254780228

254780228

hypothetical protein CLIBASIA_00565

GeneID in NCBI database:8209209Locus tag:CLIBASIA_00565
Protein GI in NCBI database:254780228Protein Accession:YP_003064641.1
Gene range:+(116798, 117838)Protein Length:346aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09799 hypothetical protein
SEED prediction:Integral membrane protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM10 TM-Helix
TOPPRED6 TM-Helix
HMMTOP10 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS10 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccc
MKSNSLYASLIHHFRWAILVTVAGFLCGLgigwqfthtlsgtISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTInpieamnlaiyspQDYLKIISqahvpisgfgGTFLMMVSLTFffnsqnklHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGisnilptnemysfvsSSTAAIIIFYGINFLESVlssdssnnvthgkhglNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNkykylehgsYYSIFVLSVIMFLQTIvdipeiftgtsSTILIFLSIYSSIKNK
MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSiyssiknk
MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
***********HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE****************GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
*****LYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiii
SSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target346 hypothetical protein CLIBASIA_00565 [Candidatus Liberib
315122332384 hypothetical protein CKC_02920 [Candidatus Liberibacter 1 1e-132
222107044353 hypothetical protein Avi_6115 [Agrobacterium vitis S4] 1 3e-97
150376529365 hypothetical protein Smed_4388 [Sinorhizobium medicae W 1 4e-96
84499490357 hypothetical protein OB2597_06165 [Oceanicola batsensis 1 6e-95
227820093362 hypothetical protein NGR_b18640 [Sinorhizobium fredii N 1 9e-95
327189635362 hypothetical protein RHECNPAF_570029 [Rhizobium etli CN 1 2e-94
190893419389 hypothetical protein RHECIAT_CH0003846 [Rhizobium etli 1 2e-94
86359171463 hypothetical protein RHE_CH03581 [Rhizobium etli CFN 42 1 3e-94
209550908363 hypothetical protein Rleg2_3332 [Rhizobium leguminosaru 1 7e-94
241206320363 hypothetical protein Rleg_3632 [Rhizobium leguminosarum 1 1e-93
>gi|315122332|ref|YP_004062821.1| hypothetical protein CKC_02920 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 384 Back     alignment and organism information
 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 249/347 (71%), Positives = 300/347 (86%), Gaps = 1/347 (0%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MK N     +IHHFRWAILVT+ G L  +GIGW+ +HTLSGT   +YICIILA++EISLS
Sbjct: 1   MKINPFQIDIIHHFRWAILVTIIGILLSIGIGWETSHTLSGTSEILYICIILAIIEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
            +NAILNAKN+QKMS +WQ+RFLTWGI+IAVFGMRI+FPI+IVCIV+TINPIEA+ +AI+
Sbjct: 61  CDNAILNAKNIQKMSPLWQRRFLTWGIVIAVFGMRIVFPIIIVCIVATINPIEAVKIAIF 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
           SPQDYLKIIS AH+PI+GFGGTFLMMVSLTFFFN    +HWI+FLEI MS+LS+I+GIK 
Sbjct: 121 SPQDYLKIISDAHIPIAGFGGTFLMMVSLTFFFNRNKNIHWINFLEIPMSYLSRIRGIKF 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-SNNVTHGKHGLN 239
           F+VL +I GIS IL   ++Y  + SST A++ FY INFLES+LS D+ + +V   KHGL+
Sbjct: 181 FLVLLLIIGISCILSIRDIYILIFSSTFALMTFYAINFLESILSGDNQTKSVAQKKHGLS 240

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           LFLYLEIIDASLS DGVISSFAITKNFFII+IGLTIGA+YVRSMT+LMLK+G+L KYKYL
Sbjct: 241 LFLYLEIIDASLSFDGVISSFAITKNFFIIIIGLTIGAVYVRSMTVLMLKKGMLQKYKYL 300

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHGS+YSIFVLS++MFLQT++++PEIFTGTSS +LI LSIYSSIKN 
Sbjct: 301 EHGSFYSIFVLSIVMFLQTVINVPEIFTGTSSVLLIILSIYSSIKND 347


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222107044|ref|YP_002547835.1| hypothetical protein Avi_6115 [Agrobacterium vitis S4] Length = 353 Back     alignment and organism information
>gi|150376529|ref|YP_001313125.1| hypothetical protein Smed_4388 [Sinorhizobium medicae WSM419] Length = 365 Back     alignment and organism information
>gi|84499490|ref|ZP_00997778.1| hypothetical protein OB2597_06165 [Oceanicola batsensis HTCC2597] Length = 357 Back     alignment and organism information
>gi|227820093|ref|YP_002824064.1| hypothetical protein NGR_b18640 [Sinorhizobium fredii NGR234] Length = 362 Back     alignment and organism information
>gi|327189635|gb|EGE56785.1| hypothetical protein RHECNPAF_570029 [Rhizobium etli CNPAF512] Length = 362 Back     alignment and organism information
>gi|190893419|ref|YP_001979961.1| hypothetical protein RHECIAT_CH0003846 [Rhizobium etli CIAT 652] Length = 389 Back     alignment and organism information
>gi|86359171|ref|YP_471063.1| hypothetical protein RHE_CH03581 [Rhizobium etli CFN 42] Length = 463 Back     alignment and organism information
>gi|209550908|ref|YP_002282825.1| hypothetical protein Rleg2_3332 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 363 Back     alignment and organism information
>gi|241206320|ref|YP_002977416.1| hypothetical protein Rleg_3632 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 363 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target346 hypothetical protein CLIBASIA_00565 [Candidatus Liberib
PRK14013338 PRK14013, PRK14013, hypothetical protein; Provisional 1e-115
COG2899346 COG2899, COG2899, Uncharacterized protein conserved in 2e-82
pfam04332294 pfam04332, DUF475, Protein of unknown function (DUF475) 4e-66
pfam03741184 pfam03741, TerC, Integral membrane protein TerC family 1e-04
TIGR03716215 TIGR03716, R_switched_YkoY, integral membrane protein, 8e-04
>gnl|CDD|184451 PRK14013, PRK14013, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|32724 COG2899, COG2899, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|113115 pfam04332, DUF475, Protein of unknown function (DUF475) Back     alignment and domain information
>gnl|CDD|146399 pfam03741, TerC, Integral membrane protein TerC family Back     alignment and domain information
>gnl|CDD|163428 TIGR03716, R_switched_YkoY, integral membrane protein, YkoY family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 346 hypothetical protein CLIBASIA_00565 [Candidatus Liberib
COG2899346 Uncharacterized protein conserved in bacteria [Function 100.0
COG0861254 TerC Membrane protein TerC, possibly involved in tellur 100.0
pfam04332294 DUF475 Protein of unknown function (DUF475). Predicted 100.0
pfam03741184 TerC Integral membrane protein TerC family. This family 100.0
COG0861254 TerC Membrane protein TerC, possibly involved in tellur 97.2
pfam03741184 TerC Integral membrane protein TerC family. This family 96.86
pfam01914203 MarC MarC family integral membrane protein. Integral me 96.73
PRK10995222 multiple drug resistance protein MarC; Provisional 96.42
PRK11469206 hypothetical protein; Provisional 94.85
PRK10739197 putative dITP- and XTP- hydrolase; Provisional 94.52
TIGR00949194 2A76 Homoserine/Threonine efflux protein; InterPro: IPR 93.57
>COG2899 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0861 TerC Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam04332 DUF475 Protein of unknown function (DUF475) Back     alignment and domain information
>pfam03741 TerC Integral membrane protein TerC family Back     alignment and domain information
>COG0861 TerC Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam03741 TerC Integral membrane protein TerC family Back     alignment and domain information
>pfam01914 MarC MarC family integral membrane protein Back     alignment and domain information
>PRK10995 multiple drug resistance protein MarC; Provisional Back     alignment and domain information
>PRK11469 hypothetical protein; Provisional Back     alignment and domain information
>PRK10739 putative dITP- and XTP- hydrolase; Provisional Back     alignment and domain information
>TIGR00949 2A76 Homoserine/Threonine efflux protein; InterPro: IPR004778 Proteins in this group include, A chemotactic transduction protein from Pseudomonas aeruginosa Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00