254780233

254780233

GTP-binding protein

GeneID in NCBI database:8209214Locus tag:CLIBASIA_00590
Protein GI in NCBI database:254780233Protein Accession:YP_003064646.1
Gene range:-(125840, 127714)Protein Length:624aa
Gene description:GTP-binding protein
COG prediction:[T] Predicted membrane GTPase involved in stress response
KEGG prediction:GTP-binding protein; K06207 GTP-binding protein
SEED prediction:GTP-binding protein TypA/BipA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Universal GTPases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620----
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRKGKSVNLEYNV
cEEccHHHHHccccccccccEEEEEEcccccHHHHHHHHHHHHccccccccEEEEEEcccHHHHHccEEEEEEEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccHHHHHHHHHHcccccccccccccEEEEEEEcccccccEEEEEEEEEEEEcccEEEEEcccccEEEEEEEEEEEEEEccccEEEEEEccccEEEEEccccccccEEEEccccccccccccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEEEccccccEEEEEEcHHHHHHHHHHHHHcccEEEEcccEEEEEEEcccccccEEEEEEEEccccccHHHHHHHHcccEEEccEEccccEEEEEEEEcHHHHHcHHHHHHHHcccEEEEEEEEccccccccccccccccEEEEccccEEEEEEHHHHHHHHHHEEccccEEEccEEEEEEccccccEEEEEcccccccEEccccccEEEEcccccccHHHHHHHccccEEEEEccccEEEEEHHccHHHHHHHHHHHHccccc
cccccccHHHHHHHHHHHccEEEEEccccccHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHcccEEEccccHEcccccEEEEEccccccccccHHHHHHHccccEEEEEEcccccccccHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHccccHHHccccEEEEEccccccccccccccccccHHHHHHHHHccccccccccccEEEEEEcccccccEEEEEEEEEEEEEccccEEEEEcccccEEEccEEEEEEEccccccccHHHHccccEEEEEcccccccccccccccccccccccccccccEEEEEEEcccccccccccEEcHHHHHHHHHHHHHccEEEEEEcccccccEEEccccHHHHHHHHHHHHHcccEEEEcccEEEEEEEcccEcccccEEEEEccHHHHHHHHHHHHcccccHHHcccccccEEEEEEEEcccccccccccHHccccccHHHHHcccccccccccccccccEEEEEccccHHHHHHHHcHHHcccEEEccccEEEEEEEEEEEccccccEEEcccccccccEEccccccEEEccccHHHcHHHHHHHHccccEEEccHHHHHHHHHHccHHHHHHHHcccccHccc
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLkqsgvfrdnqrvSERVMDCNDLEKERGITILAKVTSIVWndvrinivdtpghadfggeVERILCMVESVVVLVdaaegpmpqtkfvvgkalkiglrpivvvnkvdrsdaraDEVINEVFDLFSaldatdaqldfpilygsgrfgwmsdssdgsrdqgmvPLLNLivdhvpppvisegefkMIGTIlekdpflgrivtgrihsgtiksnqnikalspdgalvEVGRVSKILAfrgidrqpideahagdIVSIAGLVKatvadtfcdpsideplkaqpidpptvtmtfgvndsplagtegdkvtSRMIRDRLFKEAEGNIAlkieessskdaffvsgrgELQLAVLIETMRREGFElavsrprvvikkegdsllepiEEVVIDVDEEHSGAVVQKMTLHKsemielrpsgtgrvrlvflsptrgligyqsqlmtdTRGTAIMNRLFhsyqphkgeiggrsngvllsneEGKVVAYALFNledrgsmivepgdkvyQGMIVGIHtrendldvnvlkgkkltnmrasgkdeAVKLVPAVKMTLEQALSWIQndelvevtPKSIRLRKmyldpnerkrkgksvnleynv
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLkqsgvfrdnqrvservmdcndlekergitilakvtsivwndVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKfvvgkalkiglrpivvvnkvdrsdarADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRihsgtiksnqnikalspdgalVEVGRVSKILAFrgidrqpideaHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMtfgvndsplagtegdkvtsRMIRDRLFKEAEGnialkieessskdaffvsgRGELQLAVLIETMRREgfelavsrprvvikkegdsllepiEEVVIDVDEEHSGAVVQKMtlhksemielrpsgtgrvRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIhtrendldvnvLKGKKltnmrasgkdeavKLVPAVKMTLEQAlswiqndelvevtpksirlrkmyldpnerkrkgksvnleynv
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPieevvidvdeeHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRKGKSVNLEYNV
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSD*S**QGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYL******************
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNER*************
**YDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRK**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRKGKSVNLEYNV
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRKGKSVNLEYNV
MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRKGKSVNLEYNV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target624 GTP-binding protein [Candidatus Liberibacter asiaticus
254780321606 GTP-binding protein LepA [Candidatus Liberibacter 2e-29
254780264701 elongation factor G [Candidatus Liberibacter asiat 8e-19
254780264701 elongation factor G [Candidatus Liberibacter asiat 4e-17
254780263392 translation elongation factor Tu [Candidatus Liber 4e-18
254780150392 translation elongation factor Tu [Candidatus Liber 4e-18
254780787884 translation initiation factor IF-2 [Candidatus Lib 2e-07
>gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Back     alignment
 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 118/400 (29%), Positives = 189/400 (47%), Gaps = 43/400 (10%)

Query: 18  QIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKV--- 74
           +IRN +I+AH+DHGK+TL D  ++      + + +S +V+D  D+E+ERGITI A+    
Sbjct: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE-MSSQVLDNMDIERERGITIKAQTVRL 68

Query: 75  --TSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALK 132
             TS    D ++N++DTPGH DF  EV R L   E  +++VDA +G   QT   V +A+ 
Sbjct: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128

Query: 133 IGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDG 192
                I V+NK D   A  D V  ++ +    +   DA      L  S + G        
Sbjct: 129 NNHEIITVLNKADLPSADPDRVKKQIEETI-GISTEDA------LLVSAKTG-------- 173

Query: 193 SRDQGMVPLLNLIVDHVPPPVISEGEFKMIGTIL---EKDPFLGRIVTGRIHSGTIKSNQ 249
              +G+  LL  IV  +P P   EG    +  +L     + +LG +V  RI +G +   Q
Sbjct: 174 ---EGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQ 230

Query: 250 NIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAG-DIVSIAGLVKATVADTFCD--- 305
           +I+ +  + A  +V R+  IL  + ID + +     G  I SI  +    V DT  D   
Sbjct: 231 SIRLMGTN-AKYQVERIG-ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSS 288

Query: 306 PSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEES 365
           P+       +PI P      F     P+  T+ + + + + + RL    + + + ++E S
Sbjct: 289 PTTSALPGFKPIQPVVFCGLF-----PVDATQFENLRTAINKLRL---NDASFSFELENS 340

Query: 366 SSKDAFFVSG-RGELQLAVLIETMRRE-GFELAVSRPRVV 403
           ++    F  G  G L L ++ E + RE    L  + P VV
Sbjct: 341 TALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVV 380

>gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Back     alignment
 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 76/137 (55%), Gaps = 7/137 (5%)

Query: 20  RNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSE--RVMDCNDLEKERGITILAKVTSI 77
           RN  I+AH+D GKTT  + +L  +G       V +    MD  + E+ERGITI +  T++
Sbjct: 11  RNFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTV 70

Query: 78  VW-----NDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALK 132
            W        ++ I+DTPGH DF  EVER + + +  + L+D+  G  PQT+ V  +A K
Sbjct: 71  FWPGRDGGQKKLTIIDTPGHVDFTMEVERSIRVTDGAIALLDSNAGVEPQTETVWRQADK 130

Query: 133 IGLRPIVVVNKVDRSDA 149
             +  ++  NK+D+  A
Sbjct: 131 YSVPRVIFCNKMDKMGA 147

>gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Back     alignment
 Score = 81.6 bits (200), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 109/238 (45%), Gaps = 44/238 (18%)

Query: 174 FPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPV-------------------- 213
           FP+L GS             +++G+ PLL+ +VD++P P+                    
Sbjct: 260 FPVLCGSS-----------FKNKGVQPLLDAVVDYLPSPLDVRAIKGVDVKSNSEIDVSA 308

Query: 214 ISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFR 273
           +      M+   +  D F+G +   RI+SG I    ++  L+      E  RV ++L   
Sbjct: 309 VDSSPLSMLAFKVMADSFVGSLTFCRIYSGKISKGDSL--LNTVKGKKE--RVGRMLQMH 364

Query: 274 GIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPL 333
              R+ IDEA+ GDI+++AGL + T  DT CDPS   P+  + +D P   +   +     
Sbjct: 365 SNSREDIDEAYCGDIIALAGLKETTTGDTLCDPS--RPIVLERMDFPEPVIQIAIEPK-- 420

Query: 334 AGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRRE 391
             ++GD+    +   RL  E   + +L++    +     +SG GEL L ++++ M RE
Sbjct: 421 --SKGDQERMSLALSRLVAE---DPSLRVSMDPNSGQTNLSGMGELHLEIIVDRMLRE 473

>gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Back     alignment
 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 131/284 (46%), Gaps = 37/284 (13%)

Query: 22  IAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWND 81
           ++ I HVDHGKTTL   + K    +   ++     +D    EK RGITI     S   + 
Sbjct: 15  LSTIGHVDHGKTTLTAAITK----YYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK 70

Query: 82  VRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVV- 140
              + +D PGHAD+   +       +  +++  A +GP PQT+  +  A +IG+  IVV 
Sbjct: 71  RFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVY 130

Query: 141 VNKVDRSDARADEVIN----EVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQ 196
           +NKVD  D   DE+++    E+ DL      +D   D PI+ GS        + +   D 
Sbjct: 131 MNKVDAVD--DDELLDISEYEIRDLLKEHKYSD---DTPIIRGSALCALQGTNKELGEDS 185

Query: 197 GMVPLLNLIVDHVPPPVIS---------EGEFKMIGTILEKDPFLGRIVTGRIHSGTIKS 247
            +  L+  +  H+P P  S         EG   + G         G +VTG I  G IK+
Sbjct: 186 -IHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGR--------GTVVTGCIKRGRIKA 236

Query: 248 NQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSI 291
             +++ +   G  ++V + + +  F    R+ +DEA AGD V +
Sbjct: 237 GSDVEIIGMGGKKLKV-KCTDVEMF----RKKLDEAIAGDNVGL 275

>gi|254780150|ref|YP_003064563.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Back     alignment
 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 131/284 (46%), Gaps = 37/284 (13%)

Query: 22  IAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWND 81
           ++ I HVDHGKTTL   + K    +   ++     +D    EK RGITI     S   + 
Sbjct: 15  LSTIGHVDHGKTTLTAAITK----YYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK 70

Query: 82  VRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVV- 140
              + +D PGHAD+   +       +  +++  A +GP PQT+  +  A +IG+  IVV 
Sbjct: 71  RFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVY 130

Query: 141 VNKVDRSDARADEVIN----EVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQ 196
           +NKVD  D   DE+++    E+ DL      +D   D PI+ GS        + +   D 
Sbjct: 131 MNKVDAVD--DDELLDISEYEIRDLLKEHKYSD---DTPIIRGSALCALQGTNKELGEDS 185

Query: 197 GMVPLLNLIVDHVPPPVIS---------EGEFKMIGTILEKDPFLGRIVTGRIHSGTIKS 247
            +  L+  +  H+P P  S         EG   + G         G +VTG I  G IK+
Sbjct: 186 -IHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGR--------GTVVTGCIKRGRIKA 236

Query: 248 NQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSI 291
             +++ +   G  ++V + + +  F    R+ +DEA AGD V +
Sbjct: 237 GSDVEIIGMGGKKLKV-KCTDVEMF----RKKLDEAIAGDNVGL 275

>gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Back     alignment
 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%), Gaps = 22/145 (15%)

Query: 6   GLFFIYGRLGYMQIRN--IAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLE 63
           G+F +      + IR   + I+ HVDHGKT+L+D + K                   D+ 
Sbjct: 368 GIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKA------------------DVA 409

Query: 64  KER--GITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMP 121
           K    GIT       + +    I  +DTPGHA F     R   + +  V+++ A E  MP
Sbjct: 410 KGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMP 469

Query: 122 QTKFVVGKALKIGLRPIVVVNKVDR 146
           Q    +  A    +  IV +NK+D+
Sbjct: 470 QAIESINHAKAADVSIIVAINKIDK 494

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target624 GTP-binding protein [Candidatus Liberibacter asiaticus
315122790608 GTP-binding protein [Candidatus Liberibacter solanacear 1 0.0
15966843608 GTP-binding protein [Sinorhizobium meliloti 1021] Lengt 1 0.0
150398173608 GTP-binding protein TypA [Sinorhizobium medicae WSM419] 1 0.0
227823713608 GTP-binding protein TypA [Sinorhizobium fredii NGR234] 1 0.0
49474983608 GTP-binding protein typA [Bartonella henselae str. Hous 1 0.0
319408146608 GTP-binding protein TypA [Bartonella schoenbuchensis R1 1 0.0
86359496606 GTP-binding elongation factor protein (tyrosin phosphor 1 0.0
319899258607 GTP-binding protein TypA [Bartonella clarridgeiae 73] L 1 0.0
319406120607 GTP-binding protein TypA [Bartonella sp. AR 15-3] Lengt 1 0.0
306841562608 GTP-binding protein TypA [Brucella sp. BO2] Length = 60 1 0.0
>gi|315122790|ref|YP_004063279.1| GTP-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 608 Back     alignment and organism information
 Score = 1117 bits (2890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/606 (89%), Positives = 581/606 (95%)

Query: 17  MQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTS 76
           MQIRN+AIIAHVDHGKTTLVDELLKQSG FRDNQRVSERVMD NDLEKERGITILAKVTS
Sbjct: 1   MQIRNVAIIAHVDHGKTTLVDELLKQSGSFRDNQRVSERVMDSNDLEKERGITILAKVTS 60

Query: 77  IVWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLR 136
           I+WNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALK+GLR
Sbjct: 61  ILWNDVRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKLGLR 120

Query: 137 PIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQ 196
           PIVVVNKVDRSDAR++EVINEVFDLFS+LDATD QLDFPILYGSGR GWMSDS DG +DQ
Sbjct: 121 PIVVVNKVDRSDARSEEVINEVFDLFSSLDATDDQLDFPILYGSGRIGWMSDSPDGPQDQ 180

Query: 197 GMVPLLNLIVDHVPPPVISEGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSP 256
           G+ PLLNLI+DHVPPPV+ +G FKMIGTILEK+PFLGR++TGRIHSG +K NQNIKAL P
Sbjct: 181 GLAPLLNLILDHVPPPVVGDGGFKMIGTILEKNPFLGRVITGRIHSGAVKPNQNIKALGP 240

Query: 257 DGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQP 316
           DG+LVE GR+SKILAFRGIDRQP++EA+AGDIVSIAGLVKATVADTFCD S+DEPL+AQP
Sbjct: 241 DGSLVESGRISKILAFRGIDRQPVNEAYAGDIVSIAGLVKATVADTFCDLSVDEPLEAQP 300

Query: 317 IDPPTVTMTFGVNDSPLAGTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGR 376
           IDPPTVTMTF VNDSPLAG+EGDKVTSRMIRDRLFKEAEGNIAL+IEES  KD+FFVSGR
Sbjct: 301 IDPPTVTMTFLVNDSPLAGSEGDKVTSRMIRDRLFKEAEGNIALQIEESDLKDSFFVSGR 360

Query: 377 GELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTL 436
           GELQLAVLIETMRREGFELAVSRPRVVIKKEGD++LEP+EEVVIDVDE++SG+VVQ+MTL
Sbjct: 361 GELQLAVLIETMRREGFELAVSRPRVVIKKEGDTILEPVEEVVIDVDEQYSGSVVQRMTL 420

Query: 437 HKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGG 496
           HKSEMIELRPSG GRVRLVFL+PTR LIGY S+L+TDTRGTAIMNRLFHSYQPHKGEIGG
Sbjct: 421 HKSEMIELRPSGVGRVRLVFLAPTRALIGYHSKLLTDTRGTAIMNRLFHSYQPHKGEIGG 480

Query: 497 RSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKK 556
           R+NGVLLSNEEGK VAYALFNLEDRGSMIVEPGDKVY+GMIVGIH RENDLDVNVLKGKK
Sbjct: 481 RTNGVLLSNEEGKTVAYALFNLEDRGSMIVEPGDKVYKGMIVGIHNRENDLDVNVLKGKK 540

Query: 557 LTNMRASGKDEAVKLVPAVKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRKGK 616
           LTNMRASGKDEAVKLVPA+KMTLEQ+LSWIQNDELVEVTP SIRLRK+YLDPNERKRK K
Sbjct: 541 LTNMRASGKDEAVKLVPAIKMTLEQSLSWIQNDELVEVTPNSIRLRKIYLDPNERKRKEK 600

Query: 617 SVNLEY 622
           S+N EY
Sbjct: 601 SINKEY 606


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15966843|ref|NP_387196.1| GTP-binding protein [Sinorhizobium meliloti 1021] Length = 608 Back     alignment and organism information
>gi|150398173|ref|YP_001328640.1| GTP-binding protein TypA [Sinorhizobium medicae WSM419] Length = 608 Back     alignment and organism information
>gi|227823713|ref|YP_002827686.1| GTP-binding protein TypA [Sinorhizobium fredii NGR234] Length = 608 Back     alignment and organism information
>gi|49474983|ref|YP_033024.1| GTP-binding protein typA [Bartonella henselae str. Houston-1] Length = 608 Back     alignment and organism information
>gi|319408146|emb|CBI81799.1| GTP-binding protein TypA [Bartonella schoenbuchensis R1] Length = 608 Back     alignment and organism information
>gi|86359496|ref|YP_471388.1| GTP-binding elongation factor protein (tyrosin phosphorylated protein) [Rhizobium etli CFN 42] Length = 606 Back     alignment and organism information
>gi|319899258|ref|YP_004159351.1| GTP-binding protein TypA [Bartonella clarridgeiae 73] Length = 607 Back     alignment and organism information
>gi|319406120|emb|CBI79750.1| GTP-binding protein TypA [Bartonella sp. AR 15-3] Length = 607 Back     alignment and organism information
>gi|306841562|ref|ZP_07474260.1| GTP-binding protein TypA [Brucella sp. BO2] Length = 608 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target624 GTP-binding protein [Candidatus Liberibacter asiaticus
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA 0.0
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provisional 1e-180
KOG0462650 KOG0462, KOG0462, KOG0462, Elongation factor-type GTP-b 1e-116
COG1217603 COG1217, TypA, Predicted membrane GTPase involved in st 0.0
cd01891194 cd01891, TypA_BipA, TypA (tyrosine phosphorylated prote 1e-103
pfam00009185 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding d 4e-52
cd00881189 cd00881, GTP_translation_factor, GTP translation factor 8e-48
cd01885222 cd01885, EF2, EF2 (for archaea and eukarya) 1e-36
cd01890179 cd01890, LepA, LepA subfamily 6e-33
PTZ00416 836 PTZ00416, PTZ00416, elongation factor 2; Provisional 6e-29
cd04167213 cd04167, Snu114p, Snu114p subfamily 2e-27
KOG0469 842 KOG0469, KOG0469, KOG0469, Elongation factor 2 [Transla 1e-23
KOG0468 971 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [T 1e-21
cd01884195 cd01884, EF_Tu, EF-Tu subfamily 1e-10
PRK10512614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific trans 2e-07
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 5e-06
cd01895174 cd01895, EngA2, EngA2 subfamily 8e-06
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 9e-05
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 4e-04
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 7e-04
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Reviewed 8e-48
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aEF-2 8e-46
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope biog 2e-45
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 1e-39
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Provision 2e-35
COG5256428 COG5256, TEF1, Translation elongation factor EF-1alpha 9e-21
COG0050394 COG0050, TufB, GTPases - translation elongation factors 4e-19
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongation fac 2e-17
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 5e-16
KOG0460449 KOG0460, KOG0460, KOG0460, Mitochondrial translation el 8e-16
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 2e-15
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisional 4e-15
CHL00071409 CHL00071, tufA, elongation factor Tu 1e-13
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation factor EF 3e-13
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisional 6e-13
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 9e-13
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transferase 1e-12
COG3276447 COG3276, SelB, Selenocysteine-specific translation elon 2e-12
KOG0458603 KOG0458, KOG0458, KOG0458, Elongation factor 1 alpha [T 1e-11
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF-2; G 3e-11
PLN00043447 PLN00043, PLN00043, elongation factor 1-alpha; Provisio 7e-09
KOG0459501 KOG0459, KOG0459, KOG0459, Polypeptide release factor 3 1e-08
KOG0461522 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elon 3e-08
COG5257415 COG5257, GCD11, Translation initiation factor 2, gamma 2e-07
TIGR00491590 TIGR00491, aIF-2, translation initiation factor aIF-2/y 9e-07
COG5258527 COG5258, GTPBP1, GTPase [General function prediction on 5e-06
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, large sub 4e-05
PRK05124474 PRK05124, cysN, sulfate adenylyltransferase subunit 1; 0.001
COG0480697 COG0480, FusA, Translation elongation factors (GTPases) 4e-35
cd04168237 cd04168, TetM_like, Tet(M)-like subfamily 1e-33
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 1e-31
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) subfamily 1e-29
KOG0465721 KOG0465, KOG0465, KOG0465, Mitochondrial elongation fac 4e-29
KOG0467 887 KOG0467, KOG0467, KOG0467, Translation elongation facto 2e-27
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF-G 3e-27
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 3e-27
PRK12739691 PRK12739, PRK12739, elongation factor G; Reviewed 7e-26
PRK00007693 PRK00007, PRK00007, elongation factor G; Reviewed 1e-24
PLN00116 843 PLN00116, PLN00116, translation elongation factor EF-2 7e-24
KOG0464 753 KOG0464, KOG0464, KOG0464, Elongation factor G [Transla 1e-23
cd04169267 cd04169, RF3, RF3 subfamily 3e-23
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamil 7e-23
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [Trans 4e-22
PRK00741526 PRK00741, prfC, peptide chain release factor 3; Provisi 1e-18
TIGR00503527 TIGR00503, prfC, peptide chain release factor 3 1e-16
cd01883219 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1 2e-14
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed 2e-14
cd04171164 cd04171, SelB, SelB subfamily 2e-13
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 2e-13
cd01887168 cd01887, IF2_eIF5B, IF2/eIF5B (initiation factors 2/ eu 6e-13
KOG1145683 KOG1145, KOG1145, KOG1145, Mitochondrial translation in 5e-11
cd01889192 cd01889, SelB_euk, SelB subfamily 1e-10
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF-2 1e-10
PRK05306787 PRK05306, infB, translation initiation factor IF-2; Val 8e-10
CHL00189742 CHL00189, infB, translation initiation factor 2; Provis 9e-10
cd04166208 cd04166, CysN_ATPS, CysN_ATPS subfamily 5e-09
PRK04000411 PRK04000, PRK04000, translation initiation factor IF-2 1e-08
TIGR03680406 TIGR03680, eif2g_arch, translation initiation factor 2 5e-08
cd01888203 cd01888, eIF2_gamma, eIF2-gamma (gamma subunit of initi 3e-07
PRK04004586 PRK04004, PRK04004, translation initiation factor IF-2; 6e-07
PRK05506632 PRK05506, PRK05506, bifunctional sulfate adenylyltransf 4e-05
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 8e-05
KOG0052391 KOG0052, KOG0052, KOG0052, Translation elongation facto 1e-04
COG2229187 COG2229, COG2229, Predicted GTPase [General function pr 4e-04
KOG11441064 KOG1144, KOG1144, KOG1144, Translation initiation facto 0.003
cd01894157 cd01894, EngA1, EngA1 subfamily 0.003
cd0371079 cd03710, BipA_TypA_C, BipA_TypA_C: a C-terminal portion 3e-28
pfam0067989 pfam00679, EFG_C, Elongation factor G C-terminus 1e-18
cd0151479 cd01514, Elongation_Factor_C, Elongation factor G C-ter 2e-14
cd0371378 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to t 9e-04
COG0480697 COG0480, FusA, Translation elongation factors (GTPases) 0.003
cd0369186 cd03691, BipA_TypA_II, BipA_TypA_II: domain II of BipA 5e-23
cd0408883 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamily rep 6e-10
PRK00007693 PRK00007, PRK00007, elongation factor G; Reviewed 7e-09
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 9e-08
cd0134283 cd01342, Translation_Factor_II_like, Translation_Factor 3e-06
cd0370093 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: this su 1e-04
cd0409181 cd04091, mtEFG1_II_like, mtEFG1_C: C-terminus of mitoch 8e-04
COG0480697 COG0480, FusA, Translation elongation factors (GTPases) 2e-20
KOG0465721 KOG0465, KOG0465, KOG0465, Mitochondrial elongation fac 2e-10
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 6e-19
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 1e-16
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF-G 3e-15
PRK12739691 PRK12739, PRK12739, elongation factor G; Reviewed 4e-11
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 8e-14
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisi 6e-07
KOG0467 887 KOG0467, KOG0467, KOG0467, Translation elongation facto 5e-04
KOG0468971 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [T 0.002
>gnl|CDD|162336 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|35683 KOG0462, KOG0462, KOG0462, Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31410 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|133291 cd01891, TypA_BipA, TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>gnl|CDD|143801 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family Back     alignment and domain information
>gnl|CDD|133285 cd01885, EF2, EF2 (for archaea and eukarya) Back     alignment and domain information
>gnl|CDD|133290 cd01890, LepA, LepA subfamily Back     alignment and domain information
>gnl|CDD|185604 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|133367 cd04167, Snu114p, Snu114p subfamily Back     alignment and domain information
>gnl|CDD|35690 KOG0469, KOG0469, KOG0469, Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35689 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133284 cd01884, EF_Tu, EF-Tu subfamily Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|181029 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|30829 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|180078 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|34853 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30399 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|183709 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|35681 KOG0460, KOG0460, KOG0460, Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|178672 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|32720 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33087 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35679 KOG0458, KOG0458, KOG0458, Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30878 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional Back     alignment and domain information
>gnl|CDD|35680 KOG0459, KOG0459, KOG0459, Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35682 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|34854 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>gnl|CDD|34855 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|131089 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|179943 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|30828 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133368 cd04168, TetM_like, Tet(M)-like subfamily Back     alignment and domain information
>gnl|CDD|183990 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|133286 cd01886, EF-G, Elongation factor G (EF-G) subfamily Back     alignment and domain information
>gnl|CDD|35686 KOG0465, KOG0465, KOG0465, Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35688 KOG0467, KOG0467, KOG0467, Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|183713 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|183712 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|178789 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|35685 KOG0464, KOG0464, KOG0464, Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133369 cd04169, RF3, RF3 subfamily Back     alignment and domain information
>gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily Back     alignment and domain information
>gnl|CDD|33865 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|133283 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>gnl|CDD|183433 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|133371 cd04171, SelB, SelB subfamily Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|133287 cd01887, IF2_eIF5B, IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>gnl|CDD|36360 KOG1145, KOG1145, KOG1145, Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133289 cd01889, SelB_euk, SelB subfamily Back     alignment and domain information
>gnl|CDD|161900 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|180006 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|133366 cd04166, CysN_ATPS, CysN_ATPS subfamily Back     alignment and domain information
>gnl|CDD|179703 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|163393 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|133288 cd01888, eIF2_gamma, eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>gnl|CDD|179704 PRK04004, PRK04004, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|35275 KOG0052, KOG0052, KOG0052, Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|32410 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|36359 KOG1144, KOG1144, KOG1144, Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily Back     alignment and domain information
>gnl|CDD|58063 cd03710, BipA_TypA_C, BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2 Back     alignment and domain information
>gnl|CDD|144322 pfam00679, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|58061 cd01514, Elongation_Factor_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|58065 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>gnl|CDD|30828 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|58082 cd03691, BipA_TypA_II, BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>gnl|CDD|58095 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|178789 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|145992 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|58078 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|58091 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|58098 cd04091, mtEFG1_II_like, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|30828 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35686 KOG0465, KOG0465, KOG0465, Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183713 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|183990 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|183712 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|178823 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
>gnl|CDD|35688 KOG0467, KOG0467, KOG0467, Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35689 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 624 GTP-binding protein [Candidatus Liberibacter asiaticus
TIGR01394609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 100.0
COG1217603 TypA Predicted membrane GTPase involved in stress respo 100.0
PRK10218607 GTP-binding protein; Provisional 100.0
TIGR01393598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 100.0
KOG0462650 consensus 100.0
PRK05433601 GTP-binding protein LepA; Provisional 100.0
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 100.0
PRK00007693 elongation factor G; Reviewed 100.0
PRK13351687 elongation factor G; Reviewed 100.0
PRK12740670 elongation factor G; Reviewed 100.0
PRK12739693 elongation factor G; Reviewed 100.0
COG0480697 FusA Translation elongation factors (GTPases) [Translat 100.0
PRK07560730 elongation factor EF-2; Reviewed 100.0
TIGR00484705 EF-G translation elongation factor G; InterPro: IPR0045 100.0
KOG0465721 consensus 100.0
TIGR00490724 aEF-2 translation elongation factor aEF-2; InterPro: IP 100.0
KOG0464753 consensus 100.0
KOG0469842 consensus 100.0
KOG0468971 consensus 100.0
KOG0467887 consensus 100.0
PRK05306839 infB translation initiation factor IF-2; Validated 100.0
PRK00741526 prfC peptide chain release factor 3; Provisional 100.0
COG4108528 PrfC Peptide chain release factor RF-3 [Translation, ri 100.0
TIGR00503530 prfC peptide chain release factor 3; InterPro: IPR00454 100.0
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 100.0
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 100.0
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 100.0
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 100.0
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 100.0
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 100.0
cd00881189 GTP_translation_factor GTP translation factor family. T 100.0
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 100.0
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 100.0
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 100.0
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 100.0
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 100.0
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 100.0
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.98
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 99.95
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 99.8
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.74
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 99.72
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 99.72
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 99.72
PRK00089296 era GTP-binding protein Era; Reviewed 99.72
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.71
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.71
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.7
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.7
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.69
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 99.69
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.69
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.68
PRK00454196 engB GTPase EngB; Reviewed 99.64
COG1160444 Predicted GTPases [General function prediction only] 99.63
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 99.63
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 99.6
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.6
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.59
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.58
COG2229187 Predicted GTPase [General function prediction only] 99.57
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.56
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.55
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.51
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 99.5
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 99.5
PRK04213195 GTP-binding protein; Provisional 99.48
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 99.48
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 99.44
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.42
COG1159298 Era GTPase [General function prediction only] 99.42
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.42
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.41
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.41
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.4
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.39
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.39
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.38
PTZ00133182 ADP-ribosylation factor; Provisional 99.37
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.36
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 99.34
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 99.34
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.32
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 99.28
cd01896233 DRG The developmentally regulated GTP-binding protein ( 99.27
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.26
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.26
COG0370653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.22
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 99.22
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 99.2
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 99.19
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 99.19
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 99.19
cd04123162 Rab21 Rab21 subfamily. The localization and function of 99.19
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 99.18
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.17
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 99.15
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 99.15
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 99.14
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 99.14
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 99.12
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 99.12
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 99.11
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 99.11
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 99.1
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 99.1
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 99.1
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 99.1
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.1
PTZ00132209 GTP-binding nuclear protein; Provisional 99.09
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.09
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 99.09
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 99.09
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 99.09
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 99.09
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 99.08
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 99.07
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 99.07
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 99.07
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 99.07
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 99.07
COG0486454 ThdF Predicted GTPase [General function prediction only 99.05
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 99.04
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 99.04
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 99.04
COG0218200 Predicted GTPase [General function prediction only] 99.04
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 99.02
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 99.02
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 99.01
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 99.01
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 99.0
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 99.0
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 98.99
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 98.99
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 98.99
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 98.99
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 98.98
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 98.97
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 98.96
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 98.96
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 98.96
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 98.95
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 98.95
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 98.95
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 98.94
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 98.94
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 98.94
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 98.93
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 98.93
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 98.92
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 98.91
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 98.9
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 98.9
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 98.9
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 98.88
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily o 98.88
PRK12299334 obgE GTPase ObgE; Reviewed 98.87
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 98.82
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 98.82
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 98.81
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 98.8
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 98.8
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 98.79
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 98.78
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 98.78
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 98.76
KOG1423379 consensus 98.73
PRK12298380 obgE GTPase ObgE; Reviewed 98.68
COG3596296 Predicted GTPase [General function prediction only] 98.67
PRK11058426 putative GTPase HflX; Provisional 98.66
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 98.65
PRK12296495 obgE GTPase ObgE; Reviewed 98.63
KOG1489366 consensus 98.62
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 98.59
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 98.52
PRK12297429 obgE GTPase ObgE; Reviewed 98.49
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 98.48
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 98.48
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 98.47
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 98.43
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 98.43
COG2262411 HflX GTPases [General function prediction only] 98.43
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 98.36
PRK09435325 arginine/ornithine transport system ATPase; Provisional 98.28
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.26
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 98.2
KOG0092200 consensus 98.12
COG4917148 EutP Ethanolamine utilization protein [Amino acid trans 98.06
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 97.86
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 97.79
KOG0070181 consensus 97.75
KOG0084205 consensus 97.72
KOG0080209 consensus 97.72
KOG0098216 consensus 97.68
KOG0075186 consensus 97.67
KOG0395196 consensus 97.67
COG0536369 Obg Predicted GTPase [General function prediction only] 97.66
KOG0394210 consensus 97.65
KOG0094221 consensus 97.59
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 97.56
KOG0093193 consensus 97.45
KOG0095213 consensus 97.35
KOG0088218 consensus 97.19
KOG0072182 consensus 96.97
KOG0079198 consensus 96.95
pfam05049375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 96.87
KOG0087222 consensus 96.81
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 96.8
KOG0410410 consensus 95.76
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 100.0
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 100.0
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 100.0
KOG0052391 consensus 99.63
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 99.54
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 99.42
pfam01926106 MMR_HSR1 GTPase of unknown function. 99.25
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 99.09
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 99.07
cd04105203 SR_beta Signal recognition particle receptor, beta subu 99.06
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 99.02
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 98.98
COG1084346 Predicted GTPase [General function prediction only] 98.77
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 98.63
COG1100219 GTPase SAR1 and related small G proteins [General funct 98.54
KOG0073185 consensus 98.51
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 98.42
COG1163365 DRG Predicted GTPase [General function prediction only] 98.32
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 98.27
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 98.23
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 98.17
KOG0090238 consensus 98.14
PRK13768253 GTPase; Provisional 98.03
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 97.95
KOG0078207 consensus 97.84
KOG0076197 consensus 97.77
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 97.74
KOG1707625 consensus 97.73
KOG1547336 consensus 97.67
cd02036179 MinD Bacterial cell division requires the formation of 97.6
KOG1532366 consensus 97.56
TIGR02729296 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014 97.53
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represents Ara 97.5
COG5019373 CDC3 Septin family protein [Cell division and chromosom 97.34
KOG1954532 consensus 97.19
KOG2655366 consensus 97.17
KOG0071180 consensus 97.14
KOG0086214 consensus 97.12
KOG0077193 consensus 97.11
PHA02518211 ParA-like protein; Provisional 97.06
cd03114148 ArgK-like The function of this protein family is unkown 97.01
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.93
KOG2486320 consensus 96.88
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate vesicl 96.69
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 96.64
PRK11537317 putative GTP-binding protein YjiA; Provisional 96.61
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 96.6
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.56
KOG0448749 consensus 96.55
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 96.42
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-envelope 96.4
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 96.39
KOG0074185 consensus 96.28
PRK10867453 signal recognition particle protein; Provisional 96.21
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 96.12
COG0523323 Putative GTPases (G3E family) [General function predict 96.08
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 96.05
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.04
KOG0780483 consensus 96.0
pfam09547492 Spore_IV_A Stage IV sporulation protein A (spore_IV_A). 95.58
TIGR00101199 ureG urease accessory protein UreG; InterPro: IPR004400 95.42
PRK13849231 putative crown gall tumor protein VirC1; Provisional 95.39
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.24
KOG3883198 consensus 94.99
PRK00771433 signal recognition particle protein Srp54; Provisional 94.53
KOG0096216 consensus 94.35
KOG1490620 consensus 94.34
TIGR01425453 SRP54_euk signal recognition particle protein SRP54; In 93.82
KOG3886295 consensus 93.24
KOG4252246 consensus 93.06
KOG0097215 consensus 92.94
KOG3887347 consensus 92.75
TIGR01007207 eps_fam capsular exopolysaccharide family; InterPro: IP 92.6
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 92.56
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 92.18
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 91.15
PRK12317426 elongation factor 1-alpha; Reviewed 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
PRK05124475 cysN sulfate adenylyltransferase subunit 1; Provisional 100.0
PTZ00336449 elongation factor 1-alpha; Provisional 100.0
CHL00071409 tufA elongation factor Tu 100.0
PRK00049397 elongation factor Tu; Reviewed 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
PTZ00141443 elongation factor 1 alpha; Provisional 100.0
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 100.0
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden