254780234

254780234

argininosuccinate synthase

GeneID in NCBI database:8209215Locus tag:CLIBASIA_00595
Protein GI in NCBI database:254780234Protein Accession:YP_003064647.1
Gene range:-(127808, 129022)Protein Length:404aa
Gene description:argininosuccinate synthase
COG prediction:[E] Argininosuccinate synthase
KEGG prediction:argG; argininosuccinate synthase (EC:6.3.4.5); K01940 argininosuccinate synthase [EC:6.3.4.5]
SEED prediction:Argininosuccinate synthase (EC 6.3.4.5)
Pathway involved in KEGG:Alanine, aspartate and glutamate metabolism [PATH:las00250]
Arginine and proline metabolism [PATH:las00330]
Subsystem involved in SEED:Arginine Biosynthesis extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNKV
ccccccEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccEEHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccccccccccccccEEccccEEEEEcccccccccccccHHHHHccccHHHcccccEEEEEEEEccEEEEEccccccHHHHHHHHHHHHHHcccccEEEEccEEEEEEEEEEEEcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEEccHHHccHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHccc
cccccEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHccHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccEEEEHHHHHcccccEEEEcccccccccHHHHHHHHHHccccccccccccccccHHHHHHccccccccccccccccHHHHHHHcccHHccccccEEEEEEEccccEEEEccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEEEEccccccccHHHcccccccccccHHHHHHHHHHHccHHHHHHHHccc
MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANEtgadaiahgstgkgndQVRFELSAyslnsdieiiapwrhwsfkGRQDLIDFaekhaipidknkrgeapfsidtnllhsssegrvledpsqpapeyvykmivspeeapdtpttiridfqrgdpiaingqvmsPEVLLEQLNQygrcngigridivenRFVGiksrgvyetpggtiLLHAHRAIESisldsgsahlKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLklykgnvmvvgresnkslysdklvtfeddldaynqsdseGFIKLHALRLRTLARRNKV
MSRDVKKVVLaysggldtsiILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAiahgstgkgndQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAipidknkrgeapFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSitlklykgnvMVVGRESNKSLYSDKLVTFEDDLDAynqsdsegfikLHALRLRtlarrnkv
MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKlhalrlrtlarrNKV
****VKK*VLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLAR****
MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNKV
***DVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRN**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNKV
MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNKV
MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNKV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target404 argininosuccinate synthase [Candidatus Liberibacter asi
315122791408 argininosuccinate synthase [Candidatus Liberibacter sol 1 0.0
241206724407 argininosuccinate synthase [Rhizobium leguminosarum bv. 1 0.0
116254242407 argininosuccinate synthase [Rhizobium leguminosarum bv. 1 0.0
227823766525 argininosuccinate synthase [Sinorhizobium fredii NGR234 1 0.0
222087492407 argininosuccinate synthase [Agrobacterium radiobacter K 1 0.0
15966962405 argininosuccinate synthase [Sinorhizobium meliloti 1021 1 0.0
86359504407 argininosuccinate synthase [Rhizobium etli CFN 42] Leng 1 0.0
209551290407 argininosuccinate synthase [Rhizobium leguminosarum bv. 1 0.0
190893772407 argininosuccinate synthase protein [Rhizobium etli CIAT 1 0.0
150398257405 argininosuccinate synthase [Sinorhizobium medicae WSM41 1 0.0
>gi|315122791|ref|YP_004063280.1| argininosuccinate synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 408 Back     alignment and organism information
 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/403 (87%), Positives = 384/403 (95%)

Query: 1   MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKE 60
           MS+++KKVVLAYSGGLDTSIILKWLQVEKGLEV+VFIADLGQGEEL  A DKA+LLGAKE
Sbjct: 1   MSKNIKKVVLAYSGGLDTSIILKWLQVEKGLEVVVFIADLGQGEELTAACDKAKLLGAKE 60

Query: 61  VYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGS 120
           VYVKDLRREFVRDFVFPMFRANALYEG YLLGTAIARPLI+KYLVDIA ETGADA+AHGS
Sbjct: 61  VYVKDLRREFVRDFVFPMFRANALYEGCYLLGTAIARPLISKYLVDIARETGADAVAHGS 120

Query: 121 TGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFS 180
           TGKGNDQVRFELSAYSLNSDIEIIAPWRHW FKGRQDL++FAEK+AIPIDKNKRGEAPFS
Sbjct: 121 TGKGNDQVRFELSAYSLNSDIEIIAPWRHWDFKGRQDLLEFAEKNAIPIDKNKRGEAPFS 180

Query: 181 IDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVM 240
           +DTNLLHSSSEGRVLEDPS+PAP+YVYK  +SPEEAPD+PT I+IDFQRGDP++ING++M
Sbjct: 181 VDTNLLHSSSEGRVLEDPSEPAPDYVYKTTISPEEAPDSPTLIKIDFQRGDPVSINGELM 240

Query: 241 SPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSG 300
            PEVLL++LNQYG  NGIGRIDIVENRF+GIKSRGVYETPGGTILLHAHRAIESISLDSG
Sbjct: 241 PPEVLLDKLNQYGSSNGIGRIDIVENRFIGIKSRGVYETPGGTILLHAHRAIESISLDSG 300

Query: 301 SAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRES 360
           +AHLKD+LM RYA+++YQGFWFSPEREMLQALIDKSQEYV+G++ LKLYKGNVMVVGRES
Sbjct: 301 AAHLKDELMPRYANLIYQGFWFSPEREMLQALIDKSQEYVQGTVALKLYKGNVMVVGRES 360

Query: 361 NKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNK 403
           N+SLY DKLVTFEDDLD YNQ DSEGFIKL ALRLRTLARR K
Sbjct: 361 NQSLYLDKLVTFEDDLDTYNQGDSEGFIKLQALRLRTLARRKK 403


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241206724|ref|YP_002977820.1| argininosuccinate synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 407 Back     alignment and organism information
>gi|116254242|ref|YP_770080.1| argininosuccinate synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 407 Back     alignment and organism information
>gi|227823766|ref|YP_002827739.1| argininosuccinate synthase [Sinorhizobium fredii NGR234] Length = 525 Back     alignment and organism information
>gi|222087492|ref|YP_002546029.1| argininosuccinate synthase [Agrobacterium radiobacter K84] Length = 407 Back     alignment and organism information
>gi|15966962|ref|NP_387315.1| argininosuccinate synthase [Sinorhizobium meliloti 1021] Length = 405 Back     alignment and organism information
>gi|86359504|ref|YP_471396.1| argininosuccinate synthase [Rhizobium etli CFN 42] Length = 407 Back     alignment and organism information
>gi|209551290|ref|YP_002283207.1| argininosuccinate synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 407 Back     alignment and organism information
>gi|190893772|ref|YP_001980314.1| argininosuccinate synthase protein [Rhizobium etli CIAT 652] Length = 407 Back     alignment and organism information
>gi|150398257|ref|YP_001328724.1| argininosuccinate synthase [Sinorhizobium medicae WSM419] Length = 405 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target404 argininosuccinate synthase [Candidatus Liberibacter asi
PRK00509399 PRK00509, PRK00509, argininosuccinate synthase; Provisi 0.0
PLN00200404 PLN00200, PLN00200, argininosuccinate synthase; Provisi 1e-176
cd01999385 cd01999, Argininosuccinate_Synthase, Argininosuccinate 1e-159
pfam00764389 pfam00764, Arginosuc_synth, Arginosuccinate synthase 1e-141
TIGR00032394 TIGR00032, argG, argininosuccinate synthase 1e-128
KOG1706412 KOG1706, KOG1706, KOG1706, Argininosuccinate synthase [ 1e-123
PRK13820394 PRK13820, PRK13820, argininosuccinate synthase; Provisi 1e-116
PRK04527400 PRK04527, PRK04527, argininosuccinate synthase; Provisi 2e-52
COG0137403 COG0137, ArgG, Argininosuccinate synthase [Amino acid t 1e-162
PRK05370447 PRK05370, PRK05370, argininosuccinate synthase; Validat 3e-30
COG0037298 COG0037, MesJ, Predicted ATPase of the PP-loop superfam 1e-04
cd01992185 cd01992, PP-ATPase, N-terminal domain of predicted ATPa 0.002
COG0482356 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thi 2e-04
COG1606269 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop 7e-04
cd01990202 cd01990, Alpha_ANH_like_I, This is a subfamily of Adeni 0.003
>gnl|CDD|179051 PRK00509, PRK00509, argininosuccinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|177791 PLN00200, PLN00200, argininosuccinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|30186 cd01999, Argininosuccinate_Synthase, Argininosuccinate synthase Back     alignment and domain information
>gnl|CDD|109807 pfam00764, Arginosuc_synth, Arginosuccinate synthase Back     alignment and domain information
>gnl|CDD|129143 TIGR00032, argG, argininosuccinate synthase Back     alignment and domain information
>gnl|CDD|36918 KOG1706, KOG1706, KOG1706, Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184346 PRK13820, PRK13820, argininosuccinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|179859 PRK04527, PRK04527, argininosuccinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|30486 COG0137, ArgG, Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180043 PRK05370, PRK05370, argininosuccinate synthase; Validated Back     alignment and domain information
>gnl|CDD|30386 COG0037, MesJ, Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|30179 cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|30830 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31794 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|30177 cd01990, Alpha_ANH_like_I, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 404 argininosuccinate synthase [Candidatus Liberibacter asi
PRK00509398 argininosuccinate synthase; Provisional 100.0
TIGR00032420 argG argininosuccinate synthase; InterPro: IPR001518 Ar 100.0
pfam00764389 Arginosuc_synth Arginosuccinate synthase. This family c 100.0
COG0137403 ArgG Argininosuccinate synthase [Amino acid transport a 100.0
cd01999385 Argininosuccinate_Synthase Argininosuccinate synthase. 100.0
PRK13820395 argininosuccinate synthase; Provisional 100.0
PRK04527397 argininosuccinate synthase; Provisional 100.0
PRK05370447 argininosuccinate synthase; Validated 100.0
KOG1706412 consensus 100.0
PRK00143355 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.76
cd01998349 tRNA_Me_trans tRNA methyl transferase. This family repr 99.71
pfam03054354 tRNA_Me_trans tRNA methyl transferase. This family repr 99.7
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nucleot 99.4
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [Gener 99.36
PRK11106231 queuosine biosynthesis protein QueC; Provisional 99.27
cd01712177 ThiI ThiI is required for thiazole synthesis in the thi 99.21
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle contr 99.18
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine nucleo 99.17
TIGR00268263 TIGR00268 conserved hypothetical protein TIGR00268; Int 99.08
COG0603222 Predicted PP-loop superfamily ATPase [General function 99.04
cd01995169 ExsB ExsB is a transcription regulator related protein. 99.0
KOG2805377 consensus 98.99
pfam02568197 ThiI Thiamine biosynthesis protein (ThiI). ThiI is requ 98.88
PRK10660433 tilS tRNA(Ile)-lysidine synthetase; Provisional 98.87
pfam01171182 ATP_bind_3 PP-loop family. This family of proteins belo 98.79
PRK10696311 C32 tRNA thiolase; Provisional 98.75
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of the 98.71
TIGR00364227 TIGR00364 exsB protein; InterPro: IPR004479 This protei 98.68
PRK08349198 hypothetical protein; Validated 98.64
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine nucleo 98.63
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthetase. 98.58
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide 98.46
pfam01507174 PAPS_reduct Phosphoadenosine phosphosulfate reductase f 98.45
cd01713173 PAPS_reductase This domain is found in phosphoadenosine 98.43
PRK00074513 guaA GMP synthase; Reviewed 98.42
TIGR02432204 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro 98.4
PRK13795630 hypothetical protein; Provisional 98.37
pfam00733195 Asn_synthase Asparagine synthase. This family is always 98.33
PRK13794473 hypothetical protein; Provisional 98.32
PRK01269483 thiamine biosynthesis protein ThiI; Provisional 98.29
COG2117198 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouri 98.26
COG2102223 Predicted ATPases of PP-loop superfamily [General funct 98.25
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransfe 98.24
COG0301383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzym 98.19
PRK08557420 hypothetical protein; Provisional 98.17
PRK08576439 hypothetical protein; Provisional 98.12
PRK01565399 thiamine biosynthesis protein ThiI; Provisional 98.12
PRK13980264 NAD synthetase; Provisional 97.98
COG1365255 Predicted ATPase (PP-loop superfamily) [General functio 97.96
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which cataly 97.96
PRK13981543 NAD synthetase; Provisional 97.95
pfam02540243 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is 97.9
TIGR00289227 TIGR00289 conserved hypothetical protein TIGR00289; Int 97.85
TIGR03183447 DNA_S_dndC putative sulfurtransferase DndC. Members of 97.49
PRK06850488 hypothetical protein; Provisional 97.43
PRK00768274 nadE NAD synthetase; Reviewed 97.21
TIGR00342391 TIGR00342 thiamine biosynthesis/tRNA modification prote 97.2
PTZ00323294 NAD+ synthase; Provisional 97.19
PRK00876325 nadE NAD synthetase; Reviewed 97.19
PRK08384310 thiamine biosynthesis protein ThiI; Provisional 97.16
COG0171268 NadE NAD synthase [Coenzyme metabolism] 97.1
PRK02090243 phosphoadenosine phosphosulfate reductase; Provisional 96.36
COG0482356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate 99.72
PRK02628678 nadE NAD synthetase; Reviewed 97.04
TIGR02039295 CysD sulfate adenylyltransferase, small subunit; InterP 94.88
TIGR00420394 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.4
pfam01902219 ATP_bind_4 ATP-binding region. This family of proteins 98.38
pfam06508137 ExsB ExsB. This family includes putative transcriptiona 99.05
PRK00919306 GMP synthase subunit B; Validated 98.6
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases supe 98.55
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme has b 98.35
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagine Sy 98.3
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine nucle 98.21
TIGR01536646 asn_synth_AEB asparagine synthase (glutamine-hydrolyzin 98.13
PRK09431555 asnB asparagine synthetase B; Provisional 98.05
COG0367542 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino 98.04
PTZ00077610 asparagine synthetase; Provisional 97.9
cd0198486 AANH_like Adenine nucleotide alpha hydrolases superfami 97.74
TIGR03108628 eps_aminotran_1 exosortase 1 system-associated amidotra 97.73
TIGR03104589 trio_amidotrans asparagine synthase family amidotransfe 97.65
KOG0571543 consensus 96.5
cd01987124 USP_OKCHK USP domain is located between the N-terminal 94.11
TIGR00884319 guaA_Cterm GMP synthase, C-terminal domain; InterPro: I 98.43
PRK12563312 sulfate adenylyltransferase subunit 2; Provisional 96.45
PRK05253300 sulfate adenylyltransferase subunit 2; Provisional 96.25
KOG1622552 consensus 97.55
PRK09590104 celB cellobiose phosphotransferase system IIB component 94.98
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme 92.94
COG3969407 Predicted phosphoadenosine phosphosulfate sulfotransfer 92.51
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan 90.29
PRK05406246 LamB/YcsF family protein; Provisional 91.47
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>pfam00764 Arginosuc_synth Arginosuccinate synthase Back     alignment and domain information
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK05370 argininosuccinate synthase; Validated Back     alignment and domain information
>KOG1706 consensus Back     alignment and domain information
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>pfam03054 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR00268 TIGR00268 conserved hypothetical protein TIGR00268; InterPro: IPR005232 This family of conserved hypothetical proteins has no known function but is predicted to be part of the wider PP-loop superfamily Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>KOG2805 consensus Back     alignment and domain information
>pfam02568 ThiI Thiamine biosynthesis protein (ThiI) Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>pfam01171 ATP_bind_3 PP-loop family Back     alignment and domain information
>PRK10696 C32 tRNA thiolase; Provisional Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro: IPR012795 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>pfam00733 Asn_synthase Asparagine synthase Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>PRK01269 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>pfam02540 NAD_synthase NAD synthase Back     alignment and domain information
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237 This family of conserved hypothetical proteins has no known function Back     alignment and domain information
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>TIGR00342 TIGR00342 thiamine biosynthesis/tRNA modification protein ThiI; InterPro: IPR003720 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit; InterPro: IPR011784 Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2 Back     alignment and domain information
>pfam01902 ATP_bind_4 ATP-binding region Back     alignment and domain information
>pfam06508 ExsB ExsB Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426 These sequences represent glutamine-hydrolysing asparagine synthase Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00077 asparagine synthetase; Provisional Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>KOG0571 consensus Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase, C-terminal domain; InterPro: IPR001674 The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only] Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK05406 LamB/YcsF family protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target404 argininosuccinate synthase [Candidatus Liberibacter asi
1kh1_A400 Crystal Structure Of Thermus Thermophilus Hb8 Argin 1e-152
1vl2_A421 Crystal Structure Of Argininosuccinate Synthase (Tm 1e-139
2nz2_A404 Crystal Structure Of Human Argininosuccinate Syntha 1e-125
1k97_A455 Crystal Structure Of E. Coli Argininosuccinate Synt 9e-90
2der_A380 Cocrystal Structure Of An Rna Sulfuration Enzyme Mn 2e-05
2pg3_A232 Crystal Structure Of Hypothetical Protein (Yp_04926 3e-04
2ywc_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 8e-04
2ywb_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 8e-04
gi|20150774|pdb|1KH1|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 Argininosuccinate Synthetase Length = 400 Back     alignment and structure
 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 237/397 (59%), Positives = 297/397 (74%), Gaps = 3/397 (0%)

Query: 7   KVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDL 66
           K+VLAYSGGLDTSIILKWL+     EVI F AD+GQGEE++ A +KA   GA +    DL
Sbjct: 2   KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61

Query: 67  RREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGND 126
           + EFVRDFVFPM RA A+YEGYYLLGT+IARPLIAK+LV IA E GA+AIAHG+TGKGND
Sbjct: 62  KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121

Query: 127 QVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLL 186
           QVRFEL+AY+L  DI++IAPWR WSF+GR+++I +AE H IP+   +    P+S+D NLL
Sbjct: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEK--PYSMDANLL 179

Query: 187 HSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLL 246
           H S EG VLEDP    P+ +++M   PEEAPD P  + ++F  GDP+A+NG+ +SP  LL
Sbjct: 180 HISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALL 239

Query: 247 EQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKD 306
           ++LN+ G  +G+GR+DIVENRFVG+KSRGVYETPGGTIL HA RA+ES++LD    H +D
Sbjct: 240 QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRD 299

Query: 307 DLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYS 366
            L  +YA +VY GFW++PERE LQA  D     V G   LKLYKGNV VVGR++ KSLY 
Sbjct: 300 MLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYR 359

Query: 367 DKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNK 403
             LV+F D+   Y+Q D+EGFIK+ ALRLR  A   +
Sbjct: 360 QDLVSF-DEAGGYDQKDAEGFIKIQALRLRVRALVER 395


>gi|52696139|pdb|1VL2|A Chain A, Crystal Structure Of Argininosuccinate Synthase (Tm1780) From Thermotoga Maritima At 1.65 A Resolution Length = 421 Back     alignment and structure
>gi|17943194|pdb|1K97|A Chain A, Crystal Structure Of E. Coli Argininosuccinate Synthetase In Complex With Aspartate And Citrulline Length = 455 Back     alignment and structure
>gi|114793688|pdb|2DER|A Chain A, Cocrystal Structure Of An Rna Sulfuration Enzyme Mnma And Trna-Glu In The Initial Trna Binding State Length = 380 Back     alignment and structure
>gi|146387132|pdb|2PG3|A Chain A, Crystal Structure Of Hypothetical Protein (Yp_049261.1) From Erwinia Carotovora Subsp. Atroseptica Scri1043 At 2.40 A Resolution Length = 232 Back     alignment and structure
>gi|159795613|pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
gi|159795609|pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target404 argininosuccinate synthase [Candidatus Liberibacter asi
1kor_A400 Argininosuccinate synthetase; ligase, riken structural 1e-160
1k92_A455 Argininosuccinate synthase, argininosuccinate; N-type A 1e-139
1vl2_A421 Argininosuccinate synthase; TM1780, structural genomics 1e-137
2nz2_A413 Argininosuccinate synthase; amino-acid biosynthesis, as 1e-135
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 1e-09
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis 4e-09
2c5s_A413 THII, probable thiamine biosynthesis protein THII; RNA- 8e-05
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, hypot 2e-05
2der_A380 TRNA-specific 2-thiouridylase MNMA; protein-RNA complex 4e-05
2hma_A376 Probable tRNA (5-methylaminomethyl-2- thiouridylate)-me 0.004
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Length = 400 Back     alignment and structure
 Score =  560 bits (1445), Expect = e-160
 Identities = 237/397 (59%), Positives = 298/397 (75%), Gaps = 3/397 (0%)

Query: 7   KVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDL 66
           K+VLAYSGGLDTSIILKWL+     EVI F AD+GQGEE++ A +KA   GA +    DL
Sbjct: 2   KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61

Query: 67  RREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGND 126
           + EFVRDFVFPM RA A+YEGYYLLGT+IARPLIAK+LV IA E GA+AIAHG+TGKGND
Sbjct: 62  KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121

Query: 127 QVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDTNLL 186
           QVRFEL+AY+L  DI++IAPWR WSF+GR+++I +AE H IP+   +  E P+S+D NLL
Sbjct: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQ--EKPYSMDANLL 179

Query: 187 HSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLL 246
           H S EG VLEDP    P+ +++M   PEEAPD P  + ++F  GDP+A+NG+ +SP  LL
Sbjct: 180 HISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALL 239

Query: 247 EQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKD 306
           ++LN+ G  +G+GR+DIVENRFVG+KSRGVYETPGGTIL HA RA+ES++LD    H +D
Sbjct: 240 QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRD 299

Query: 307 DLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYS 366
            L  +YA +VY GFW++PERE LQA  D     V G   LKLYKGNV VVGR++ KSLY 
Sbjct: 300 MLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYR 359

Query: 367 DKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNK 403
             LV+F++    Y+Q D+EGFIK+ ALRLR  A   +
Sbjct: 360 QDLVSFDEA-GGYDQKDAEGFIKIQALRLRVRALVER 395


>1k92_A Argininosuccinate synthase, argininosuccinate; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Length = 455 Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Length = 421 Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, structural genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Length = 413 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Length = 203 Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Length = 219 Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Length = 413 Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Length = 232 Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Length = 380 Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Length = 376 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target404 argininosuccinate synthase [Candidatus Liberibacter asi
1kor_A400 Argininosuccinate synthetase; ligase, riken structural 100.0
2nz2_A413 Argininosuccinate synthase; amino-acid biosynthesis, as 100.0
1vl2_A421 Argininosuccinate synthase; TM1780, structural genomics 100.0
1k92_A455 Argininosuccinate synthase, argininosuccinate; N-type A 100.0
2hma_A376 Probable tRNA (5-methylaminomethyl-2- thiouridylate)-me 99.75
2der_A380 TRNA-specific 2-thiouridylase MNMA; protein-RNA complex 99.73
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 99.44
2c5s_A413 THII, probable thiamine biosynthesis protein THII; RNA- 99.24
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, hypot 99.21
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzing] su 99.18
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP- 99.13
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis 98.92
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligas 98.92
1ni5_A433 Putative cell cycle protein MESJ; structural genomics, 98.84
2vxo_A697 GMP synthase [glutamine-hydrolyzing]; proto-oncogene, p 98.82
3p52_A249 NH(3)-dependent NAD(+) synthetase; structural genomics, 98.78
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferase, li 98.74
3fiu_A249 NH(3)-dependent NAD(+) synthetase; rossman fold, adenin 98.74
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structural g 98.64
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine amidotra 98.64
2d13_A227 Hypothetical protein PH1257; structural genomics, NPPSF 98.61
3dpi_A285 NAD+ synthetase; ssgcid, decode, structural genomics, P 98.54
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP synthetase, X 98.51
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfide cr 98.31
1kqp_A271 NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; liga 98.23
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3-phosp 98.18
1wxi_A275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase 98.15
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel, swi 97.97
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cluster 97.86
1vbk_A307 Hypothetical protein PH1313; structural genomics, riken 97.68
3n05_A590 NH(3)-dependent NAD(+) synthetase; ligase, structural g 97.19
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate redu 97.09
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferase, nu 97.05
3dla_A680 Glutamine-dependent NAD(+) synthetase; glutaminase, amm 96.55
1ct9_A553 Asparagine synthetase B; amidotransferase, substrate ch 98.23
1q15_A503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lac 98.19
1jgt_A513 Beta-lactam synthetase; asparagine synthetase, clavulan 98.18
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/beta p 96.28
1xw8_A252 UPF0271 protein YBGL; NESG, northeast structural genomi 91.48
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_IIB_L 91.08
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1176.40  Aligned_cols=394  Identities=60%  Similarity=1.016  Sum_probs=388.5

Q ss_pred             EEEEEECCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             89999147725999999998718986999994578711068999999973980799820089999987999973686547
Q gi|254780234|r    7 KVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYE   86 (404)
Q Consensus         7 kVvlaySGGLDTSv~i~~L~~e~g~eVi~~~~d~Gq~~d~~~~~~~A~~~Ga~~~~v~D~r~ef~~~~i~~~I~ana~Ye   86 (404)
                      |||||||||||||||++||+++||+|||||++|+||++|++.+++||.++||++++++|+|+||+++||||+|+|||+||
T Consensus         2 KVvLAySGGLDTSv~l~wL~e~~~~eVi~~~~d~Gq~~d~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~p~i~ana~Ye   81 (400)
T 1kor_A            2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDLKEEFVRDFVFPMMRAGAVYE   81 (400)
T ss_dssp             EEEEECCSSHHHHHHHHHHHHHHTCEEEEEEEESSCSSCHHHHHHHHHHHTCSEEEEEECHHHHHHHTHHHHHHTTCCBT
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
T ss_conf             69999489817999999997405988999997088667669999999984998899975799999999999997386557


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCEEECHHHCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             87420130124335999999988568928750011168215679999998587970774410068763799999999708
Q gi|254780234|r   87 GYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAEKHA  166 (404)
Q Consensus        87 g~Ypl~tslaRplia~~lv~~a~~~ga~~iaHG~TgkGNDQvRFe~~~~~l~P~l~viaP~Rd~~~~sRe~~i~ya~~~g  166 (404)
                      |+|||+|||+|||||+++|++|+++||++||||||||||||||||+++++|+|+++||||||||+|.||+++|+||++||
T Consensus        82 ~~Y~l~tslaRplia~~~v~~A~~~ga~~iaHG~TGkGNDQvRFe~~~~al~P~l~iiaPwRd~~~~sR~~~i~ya~~~g  161 (400)
T 1kor_A           82 GYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGNDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHG  161 (400)
T ss_dssp             TTBCCTTTTHHHHHHHHHHHHHHHHTCSEEECCCCTTSSHHHHHHHHHHHHCTTCEEECGGGTCCCCSHHHHHHHHHHTT
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHHCCCCEEECCCHHCCCCCHHHHHHHHHHCC
T ss_conf             87623454106479999999985449769943777578723668889997599974850101025366799999999849


Q ss_pred             CCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCHHHCCCCCCHHHCCCCCEEEEEEEECCEEEEECCEECCHHHHH
Q ss_conf             96756656788641572431154576324584576820100146581227999638999995024787516231899999
Q gi|254780234|r  167 IPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAINGQVMSPEVLL  246 (404)
Q Consensus       167 Ipv~~~~~~~~~yS~D~Nlwg~S~Egg~Ledp~~~~pe~~~~~t~~p~~ap~~pe~v~I~Fe~G~PVainG~~~~~~~li  246 (404)
                      ||++++++  +|||+|+||||+|+|||+|||||++||+++|.||++|++|||+|++|+|+|++|+||+|||++++|++||
T Consensus       162 Ipv~~~~~--~~yS~D~NLwg~S~Egg~Ledp~~~~pe~~~~~t~~p~~apd~pe~v~I~Fe~G~Pv~ing~~~~~~eli  239 (400)
T 1kor_A          162 IPVPVTQE--KPYSMDANLLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALL  239 (400)
T ss_dssp             CCCC-------CCEEEECSSCEEEESGGGGCTTSCCCTTCCSSSCCGGGSCSSCEEEEEEEETTEEEEETTEECCHHHHH
T ss_pred             CCCCCCCC--CCCCCCCCHHCEECCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCEEEEEEEECCEEEEECCCCCCHHHHH
T ss_conf             99865678--8875465533022267664587766551213455796678998769876756566887678057899999


Q ss_pred             HHHHHHHHHCCCCCEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCHHH
Q ss_conf             99988864216374100077320210001113737899999999998650899999999999999999875351469899
Q gi|254780234|r  247 EQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPER  326 (404)
Q Consensus       247 ~~LN~igg~~GvGr~d~vEnr~vG~KsR~vYEaPga~iL~~Ahr~LE~~~l~~~~~~~K~~~~~~~a~lvy~G~wf~p~~  326 (404)
                      ++||+|||+|||||+||||||+|||||||||||||++||++|||+||++||||+++++|++++++|++|||+|+||||+|
T Consensus       240 ~~LN~i~g~~GIGr~d~vEnr~vG~KsR~vYEaPg~tiL~~AHr~LE~~tLdr~~~~~K~~l~~~~a~lvY~G~wfsP~r  319 (400)
T 1kor_A          240 QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDMLSPKYAELVYYGFWYAPER  319 (400)
T ss_dssp             HHHHHHHHHTTCCEEEEEEECTTSCEEEEEEECHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHTCSSSHHH
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCHHH
T ss_conf             99998742312153230054202542354226827999999999999871779999999999999999985461678899


Q ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCEEEEEEEECCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHCCC
Q ss_conf             99999999972336739999990615999877278310883222301577878887854788870334898884178
Q gi|254780234|r  327 EMLQALIDKSQEYVEGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNK  403 (404)
Q Consensus       327 ~~l~a~i~~~q~~VtG~V~l~L~kG~~~v~gr~S~~sLy~~~~as~~~~~~~~~~~da~GFi~i~~l~~~~~~~~~k  403 (404)
                      ++|++||+++|++|||+|+|+|||||++++||+||+|||++++|||+++ +.|+|+||+|||+|++|++|++++++|
T Consensus       320 ~~l~afi~~tq~~VtG~V~lkLykG~~~v~gr~S~~sLY~~~~as~~~~-~~~~~~da~GFi~i~~l~~k~~a~~~~  395 (400)
T 1kor_A          320 EALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYRQDLVSFDEA-GGYDQKDAEGFIKIQALRLRVRALVER  395 (400)
T ss_dssp             HHHHHHHHHHHTTCCEEEEEEEETTEEEEEEEECTTCCCC-----------CCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHCCCEEEEEEEEECCEEEEEEEECCCCCCCCCCCCCCCC-CCCCHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             9999999996395369999999788389998789620158623415689-997968807889974688999999864



>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, structural genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii OT3} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphatase, transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli K12} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2d13_A Hypothetical protein PH1257; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Pyrococcus horikoshii} SCOP: c.26.2.1 PDB: 3h7e_A* 1ru8_A Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway; 2.10A {Thermus thermophilus HB8} PDB: 2ywc_A* Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1kqp_A NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Back     alignment and structure
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3dla_A Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic acid, AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Back     alignment and structure
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Back     alignment and structure
>1xw8_A UPF0271 protein YBGL; NESG, northeast structural genomics consortium, structural genomics, protein structure initiative, PSI, X-RAY; 2.00A {Escherichia coli} SCOP: c.6.2.5 Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 404 argininosuccinate synthase [Candidatus Liberibacter asi
d1j20a2225 d.210.1.1 (A:171-395) Argininosuccinate synthetase, C-t 2e-78
d1vl2a2236 d.210.1.1 (A:174-409) Argininosuccinate synthetase, C-t 2e-74
d1k92a2256 d.210.1.1 (A:189-444) Argininosuccinate synthetase, C-t 7e-62
d1k92a1188 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-term 4e-34
d1j20a1165 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-term 8e-29
d1vl2a1168 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-term 2e-28
d2c5sa1218 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI 1e-10
d2pg3a1230 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC 2e-06
>d1j20a2 d.210.1.1 (A:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 225 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Argininosuccinate synthetase, C-terminal domain
superfamily: Argininosuccinate synthetase, C-terminal domain
family: Argininosuccinate synthetase, C-terminal domain
domain: Argininosuccinate synthetase, C-terminal domain
species: Thermus thermophilus [TaxId: 274]
 Score =  286 bits (734), Expect = 2e-78
 Identities = 125/226 (55%), Positives = 162/226 (71%), Gaps = 1/226 (0%)

Query: 178 PFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTTIRIDFQRGDPIAING 237
           P+S+D NLLH S EG VLEDP    P+ +++M   PEEAPD P  + ++F  GDP+A+NG
Sbjct: 1   PYSMDANLLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNG 60

Query: 238 QVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPGGTILLHAHRAIESISL 297
           + +SP  LL++LN+ G  +G+GR+DIVENRFVG+KSRGVYETPGGTIL HA RA+ES++L
Sbjct: 61  ERLSPAALLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTL 120

Query: 298 DSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYVEGSITLKLYKGNVMVVG 357
           D    H +D L  +YA +VY GFW++PERE LQA  D     V G   LKLYKGNV VVG
Sbjct: 121 DREVLHQRDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVG 180

Query: 358 RESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLARRNK 403
           R++ KSLY   LV+F++    Y+Q D+EGFIK+ ALRLR  A   +
Sbjct: 181 RKAPKSLYRQDLVSFDEA-GGYDQKDAEGFIKIQALRLRVRALVER 225


>d1vl2a2 d.210.1.1 (A:174-409) Argininosuccinate synthetase, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 236 Back     information, alignment and structure
>d1k92a2 d.210.1.1 (A:189-444) Argininosuccinate synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 165 Back     information, alignment and structure
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 168 Back     information, alignment and structure