RLSSG+KI+RDSFGHILLDK+NV
Sbjct: 241 SFNLEEETERLTMIMEKKGSVALFVSEGACRDVIVSDRLSSGDKIQRDSFGHILLDKINV 300

Query: 327 GSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGE 386
           GSWF+DKFAN+IKAERSIVQKSGYFARSA S  EDL LI+KMV+LAVD AI+GISGVTGE
Sbjct: 301 GSWFSDKFANLIKAERSIVQKSGYFARSAASSEEDLILIRKMVILAVDGAIAGISGVTGE 360

Query: 387 DERENNILRIIKFEDIRGGRVFDTNTPWFSDILRHTGQK 425
           DER+NN+LRII+FE+I GG++FD  TPWFSDIL+HTGQK
Sbjct: 361 DERKNNLLRIIEFENILGGKIFDIKTPWFSDILQHTGQK 399


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149150|ref|YP_002550107.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Agrobacterium vitis S4] Length = 404 Back     alignment and organism information
>gi|227822665|ref|YP_002826637.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Sinorhizobium fredii NGR234] Length = 404 Back     alignment and organism information
>gi|222086458|ref|YP_002544992.1| 6-phosphofructokinase protein [Agrobacterium radiobacter K84] Length = 403 Back     alignment and organism information
>gi|159185054|ref|NP_355078.2| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Agrobacterium tumefaciens str. C58] Length = 403 Back     alignment and organism information
>gi|150397307|ref|YP_001327774.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Sinorhizobium medicae WSM419] Length = 404 Back     alignment and organism information
>gi|15965943|ref|NP_386296.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Sinorhizobium meliloti 1021] Length = 404 Back     alignment and organism information
>gi|325293480|ref|YP_004279344.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Agrobacterium sp. H13-3] Length = 403 Back     alignment and organism information
>gi|190892599|ref|YP_001979141.1| 6-phosphofructokinase protein [Rhizobium etli CIAT 652] Length = 403 Back     alignment and organism information
>gi|218673807|ref|ZP_03523476.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Rhizobium etli GR56] Length = 403 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target426 pyrophosphate--fructose-6-phosphate 1-phosphotransferas
PRK06555403 PRK06555, PRK06555, pyrophosphate--fructose-6-phosphate 0.0
PTZ00286459 PTZ00286, PTZ00286, 6-phospho-1-fructokinase; Provision 1e-32
PLN02884411 PLN02884, PLN02884, 6-phosphofructokinase 6e-13
cd00363338 cd00363, PFK, Phosphofructokinase, a key regulatory enz 2e-23
pfam00365279 pfam00365, PFK, Phosphofructokinase 2e-19
PRK03202320 PRK03202, PRK03202, 6-phosphofructokinase; Provisional 2e-16
cd00763317 cd00763, Bacterial_PFK, Phosphofructokinase, a key regu 6e-16
TIGR02482301 TIGR02482, PFKA_ATP, 6-phosphofructokinase 1e-12
cd00764 762 cd00764, Eukaryotic_PFK, Phosphofructokinase, a key reg 3e-12
KOG2440 666 KOG2440, KOG2440, KOG2440, Pyrophosphate-dependent phos 1e-07
PRK14072416 PRK14072, PRK14072, 6-phosphofructokinase; Provisional 4e-23
PLN02564484 PLN02564, PLN02564, 6-phosphofructokinase 4e-12
KOG2440 666 KOG2440, KOG2440, KOG2440, Pyrophosphate-dependent phos 7e-07
TIGR02483324 TIGR02483, PFK_mixed, phosphofructokinase 3e-22
PRK06830443 PRK06830, PRK06830, diphosphate--fructose-6-phosphate 1 2e-18
PRK14071360 PRK14071, PRK14071, 6-phosphofructokinase; Provisional 3e-08
COG0205347 COG0205, PfkA, 6-phosphofructokinase [Carbohydrate tran 1e-39
cd00765550 cd00765, Pyrophosphate_PFK, Phosphofructokinase, a key 5e-13
TIGR02478 745 TIGR02478, 6PF1K_euk, 6-phosphofructokinase, eukaryotic 1e-12
PRK07085 555 PRK07085, PRK07085, diphosphate--fructose-6-phosphate 1 2e-12
TIGR02477539 TIGR02477, PFKA_PPi, diphosphate--fructose-6-phosphate 8e-12
PTZ00287 1419 PTZ00287, PTZ00287, 6-phosphofructokinase; Provisional 6e-09
PTZ00468 1328 PTZ00468, PTZ00468, phosphofructokinase family protein; 3e-08
PLN02251568 PLN02251, PLN02251, pyrophosphate-dependent phosphofruc 1e-08
TIGR02478745 TIGR02478, 6PF1K_euk, 6-phosphofructokinase, eukaryotic 1e-07
cd00764762 cd00764, Eukaryotic_PFK, Phosphofructokinase, a key reg 2e-07
>gnl|CDD|180620 PRK06555, PRK06555, pyrophosphate--fructose-6-phosphate 1-phosphotransferase; Validated Back     alignment and domain information
>gnl|CDD|185539 PTZ00286, PTZ00286, 6-phospho-1-fructokinase; Provisional Back     alignment and domain information
>gnl|CDD|178472 PLN02884, PLN02884, 6-phosphofructokinase Back     alignment and domain information
>gnl|CDD|29437 cd00363, PFK, Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>gnl|CDD|109425 pfam00365, PFK, Phosphofructokinase Back     alignment and domain information
>gnl|CDD|179553 PRK03202, PRK03202, 6-phosphofructokinase; Provisional Back     alignment and domain information
>gnl|CDD|29438 cd00763, Bacterial_PFK, Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>gnl|CDD|131535 TIGR02482, PFKA_ATP, 6-phosphofructokinase Back     alignment and domain information
>gnl|CDD|29439 cd00764, Eukaryotic_PFK, Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>gnl|CDD|37651 KOG2440, KOG2440, KOG2440, Pyrophosphate-dependent phosphofructo-1-kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184488 PRK14072, PRK14072, 6-phosphofructokinase; Provisional Back     alignment and domain information
>gnl|CDD|178178 PLN02564, PLN02564, 6-phosphofructokinase Back     alignment and domain information
>gnl|CDD|37651 KOG2440, KOG2440, KOG2440, Pyrophosphate-dependent phosphofructo-1-kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162879 TIGR02483, PFK_mixed, phosphofructokinase Back     alignment and domain information
>gnl|CDD|180716 PRK06830, PRK06830, diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184487 PRK14071, PRK14071, 6-phosphofructokinase; Provisional Back     alignment and domain information
>gnl|CDD|30554 COG0205, PfkA, 6-phosphofructokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|29440 cd00765, Pyrophosphate_PFK, Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>gnl|CDD|162876 TIGR02478, 6PF1K_euk, 6-phosphofructokinase, eukaryotic type Back     alignment and domain information
>gnl|CDD|180830 PRK07085, PRK07085, diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional Back     alignment and domain information
>gnl|CDD|131530 TIGR02477, PFKA_PPi, diphosphate--fructose-6-phosphate 1-phosphotransferase Back     alignment and domain information
>gnl|CDD|173508 PTZ00287, PTZ00287, 6-phosphofructokinase; Provisional Back     alignment and domain information
>gnl|CDD|185647 PTZ00468, PTZ00468, phosphofructokinase family protein; Provisional Back     alignment and domain information
>gnl|CDD|177893 PLN02251, PLN02251, pyrophosphate-dependent phosphofructokinase Back     alignment and domain information
>gnl|CDD|162876 TIGR02478, 6PF1K_euk, 6-phosphofructokinase, eukaryotic type Back     alignment and domain information
>gnl|CDD|29439 cd00764, Eukaryotic_PFK, Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 426 pyrophosphate--fructose-6-phosphate 1-phosphotransferas
PRK06555403 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 100.0
PRK06830442 diphosphate--fructose-6-phosphate 1-phosphotransferase; 100.0
PTZ00286486 6-phospho-1-fructokinase; Provisional 100.0
cd00363338 PFK Phosphofructokinase, a key regulatory enzyme in gly 100.0
PRK03202323 6-phosphofructokinase; Provisional 100.0
cd00763317 Bacterial_PFK Phosphofructokinase, a key regulatory enz 100.0
TIGR02478 777 6PF1K_euk 6-phosphofructokinase; InterPro: IPR009161 Me 100.0
cd00764 762 Eukaryotic_PFK Phosphofructokinase, a key regulatory en 100.0
cd00764762 Eukaryotic_PFK Phosphofructokinase, a key regulatory en 100.0
PRK07085557 diphosphate--fructose-6-phosphate 1-phosphotransferase; 100.0
cd00765550 Pyrophosphate_PFK Phosphofructokinase, a key regulatory 100.0
TIGR02478777 6PF1K_euk 6-phosphofructokinase; InterPro: IPR009161 Me 100.0
PTZ00287 1439 6-phosphofructokinase; Provisional 100.0
PTZ00287 1439 6-phosphofructokinase; Provisional 100.0
KOG2440 666 consensus 100.0
TIGR02483339 PFK_mixed phosphofructokinase; InterPro: IPR012829 Memb 100.0
TIGR02482302 PFKA_ATP 6-phosphofructokinase; InterPro: IPR012828 6-p 100.0
TIGR02477566 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosphotra 100.0
COG0205347 PfkA 6-phosphofructokinase [Carbohydrate transport and 100.0
pfam00365279 PFK Phosphofructokinase. 100.0
KOG2440 666 consensus 100.0
pfam01513243 NAD_kinase ATP-NAD kinase. Members of this family inclu 96.16
PRK00561259 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 95.63
PRK13337305 putative lipid kinase; Reviewed 94.56
PRK09423366 gldA glycerol dehydrogenase; Provisional 94.49
PRK04761246 ppnK inorganic polyphosphate/ATP-NAD kinase; Reviewed 94.21
PRK04885265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 94.2
PRK02649305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 94.05
PRK03501264 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.87
COG3199355 Predicted inorganic polyphosphate/ATP-NAD kinase [Gener 93.79
PRK13057287 putative lipid kinase; Reviewed 93.63
PRK02231272 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.3
PRK11914304 diacylglycerol kinase; Reviewed 92.3
PRK13059294 putative lipid kinase; Reviewed 91.96
PRK01185272 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 90.59
PRK02155291 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 95.86
PRK02645304 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 94.7
PRK03708278 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 94.4
PRK01911290 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 94.21
PRK03378292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.94
PRK04759294 consensus 93.83
PRK01231296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.8
PRK04539296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.46
PRK03372303 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 93.16
PRK00861296 putative lipid kinase; Reviewed 93.65
TIGR00147316 TIGR00147 conserved hypothetical protein TIGR00147; Int 93.5
pfam00465312 Fe-ADH Iron-containing alcohol dehydrogenase. 92.58
PRK10624381 L-1,2-propanediol oxidoreductase; Provisional 92.04
>PRK06555 pyrophosphate--fructose-6-phosphate 1-phosphotransferase; Validated Back     alignment and domain information
>PRK06830 diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional Back     alignment and domain information
>PTZ00286 6-phospho-1-fructokinase; Provisional Back     alignment and domain information
>cd00363 PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>PRK03202 6-phosphofructokinase; Provisional Back     alignment and domain information
>cd00763 Bacterial_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>TIGR02478 6PF1K_euk 6-phosphofructokinase; InterPro: IPR009161 Members of this family are eukaryotic (with one exception) ATP-dependent 6-phosphofructokinases (2 Back     alignment and domain information
>cd00764 Eukaryotic_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>cd00764 Eukaryotic_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>PRK07085 diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional Back     alignment and domain information
>cd00765 Pyrophosphate_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>TIGR02478 6PF1K_euk 6-phosphofructokinase; InterPro: IPR009161 Members of this family are eukaryotic (with one exception) ATP-dependent 6-phosphofructokinases (2 Back     alignment and domain information
>PTZ00287 6-phosphofructokinase; Provisional Back     alignment and domain information
>PTZ00287 6-phosphofructokinase; Provisional Back     alignment and domain information
>KOG2440 consensus Back     alignment and domain information
>TIGR02483 PFK_mixed phosphofructokinase; InterPro: IPR012829 Members of this family that are characterised, save one, are phosphofructokinases dependent on pyrophosphate (2 Back     alignment and domain information
>TIGR02482 PFKA_ATP 6-phosphofructokinase; InterPro: IPR012828 6-phosphofructokinase (2 Back     alignment and domain information
>TIGR02477 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosphotransferase; InterPro: IPR011183 Diphosphate--fructose-6-phosphate 1-phosphotransferase catalyses the addition of phosphate from diphosphate (PPi) to fructose 6-phosphate to give fructose 1,6-bisphosphate (2 Back     alignment and domain information
>COG0205 PfkA 6-phosphofructokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam00365 PFK Phosphofructokinase Back     alignment and domain information
>KOG2440 consensus Back     alignment and domain information
>pfam01513 NAD_kinase ATP-NAD kinase Back     alignment and domain information
>PRK00561 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>PRK04761 ppnK inorganic polyphosphate/ATP-NAD kinase; Reviewed Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03501 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG3199 Predicted inorganic polyphosphate/ATP-NAD kinase [General function prediction only] Back     alignment and domain information
>PRK13057 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>PRK13059 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02155 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04759 consensus Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK00861 putative lipid kinase; Reviewed Back     alignment and domain information
>TIGR00147 TIGR00147 conserved hypothetical protein TIGR00147; InterPro: IPR005218 Although the proteins in this group all contain the diacylglycerol kinase catalytic domain, their function is, as yet, unknown Back     alignment and domain information
>pfam00465 Fe-ADH Iron-containing alcohol dehydrogenase Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target426 pyrophosphate--fructose-6-phosphate 1-phosphotransferas
3pfk_A319 Phosphofructokinase. Structure And Control Length = 3e-75
6pfk_A319 Phosphofructokinase, Inhibited T-State Length = 319 4e-75
1mto_A319 Crystal Structure Of A Phosphofructokinase Mutant F 6e-75
2hig_A487 Crystal Structure Of Phosphofructokinase Apoenzyme 5e-73
1pfk_A320 Crystal Structure Of The Complex Of Phosphofructoki 4e-69
3o8l_A 762 Structure Of Phosphofructokinase From Rabbit Skelet 3e-67
3o8l_A762 Structure Of Phosphofructokinase From Rabbit Skelet 9e-45
1zxx_A319 The Crystal Structure Of Phosphofructokinase From L 2e-66
3opy_A 989 Crystal Structure Of Pichia Pastoris Phosphofructok 2e-66
3opy_B 941 Crystal Structure Of Pichia Pastoris Phosphofructok 5e-65
3o8o_A 787 Structure Of Phosphofructokinase From Saccharomyces 2e-64
3k2q_A420 Crystal Structure Of Pyrophosphate-Dependent Phosph 2e-62
3o8o_B 766 Structure Of Phosphofructokinase From Saccharomyces 4e-60
3o8o_B766 Structure Of Phosphofructokinase From Saccharomyces 1e-40
1kzh_A555 Structure Of A Pyrophosphate-Dependent Phosphofruct 4e-59
3hno_A419 Crystal Structure Of Pyrophosphate-Dependent Phosph 4e-56
3opy_A989 Crystal Structure Of Pichia Pastoris Phosphofructok 1e-42
3opy_B941 Crystal Structure Of Pichia Pastoris Phosphofructok 1e-42
3o8o_A787 Structure Of Phosphofructokinase From Saccharomyces 5e-35
>gi|157836866|pdb|3PFK|A Chain A, Phosphofructokinase. Structure And Control Length = 319 Back     alignment and structure
 Score =  287 bits (734), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 74/382 (19%), Positives = 126/382 (32%), Gaps = 76/382 (19%)

Query: 29  AHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQ 88
             ++  LT+GG +P +++ I  ++     I    E+     GY GL+  +   I +    
Sbjct: 1   MKRIGVLTSGGDSPGMNAAIRSVVRKA--IYHGVEVYGVYHGYAGLIAGN---IKKLEVG 55

Query: 89  NAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGD 148
           +   ++  GG+ +  +R       +  K+G               L + G+  L  IGGD
Sbjct: 56  DVGDIIHRGGTILYTARCPEFKTEEGQKKG------------IEQLKKHGIQGLVVIGGD 103

Query: 149 DTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNER 208
            +   A  L        +    VG+P TIDNDI     ++G  TA        D I +  
Sbjct: 104 GSYQGAKKLTE------HGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTA 157

Query: 209 SATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSF 268
           + +     + EVMGR+ G +  +S                               PE  +
Sbjct: 158 T-SHERTYVIEVMGRHAGDIALWSGLAGGAETILI--------------------PEADY 196

Query: 269 NLEVEIERLSKVME-KKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVG 327
           ++   I RL +  E  K    I V+EG                             +  G
Sbjct: 197 DMNDVIARLKRGHERGKKHSIIIVAEG-----------------------------VGSG 227

Query: 328 SWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGED 387
             F  +       E + V   G+  R     + D  L  ++   AV+  + G  G     
Sbjct: 228 VDFGRQIQEATGFE-TRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGI 286

Query: 388 ERENNILRIIKFEDIRGGRVFD 409
           +    +   I  E +      D
Sbjct: 287 QNNQLVDHDI-AEALANKHTID 307


gi|1633050|pdb|6PFK|A Chain A, Phosphofructokinase, Inhibited T-State Length = 319 Back     alignment and structure
>gi|27573982|pdb|1MTO|A Chain A, Crystal Structure Of A Phosphofructokinase Mutant From Bacillus Stearothermophilus Bound With Fructose-6-Phosphate Length = 319 Back     alignment and structure
gi|134104453|pdb|2HIG|A Chain A, Crystal Structure Of Phosphofructokinase Apoenzyme From Trypanosoma Brucei. Length = 487 Back     alignment and structure
gi|230242|pdb|1PFK|A Chain A, Crystal Structure Of The Complex Of Phosphofructokinase From Escherichia Coli With Its Reaction Products Length = 320 Back     alignment and structure
>gi|321159866|pdb|3O8L|A Chain A, Structure Of Phosphofructokinase From Rabbit Skeletal Muscle Length = 762 Back     alignment and structure
>gi|321159866|pdb|3O8L|A Chain A, Structure Of Phosphofructokinase From Rabbit Skeletal Muscle Length = 762 Back     alignment and structure
gi|83753869|pdb|1ZXX|A Chain A, The Crystal Structure Of Phosphofructokinase From Lactobacillus Delbrueckii Length = 319 Back     alignment and structure
>gi|308198669|pdb|3OPY|A Chain A, Crystal Structure Of Pichia Pastoris Phosphofructokinase In The T- State Length = 989 Back     alignment and structure
>gi|308198670|pdb|3OPY|B Chain B, Crystal Structure Of Pichia Pastoris Phosphofructokinase In The T- State Length = 941 Back     alignment and structure
>gi|321159870|pdb|3O8O|A Chain A, Structure Of Phosphofructokinase From Saccharomyces Cerevisiae Length = 787 Back     alignment and structure
gi|268612430|pdb|3K2Q|A Chain A, Crystal Structure Of Pyrophosphate-Dependent Phosphofructokinase From Marinobacter Aquaeolei, Northeast Structural Genomics Consortium Target Mqr88 Length = 420 Back     alignment and structure
>gi|321159871|pdb|3O8O|B Chain B, Structure Of Phosphofructokinase From Saccharomyces Cerevisiae Length = 766 Back     alignment and structure
>gi|321159871|pdb|3O8O|B Chain B, Structure Of Phosphofructokinase From Saccharomyces Cerevisiae Length = 766 Back     alignment and structure
gi|21465959|pdb|1KZH|A Chain A, Structure Of A Pyrophosphate-Dependent Phosphofructokinase From The Lyme Disease Spirochete Borrelia Burgdorferi Length = 555 Back     alignment and structure
gi|242556686|pdb|3HNO|A Chain A, Crystal Structure Of Pyrophosphate-Dependent Phosphofructokinase From Nitrosospira Multiformis. Northeast Structural Genomics Consortium Target Id Nmr42 Length = 419 Back     alignment and structure
>gi|308198669|pdb|3OPY|A Chain A, Crystal Structure Of Pichia Pastoris Phosphofructokinase In The T- State Length = 989 Back     alignment and structure
>gi|308198670|pdb|3OPY|B Chain B, Crystal Structure Of Pichia Pastoris Phosphofructokinase In The T- State Length = 941 Back     alignment and structure
>gi|321159870|pdb|3O8O|A Chain A, Structure Of Phosphofructokinase From Saccharomyces Cerevisiae Length = 787 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target426 pyrophosphate--fructose-6-phosphate 1-phosphotransferas
3opy_A 989 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fr 1e-47
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding, fru 4e-47
3hno_A419 Pyrophosphate-dependent phosphofructokinase; structural 4e-46
2f48_A555 Diphosphate--fructose-6-phosphate 1- phosphotransferase 9e-43
2hig_A487 6-phospho-1-fructokinase; transferase; 2.40A {Trypanoso 9e-43
1pfk_A320 Phosphofructokinase; transferase(phosphotransferase); H 2e-33
1zxx_A319 6-phosphofructokinase; allosteric regulation, lactobaci 3e-27
3pfk_A319 Phosphofructokinase; transferase(phosphotransferase); 2 2e-26
3opy_A989 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fr 2e-31
3opy_B941 6-phosphofructo-1-kinase beta-subunit; ATP binding, fru 2e-31
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Length = 989 Back     alignment and structure
 Score =  185 bits (472), Expect = 1e-47
 Identities = 78/377 (20%), Positives = 144/377 (38%), Gaps = 82/377 (21%)

Query: 31  KVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNA 90
           K+A +T+GG AP +++ +  +      I    ++     GY GL+    + + E   Q+ 
Sbjct: 212 KIAIITSGGDAPGMNAAVRAVT--RAGIFYGCKVYACYEGYTGLVKGGDM-LKELQWQDV 268

Query: 91  EQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDT 150
             LLS GG+ IG +R K              ++      + ++++ +G+  L   GGD +
Sbjct: 269 RGLLSIGGTIIGTARCKEF------------RERWGRLQACYNMVSNGIDALVVCGGDGS 316

Query: 151 NTTACDL-----------------LRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTA 193
            T A                     +   E + N+T+VGL  +IDND+     ++GA ++
Sbjct: 317 LTGADLFRKEWPELIKELLGEDKITKEQYETHRNLTIVGLVGSIDNDMCGTDSTIGAYSS 376

Query: 194 AQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSP 253
            +      D I    ++  R+ ++ EVMGR+CGWL   S       I             
Sbjct: 377 LERIIELVDYIDATAASHSRAFVV-EVMGRHCGWLGLMSG------IA------------ 417

Query: 254 DFKGIDGVYLPEMSFNLEVEIERLSKVMEK-----KGSVAIFVSEGACRDVIMDNRLSSG 308
              G D +++PE   +     + L KV  +     +    + V+EGA     +D++L+  
Sbjct: 418 --TGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGA-----IDDQLN-- 468

Query: 309 EKIKRDSFGHILLDKMNVGSWFADKFANMIKAERSIVQKSGYFARSAPSGSEDLSLIKKM 368
                            + S         I  + + + + G+  R     + D  L    
Sbjct: 469 ----------------PITSEEVKDVLVEIGLD-TRITRLGHVQRGGAPCAFDRFLATVQ 511

Query: 369 VVLAVDSAISGISGVTG 385
            V AV + +     +  
Sbjct: 512 GVDAVRAVLESTPAIPS 528


>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Length = 941 Back     alignment and structure
>3hno_A Pyrophosphate-dependent phosphofructokinase; structural genomics, PSI-2, protein structure initiative; 2.00A {Nitrosospira multiformis atcc 25196} PDB: 3k2q_A Length = 419 Back     alignment and structure
>2f48_A Diphosphate--fructose-6-phosphate 1- phosphotransferase; HET: FBP; 2.11A {Borrelia burgdorferi B31} SCOP: c.89.1.1 PDB: 1kzh_A* Length = 555 Back     alignment and structure
>2hig_A 6-phospho-1-fructokinase; transferase; 2.40A {Trypanosoma brucei} PDB: 3f5m_A* Length = 487 Back     alignment and structure
>1pfk_A Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} SCOP: c.89.1.1 PDB: 2pfk_A Length = 320 Back     alignment and structure
>1zxx_A 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp} Length = 319 Back     alignment and structure
>3pfk_A Phosphofructokinase; transferase(phosphotransferase); 2.40A {Bacillus stearothermophilus} SCOP: c.89.1.1 PDB: 4pfk_A* 6pfk_A 1mto_A* Length = 319 Back     alignment and structure
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Length = 989 Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Length = 941 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target426 pyrophosphate--fructose-6-phosphate 1-phosphotransferas
2hig_A487 6-phospho-1-fructokinase; transferase; 2.40A {Trypanoso 100.0
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding, fru 100.0
3hno_A419 Pyrophosphate-dependent phosphofructokinase; structural 100.0
3opy_A 989 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fr 100.0
3opy_B941 6-phosphofructo-1-kinase beta-subunit; ATP binding, fru 100.0
2f48_A555 Diphosphate--fructose-6-phosphate 1- phosphotransferase 100.0
3pfk_A319 Phosphofructokinase; transferase(phosphotransferase); 2 100.0
1zxx_A319 6-phosphofructokinase; allosteric regulation, lactobaci 100.0
1pfk_A320 Phosphofructokinase; transferase(phosphotransferase); H 100.0
3opy_A989 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fr 100.0
2an1_A292 Putative kinase; structural genomics, PSI, protein stru 95.3
3pfn_A365 NAD kinase; structural genomics consortium, SNP, SGC, t 93.38
3l49_A291 ABC sugar (ribose) transporter, periplasmic substrate-b 91.57
2qv7_A337 Diacylglycerol kinase DGKB; alpha-beta domain 1, beta s 95.13
1u0t_A307 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, bet 94.75
2i2c_A272 Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP 93.66
2bon_A332 Lipid kinase; DAG kinase, ATP-binding, transferase; 1.9 93.35
1yt5_A258 Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha 91.24
2w7t_A273 CTP synthetase, putative cytidine triphosphate synthase 90.11
1z0s_A278 Probable inorganic polyphosphate/ATP-NAD kinase; ATP-bi 94.79
1rrm_A386 Lactaldehyde reductase; structural genomics, dehydrogen 93.08
1o2d_A371 Alcohol dehydrogenase, iron-containing; TM0920, structu 91.76
1vlj_A407 NADH-dependent butanol dehydrogenase; TM0820, structura 91.38
3iv7_A364 Alcohol dehydrogenase IV; NP_602249.1, iron-containing 91.2
3jzd_A358 Iron-containing alcohol dehydrogenase; YP_298327.1, put 90.83
1oj7_A408 Hypothetical oxidoreductase YQHD; structural genomics; 90.31
3l8m_A212 Probable thiamine pyrophosphokinase; thiamin diphosphat 90.8
2ejc_A280 Pantoate--beta-alanine ligase; X-RAY diffraction, struc 90.37
>2hig_A 6-phospho-1-fructokinase; transferase; 2.40A {Trypanosoma brucei} PDB: 3f5m_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=721.89  Aligned_cols=363  Identities=26%  Similarity=0.335  Sum_probs=333.0

Q ss_pred             HHHHCCHHHCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEECCCCCHHHHHHH
Q ss_conf             98733212103487633799983687751489999999999998569978999838366010799130462698888746
Q gi|254780227|r   14 WILTGVLSFLEKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQL   93 (426)
Q Consensus        14 ~~~~g~~~~~~~~~~~krI~IltsGG~aPG~N~~I~~iv~~a~~~~~~~~v~G~~~G~~GL~~~~~~~l~~l~~~~v~~~   93 (426)
                      +-++|||+.++|+|++.|||||||||||||||++||++++++...+++++||||++||+||++++..++.+++++++++|
T Consensus        82 ~~~~g~r~~~~~~p~~~rIgIltsGGdaPGmNavIr~vv~~a~~~~~~~~V~Gi~~G~~GLi~~~~~~~~~L~~~~v~~i  161 (487)
T 2hig_A           82 CELAAARSRIHFNPTETTIGIVTCGGICPGLNDVIRSITLTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNI  161 (487)
T ss_dssp             EEECCCBSEESSCGGGCEEEEEECSSCCTTHHHHHHHHHHHHHHHHCCSEEEECSTGGGGGSHHHHTTCEEECHHHHTTG
T ss_pred             CCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             21259965213588885899988578847689999999999999659938999841148860599754101899998408


Q ss_pred             HHCCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             40787400336788865301110123456745699999999863998899948825789999999999851899628852
Q gi|254780227|r   94 LSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGL  173 (426)
Q Consensus        94 ~~~GGt~LgtsR~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~Id~Li~IGGdgS~~~a~~L~e~~~~~~~~i~vigi  173 (426)
                      .++|||+|||||++.                 +.++++++|++++||+|++||||||+++|+.|++++.+++++|+||||
T Consensus       162 ~~~GGtiLGTsR~~e-----------------~~~~i~~~L~~~~Id~LivIGGdgS~~~A~~Lae~~~~~~~~i~VIGI  224 (487)
T 2hig_A          162 HHYGGTILGSSRGPQ-----------------DPKEMVDTLERLGVNILFTVGGDGTQRGALVISQEAKRRGVDISVFGV  224 (487)
T ss_dssp             GGSSSCSSCCCCSCC-----------------CHHHHHHHHHHHTCSEEEEEECHHHHHHHHHHHHHHHHHTCCCEEEEE
T ss_pred             HHCCCCEECCCCCCC-----------------CHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             856970612589985-----------------699999999984998799956747899999999998862898329984


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHC
Q ss_conf             22234772221146335659999999999999877516661699997698742899998740143323101111111000
Q gi|254780227|r  174 PKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSP  253 (426)
Q Consensus       174 PKTIDNDi~~td~tiGfdTA~~~~a~~i~~l~~~A~s~~~~~~iVEvMGR~aG~LAl~~ala~ga~~~~i~~~~~~~~~~  253 (426)
                      ||||||||++||+|||||||+++++++|++++.||.|++++|||||+|||+|||||+++|||+++               
T Consensus       225 PKTIDNDl~gtD~TiGFdTAv~~~~~ai~~l~~dA~S~~r~v~iVEvMGR~aG~LAl~aalA~g~---------------  289 (487)
T 2hig_A          225 PKTIDNDLSFSHRTFGFQTAVEKAVQAIRAAYAEAVSANYGVGVVKLMGRDSGFIAAQAAVASAQ---------------  289 (487)
T ss_dssp             ECCTTSSCCCSSCCTTHHHHHHHHHHHHHHHHHHHHTSTTEEEEEEECCSSCCHHHHHHHHHHTC---------------
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHCC---------------
T ss_conf             02556887760235635579999999999998875533566079996687654899999986288---------------


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             14576523287865598999999999850289538995042111111012320112222234445443556648999999
Q gi|254780227|r  254 DFKGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADK  333 (426)
Q Consensus       254 ~~~~~d~iliPE~~~~~~~~~~~i~~~~~~~~~~vIVvsEG~~~~~~~~~~~~~~~~~~~d~~g~~~l~~~~i~~~La~~  333 (426)
                          +|+|||||.|++++.+++.++++++++++++||||||+..++..       .....+.++|.++.  +++.+|+++
T Consensus       290 ----ad~ilIPE~~~~~~~i~~~i~~~~~~~~~~vIVVaEG~~~~~~~-------~~~~~~~~g~~~~~--~ig~~l~~~  356 (487)
T 2hig_A          290 ----ANICLVPENPISEQEVMSLLERRFCHSRSCVIIVAEGFGQDWGR-------GSGGYDASGNKKLI--DIGVILTEK  356 (487)
T ss_dssp             ----CSEEECTTSCCCHHHHHHHHHHHTTSCSEEEEEEETTTTGGGCC-------C--CBCTTSCBCCC--CHHHHHHHH
T ss_pred             ----CCEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCC-------CCCCCCCCCCCCCC--CHHHHHHHH
T ss_conf             ----73897788889999999999998723797549970452245554-------32221455681201--078999999


Q ss_pred             HHHHHCC-------CCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEEEHHHHCCCC
Q ss_conf             9987187-------431884188612355898679999999999999999779986699998598699643089852688
Q gi|254780227|r  334 FANMIKA-------ERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKFEDIRGGR  406 (426)
Q Consensus       334 i~~~~~~-------~~~~~~~lGy~qRgg~Ps~~Dr~~a~~lG~~Av~~~~~G~sgvmv~i~~~~~~~~~i~~~~i~~~k  406 (426)
                      +++.+..       ..+|+++|||+||||+||+|||.||++||+.||+++++|+||+||+++++++.++|++ .++...|
T Consensus       357 i~~~l~~~~~~~~~~~vr~~~lGy~qRgg~Psa~Dr~~a~~lG~~AV~~l~~G~tg~mV~i~~~~~~~vPl~-~v~~~~k  435 (487)
T 2hig_A          357 VKAFLKANKSRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHNNYILVPIK-VATSVRR  435 (487)
T ss_dssp             HHHHHHTTTTTSSSCEEEEECCHHHHHSSCCCHHHHHHHHHHHHHHHHHHHTTEESEEEEEETTEEEEEEHH-HHTTEEE
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCCEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCEEEEEEHH-HHHCCCC
T ss_conf             999998764225771599942783402789988999999999999999997799987999999999996499-9965587


Q ss_pred             CCCCCHHHHHHHHHHC
Q ss_conf             2077758999999844
Q gi|254780227|r  407 VFDTNTPWFSDILRHT  422 (426)
Q Consensus       407 ~vd~~~~~~~~~l~~~  422 (426)
                      .|||++.+|+++++.+
T Consensus       436 ~vd~~~~~~~~~r~~~  451 (487)
T 2hig_A          436 VLDLRGQLWRQVREIT  451 (487)
T ss_dssp             EECTTSHHHHHHHHHS
T ss_pred             CCCCCCHHHHHHHHHC
T ss_conf             6799827999999972



>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3hno_A Pyrophosphate-dependent phosphofructokinase; structural genomics, PSI-2, protein structure initiative; 2.00A {Nitrosospira multiformis atcc 25196} PDB: 3k2q_A Back     alignment and structure
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>2f48_A Diphosphate--fructose-6-phosphate 1- phosphotransferase; HET: FBP; 2.11A {Borrelia burgdorferi B31} SCOP: c.89.1.1 PDB: 1kzh_A* Back     alignment and structure
>3pfk_A Phosphofructokinase; transferase(phosphotransferase); 2.40A {Geobacillus stearothermophilus} SCOP: c.89.1.1 PDB: 4pfk_A* 6pfk_A 1mto_A* Back     alignment and structure
>1zxx_A 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1pfk_A Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} SCOP: c.89.1.1 PDB: 2pfk_A Back     alignment and structure
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2} Back     alignment and structure
>3pfn_A NAD kinase; structural genomics consortium, SNP, SGC, transferase; 2.70A {Homo sapiens} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP complex, transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 2i2f_A* 2q5f_A* Back     alignment and structure
>2bon_A Lipid kinase; DAG kinase, ATP-binding, transferase; 1.9A {Escherichia coli} SCOP: e.52.1.2 PDB: 2jgr_A 2p1r_A Back     alignment and structure
>1yt5_A Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1z0s_A Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} SCOP: e.52.1.1 PDB: 1z0u_A* 1z0z_A* 1suw_A* Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural genomics, JCSG, protein structure initiative, PSI; HET: NAP; 1.78A {Thermotoga maritima MSB8} SCOP: e.22.1.2 Back     alignment and structure
>3iv7_A Alcohol dehydrogenase IV; NP_602249.1, iron-containing alcohol dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha JMP134} Back     alignment and structure
>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 Back     alignment and structure
>3l8m_A Probable thiamine pyrophosphokinase; thiamin diphosphate biosynthetic process, ATP binding, structural genomics, PSI-2; 2.40A {Staphylococcus saprophyticus} Back     alignment and structure
>2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 426 pyrophosphate--fructose-6-phosphate 1-phosphotransferas
d2f48a1550 c.89.1.1 (A:4-553) Pyrophosphate-dependent phosphofruct 2e-44
d1pfka_320 c.89.1.1 (A:) ATP-dependent phosphofructokinase {Escher 3e-27
d4pfka_319 c.89.1.1 (A:) ATP-dependent phosphofructokinase {Bacill 3e-24
>d2f48a1 c.89.1.1 (A:4-553) Pyrophosphate-dependent phosphofructokinase {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Length = 550 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphofructokinase
superfamily: Phosphofructokinase
family: Phosphofructokinase
domain: Pyrophosphate-dependent phosphofructokinase
species: Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]
 Score =  174 bits (441), Expect = 2e-44
 Identities = 78/413 (18%), Positives = 152/413 (36%), Gaps = 65/413 (15%)

Query: 31  KVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNA 90
            +  + +GG AP   ++I  + +   K  P ++L  ++ G  GLL +DKI +TE +  + 
Sbjct: 71  NIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINS- 129

Query: 91  EQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDT 150
               + GG  I +S            R  I+ +E+    +     ++ +  +  IGGDD+
Sbjct: 130 --YRNTGGFDIVSSG-----------RTKIETEEH-YNKALFVAKENNLNAIIIIGGDDS 175

Query: 151 NTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIH--QSLGALTAAQVSACFFDNISNER 208
           NT A  L  Y K+   NI V+G+PKTID D+   H   S G  +A ++ +    N+  + 
Sbjct: 176 NTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDA 235

Query: 209 SATPRSLIIHEVMGRNCGWLTAYSA---HCYLNMIQDRNYIDGFIFSPDF---------- 255
            +T +     ++MGR+   +    A   H  + ++ +         S             
Sbjct: 236 MSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKR 295

Query: 256 ----KGIDGVYLPEMSFNLEVEIERLSKVMEKKGSVAIFVSEGACRDVIMDNRLSSGEK- 310
                    V +PE       E++ L   +           +G   + + +  ++     
Sbjct: 296 SLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDY 355

Query: 311 --------------------IKRDSFGHILLDKMNVGSWFADKFANMIKAERS------- 343
                               ++RD  G+  + ++     F +   + +   +        
Sbjct: 356 MKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGS 415

Query: 344 ---IVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNI 393
              +    GY  RSA   + D      +   AV   ++G++G     +  N  
Sbjct: 416 FTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLK 468


>d1pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Escherichia coli [TaxId: 562]} Length = 320 Back     information, alignment and structure
>d4pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 319 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target426 pyrophosphate--fructose-6-phosphate 1-phosphotransferas
d2f48a1550 Pyrophosphate-dependent phosphofructokinase {Lyme disea 100.0
d4pfka_319 ATP-dependent phosphofructokinase {Bacillus stearotherm 100.0
d1pfka_320 ATP-dependent phosphofructokinase {Escherichia coli [Ta 100.0
d2bona1295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 95.5
d2qv7a1312 Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxI 95.15
d1u0ta_302 Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacter 94.37
d1z0sa1249 Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglo 94.55
d1rrma_385 Lactaldehyde reductase FucO {Escherichia coli [TaxId: 5 93.14
d1vlja_398 NADH-dependent butanol dehydrogenase A (TM0820) {Thermo 92.55
d1o2da_359 Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxI 91.92
d1jq5a_366 Glycerol dehydrogenase {Bacillus stearothermophilus [Ta 91.38
>d2f48a1 c.89.1.1 (A:4-553) Pyrophosphate-dependent phosphofructokinase {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphofructokinase
superfamily: Phosphofructokinase
family: Phosphofructokinase
domain: Pyrophosphate-dependent phosphofructokinase
species: Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]
Probab=100.00  E-value=0  Score=629.57  Aligned_cols=360  Identities=21%  Similarity=0.252  Sum_probs=302.1

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEECCCCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             76337999836877514899999999999985699789998383660107991304626988887464078740033678
Q gi|254780227|r   27 MVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNSRV  106 (426)
Q Consensus        27 ~~~krI~IltsGG~aPG~N~~I~~iv~~a~~~~~~~~v~G~~~G~~GL~~~~~~~l~~l~~~~v~~~~~~GGt~LgtsR~  106 (426)
                      ....|||||||||||||||++|+|++++++.++++++||||++||+||++++++   +++++.++.|.++||+.|++||.
T Consensus        67 ~~~~rIgIl~sGG~aPG~N~vI~gvv~~~~~~~~~~~v~G~~~G~~GL~~~~~~---~L~~~~v~~~~~~GG~~l~~s~r  143 (550)
T d2f48a1          67 SKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKI---ELTESLINSYRNTGGFDIVSSGR  143 (550)
T ss_dssp             CSCCEEEEEEBSSCCTTHHHHHHHHHHHHHHHCTTCEEEEETTTTHHHHTTCEE---EECHHHHHHHTTCCSSTTTCCBC
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHCCCCEE---ECCHHHHHHHHHCCCCEECCCCC
T ss_conf             898779998967872889999999999999858998999988503886489879---89999983487279907217999


Q ss_pred             CCCCCCHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCC--C
Q ss_conf             88653011101234567456999999998639988999488257899999999998518996288522223477222--1
Q gi|254780227|r  107 KLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIP--I  184 (426)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~Id~Li~IGGdgS~~~a~~L~e~~~~~~~~i~vigiPKTIDNDi~~--t  184 (426)
                      ..+            ++++++++++++|++++||+||+||||||+++|+.|+|++++++++|+||||||||||||++  |
T Consensus       144 ~~~------------~~~e~~~~i~~~l~~~~Id~LviIGGd~S~~~a~~Lae~~~~~~~~i~vigvPKTIDNDl~~~~~  211 (550)
T d2f48a1         144 TKI------------ETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHI  211 (550)
T ss_dssp             CCC------------CSHHHHHHHHHHHHHTTCSEEEEEESHHHHHHHHHHHHHHHHTTCCCEEEEEEEETTCCCCCSSC
T ss_pred             CCC------------CCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCC
T ss_conf             997------------67788899999998648887999898379999999999999718996289702443678777655


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             14633565999999999999987751666169999769874289999874014332310111111100014576523287
Q gi|254780227|r  185 HQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLP  264 (426)
Q Consensus       185 d~tiGfdTA~~~~a~~i~~l~~~A~s~~~~~~iVEvMGR~aG~LAl~~ala~ga~~~~i~~~~~~~~~~~~~~~d~iliP  264 (426)
                      |+|||||||+++++++|++++.||.|++++|||||||||+|||||++||||++|+                    +|+||
T Consensus       212 d~s~GfdTA~~~~~~~i~~l~~da~S~~~~~~~VevMGR~aG~lAl~~alat~a~--------------------~ilip  271 (550)
T d2f48a1         212 EISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPN--------------------ICIVS  271 (550)
T ss_dssp             CCCEEHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCTTSCHHHHHHHHHHCCS--------------------EECCH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHCCCC--------------------EEEEC
T ss_conf             6654277899999999999998876435634899980687718899999861886--------------------59833


Q ss_pred             CCCCC----H----HHHHHHHHH-HHHCCCCEEEEEECCCCCCCCHHH--------------------------------
Q ss_conf             86559----8----999999999-850289538995042111111012--------------------------------
Q gi|254780227|r  265 EMSFN----L----EVEIERLSK-VMEKKGSVAIFVSEGACRDVIMDN--------------------------------  303 (426)
Q Consensus       265 E~~~~----~----~~~~~~i~~-~~~~~~~~vIVvsEG~~~~~~~~~--------------------------------  303 (426)
                      |.+++    +    +.++..+.+ ...+++|++|+||||+.....+-.                                
T Consensus       272 E~~~~~~~~L~~i~~~i~~~I~kR~~~gk~~gvIvV~EGli~~ipe~~~Li~el~~~l~~~~~~~~~~~~~~~~~~~~~~  351 (550)
T d2f48a1         272 EEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAK  351 (550)
T ss_dssp             HHHHHTTCCHHHHHHHHHHHHHHHHHTTCCCEEEEEETTGGGTSHHHHHHHHHHHHHHHHSHHHHTTCCHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             64464010178999999999999997289838999547321036678899999987654023210122201234455542


Q ss_pred             -----------------HHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC----------CEEEECCCCCCCCCC
Q ss_conf             -----------------32011222223444544355664899999999871874----------318841886123558
Q gi|254780227|r  304 -----------------RLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKAE----------RSIVQKSGYFARSAP  356 (426)
Q Consensus       304 -----------------~~~~~~~~~~d~~g~~~l~~~~i~~~La~~i~~~~~~~----------~~~~~~lGy~qRgg~  356 (426)
                                       .+......++|+|||++++.++++++|++++++++..+          ...++.+||+|||+.
T Consensus       352 ls~~~~~l~~~lp~~i~~qll~~~~~rD~~G~~~ls~I~~e~lLa~~V~~~L~~~~~~~~~~~~f~~~~h~~GYe~R~a~  431 (550)
T d2f48a1         352 LSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAF  431 (550)
T ss_dssp             SCHHHHHHHHTSCHHHHHHHHHHHHTCCTTCCCCCTTSCHHHHHHHHHHHHHHHHHTTTCCCSCCCEEEEEESHHHHTSC
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCEECCC
T ss_conf             01344444302617788887530136488888633454577999999999998766403344312454426653231779


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCC-----EEEEEEEHHHHCC-------------CCCCCCCHHHHHHH
Q ss_conf             98679999999999999999779986699998598-----6996430898526-------------88207775899999
Q gi|254780227|r  357 SGSEDLSLIKKMVVLAVDSAISGISGVTGEDEREN-----NILRIIKFEDIRG-------------GRVFDTNTPWFSDI  418 (426)
Q Consensus       357 Ps~~Dr~~a~~lG~~Av~~~~~G~sgvmv~i~~~~-----~~~~~i~~~~i~~-------------~k~vd~~~~~~~~~  418 (426)
                      ||+||+.||++||+.||+++++|+||+|+++++.+     +....+|+..+.+             +..||+++..|+.+
T Consensus       432 PS~fD~~~a~~lG~~Av~~~~~G~tG~M~~I~~l~~~~~~w~~~~iPl~~~m~~e~r~g~~~~~i~k~~v~l~~~~f~~~  511 (550)
T d2f48a1         432 PSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEF  511 (550)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHTTCCSEEEEEECTTSCGGGCEEEEEEGGGGEEEEEETTEEEEEECCCCCCTTSHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEEECCCCHHHHHHHHHHCCCCCCCEECCEECCCCHHHHHH
T ss_conf             99899999999999999999769988799884798897214887856899950787469867533055268886899999


Q ss_pred             HHH
Q ss_conf             984
Q gi|254780227|r  419 LRH  421 (426)
Q Consensus       419 l~~  421 (426)
                      ...
T Consensus       512 ~~~  514 (550)
T d2f48a1         512 VKN  514 (550)
T ss_dssp             HHH
T ss_pred             HHH
T ss_conf             999



>d4pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 426 pyrophosphate--fructose-6-phosphate 1-phosphotrans
3hno_A_1-148_302-364211 (A:1-148,A:302-364) Pyrophosphate-dependent phosph 9e-27
2hig_A_28-234_388-429249 (A:28-234,A:388-429) 6-phospho-1-fructokinase; tra 6e-24
2f48_A_1-211_433-504283 (A:1-211,A:433-504) Diphosphate--fructose-6-phosph 1e-22
1pfk_A_1-132_254-306185 (A:1-132,A:254-306) Phosphofructokinase; transfera 7e-19
3pfk_A_1-131_251-305186 (A:1-131,A:251-305) Phosphofructokinase; transfera 8e-19
1zxx_A_1-131_253-303182 (A:1-131,A:253-303) 6-phosphofructokinase; alloste 1e-18
2hig_A_235-387_441-487200 (A:235-387,A:441-487) 6-phospho-1-fructokinase; tr 1e-18
3hno_A_149-301153 (A:149-301) Pyrophosphate-dependent phosphofructok 8e-15
2f48_A_212-315_388-432_505-555200 (A:212-315,A:388-432,A:505-555) Diphosphate--fruct 1e-14
3pfk_A_132-250_306-319133 (A:132-250,A:306-319) Phosphofructokinase; transfe 2e-14
1pfk_A_133-253_307-320135 (A:133-253,A:307-320) Phosphofructokinase; transfe 3e-14
1zxx_A_132-252121 (A:132-252) 6-phosphofructokinase; allosteric regu 1e-12
>3hno_A (A:1-148,A:302-364) Pyrophosphate-dependent phosphofructokinase; structural genomics, PSI-2, protein structure initiative; 2.00A {Nitrosospira multiformis atcc 25196} PDB: 3k2q_ALength = 211 Back     alignment and structure
 Score =  115 bits (290), Expect = 9e-27
 Identities = 34/160 (21%), Positives = 58/160 (36%), Gaps = 10/160 (6%)

Query: 27  MVAHKVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIY-YRFGYQGLLLDDKITITED 85
           M A    +  +GG+   +++    +I    K   K   IY  R G  G L +D I   ++
Sbjct: 1   MAAKNAFYAQSGGVTAVINASAAGVIEAARKQSGKIGRIYAGRNGIIGALTEDLIDTGQE 60

Query: 86  MRQNAEQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTI 145
                  L        G+ R KL +         ++++    E          +      
Sbjct: 61  SDAAISALRYTPSGAFGSCRYKLKS---------LEQNRREYERLIEVFKAHDIGYFFYN 111

Query: 146 GGDDTNTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIH 185
           GG D+  T   + +      Y I  + +PKT+DND+   H
Sbjct: 112 GGGDSADTCLKVSQLSGTLGYPIQAIHVPKTVDNDLPARH 151


>2hig_A (A:28-234,A:388-429) 6-phospho-1-fructokinase; transferase; 2.40A {Trypanosoma brucei} PDB: 3f5m_A*Length = 249 Back     alignment and structure
>2f48_A (A:1-211,A:433-504) Diphosphate--fructose-6-phosphate 1- phosphotransferase; HET: FBP; 2.11A {Borrelia burgdorferi B31}Length = 283 Back     alignment and structure
>1pfk_A (A:1-132,A:254-306) Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli}Length = 185 Back     alignment and structure
>3pfk_A (A:1-131,A:251-305) Phosphofructokinase; transferase(phosphotransferase); 2.40A {Bacillus stearothermophilus}Length = 186 Back     alignment and structure
>1zxx_A (A:1-131,A:253-303) 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp}Length = 182 Back     alignment and structure
>2hig_A (A:235-387,A:441-487) 6-phospho-1-fructokinase; transferase; 2.40A {Trypanosoma brucei} PDB: 3f5m_A*Length = 200 Back     alignment and structure
>3hno_A (A:149-301) Pyrophosphate-dependent phosphofructokinase; structural genomics, PSI-2, protein structure initiative; 2.00A {Nitrosospira multiformis atcc 25196} PDB: 3k2q_ALength = 153 Back     alignment and structure