254780240

254780240

adenylate kinase

GeneID in NCBI database:8209221Locus tag:CLIBASIA_00625
Protein GI in NCBI database:254780240Protein Accession:YP_003064653.1
Gene range:-(131793, 132398)Protein Length:201aa
Gene description:adenylate kinase
COG prediction:[F] Adenylate kinase and related kinases
KEGG prediction:adk; adenylate kinase (EC:2.7.4.3); K00939 adenylate kinase [EC:2.7.4.3]
SEED prediction:Adenylate kinase (EC 2.7.4.3)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:Purine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS
cEEEEEccccccHHHHHHHHHHHcccEEEcHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHHHcc
cEEEEEEcccccHHHHHHHHHHHHcccEEEHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHcEEEEcccccHHHHHHHHHccccccEEEEEEEEEEccHHHHHHHHHccEEcccccEEEEcccccHHHHHHHHHHHHHHccHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHcHccccc
mriiflgppgsgkgtqacrlsqklnvpqlstgdMLRAEVDRntllgkqvkgsmesgslisDAIVNQVVcdrirlpdcdsgfildgyprtvDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIAseksvrsddkYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS
mriiflgppgsgkgtqacRLSQKLNVPQLSTGDMLRAEVDRNTLLGKqvkgsmesgslisDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLeaiaseksvrsddkydvFLKRIENYrktilplssyyrDMGCLYIIDGMLDMDEVSRSIDSLLvsvrkkcsss
MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS
MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL***R******
MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLV*********
MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS
MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS
MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target201 adenylate kinase [Candidatus Liberibacter asiaticus str
315122797201 adenylate kinase [Candidatus Liberibacter solanacearum 1 3e-80
325293315196 adenylate kinase [Agrobacterium sp. H13-3] Length = 196 1 4e-56
15889221196 adenylate kinase [Agrobacterium tumefaciens str. C58] L 1 2e-55
17987061194 adenylate kinase [Brucella melitensis bv. 1 str. 16M] L 1 1e-53
62290123194 adenylate kinase [Brucella abortus bv. 1 str. 9-941] Le 1 1e-53
23502089194 adenylate kinase [Brucella suis 1330] Length = 194 1 2e-53
163843478194 adenylate kinase [Brucella suis ATCC 23445] Length = 19 1 2e-53
294852548194 adenylate kinase [Brucella sp. NVSL 07-0026] Length = 1 1 3e-53
256061292194 adenylate kinase [Brucella neotomae 5K33] Length = 194 1 5e-53
153009307194 adenylate kinase [Ochrobactrum anthropi ATCC 49188] Len 1 6e-53
>gi|315122797|ref|YP_004063286.1| adenylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 201 Back     alignment and organism information
 Score =  301 bits (771), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 170/201 (84%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRIIFLGPPG+GKGTQA RLS KLN+PQLSTGDMLRAEV + T +GKQVK  MESG LIS
Sbjct: 1   MRIIFLGPPGAGKGTQAARLSHKLNIPQLSTGDMLRAEVSKGTFIGKQVKNIMESGHLIS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+IVN+VVCDRI   DC  GFILDGYPRTVDQA++L   +S M+C IDAVIEL+V+D+ M
Sbjct: 61  DSIVNRVVCDRIGHSDCSGGFILDGYPRTVDQAQNLQIIVSGMNCCIDAVIELQVDDSLM 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
           FKRI+ RV +AI+SEKSVRSDDKYDVF++R+E+YR+  +PLSSYYRD GCL++IDGMLD 
Sbjct: 121 FKRIESRVSKAISSEKSVRSDDKYDVFIRRMEDYRRVTVPLSSYYRDRGCLHVIDGMLDA 180

Query: 181 DEVSRSIDSLLVSVRKKCSSS 201
           D VSR IDSLLVS+  KC  S
Sbjct: 181 DTVSRDIDSLLVSIEGKCCRS 201



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293315|ref|YP_004279179.1| adenylate kinase [Agrobacterium sp. H13-3] Length = 196 Back     alignment and organism information
>gi|15889221|ref|NP_354902.1| adenylate kinase [Agrobacterium tumefaciens str. C58] Length = 196 Back     alignment and organism information
>gi|17987061|ref|NP_539695.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M] Length = 194 Back     alignment and organism information
>gi|62290123|ref|YP_221916.1| adenylate kinase [Brucella abortus bv. 1 str. 9-941] Length = 194 Back     alignment and organism information
>gi|23502089|ref|NP_698216.1| adenylate kinase [Brucella suis 1330] Length = 194 Back     alignment and organism information
>gi|163843478|ref|YP_001627882.1| adenylate kinase [Brucella suis ATCC 23445] Length = 194 Back     alignment and organism information
>gi|294852548|ref|ZP_06793221.1| adenylate kinase [Brucella sp. NVSL 07-0026] Length = 194 Back     alignment and organism information
>gi|256061292|ref|ZP_05451442.1| adenylate kinase [Brucella neotomae 5K33] Length = 194 Back     alignment and organism information
>gi|153009307|ref|YP_001370522.1| adenylate kinase [Ochrobactrum anthropi ATCC 49188] Length = 194 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target201 adenylate kinase [Candidatus Liberibacter asiaticus str
PRK00279215 PRK00279, adk, adenylate kinase; Reviewed 1e-60
TIGR01351210 TIGR01351, adk, adenylate kinases 4e-53
PRK13808 333 PRK13808, PRK13808, adenylate kinase; Provisional 4e-52
PRK14532188 PRK14532, PRK14532, adenylate kinase; Provisional 7e-43
pfam00406186 pfam00406, ADK, Adenylate kinase 5e-42
COG0563178 COG0563, Adk, Adenylate kinase and related kinases [Nuc 1e-41
PRK14528186 PRK14528, PRK14528, adenylate kinase; Provisional 1e-41
PRK02496184 PRK02496, adk, adenylate kinase; Provisional 6e-41
PRK14527191 PRK14527, PRK14527, adenylate kinase; Provisional 1e-35
PRK14531183 PRK14531, PRK14531, adenylate kinase; Provisional 6e-34
KOG3078235 KOG3078, KOG3078, KOG3078, Adenylate kinase [Nucleotide 1e-32
KOG3079195 KOG3079, KOG3079, KOG3079, Uridylate kinase/adenylate k 8e-29
PRK14526211 PRK14526, PRK14526, adenylate kinase; Provisional 1e-27
PLN02674244 PLN02674, PLN02674, adenylate kinase 2e-27
PLN02842 505 PLN02842, PLN02842, nucleotide kinase 1e-25
PLN02459261 PLN02459, PLN02459, probable adenylate kinase 2e-24
PTZ00088229 PTZ00088, PTZ00088, adenylate kinase 1; Provisional 1e-23
TIGR01360188 TIGR01360, aden_kin_iso1, adenylate kinase, isozyme 1 s 2e-23
TIGR01359183 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family 4e-22
PRK14530215 PRK14530, PRK14530, adenylate kinase; Provisional 1e-21
PRK14529223 PRK14529, PRK14529, adenylate kinase; Provisional 4e-19
PLN02200234 PLN02200, PLN02200, adenylate kinase family protein 4e-15
cd01428194 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reve 4e-48
PRK01184184 PRK01184, PRK01184, hypothetical protein; Provisional 2e-04
PRK04182180 PRK04182, PRK04182, cytidylate kinase; Provisional 3e-04
TIGR02173171 TIGR02173, cyt_kin_arch, cytidylate kinase, putative 4e-04
cd02020147 cd02020, CMPK, Cytidine monophosphate kinase (CMPK) cat 8e-04
COG0283222 COG0283, Cmk, Cytidylate kinase [Nucleotide transport a 0.002
COG1102179 COG1102, Cmk, Cytidylate kinase [Nucleotide transport a 0.003
PRK08118167 PRK08118, PRK08118, topology modulation protein; Review 0.003
>gnl|CDD|178957 PRK00279, adk, adenylate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|162313 TIGR01351, adk, adenylate kinases Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184729 PRK14532, PRK14532, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|144120 pfam00406, ADK, Adenylate kinase Back     alignment and domain information
>gnl|CDD|30909 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|172994 PRK14528, PRK14528, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|179433 PRK02496, adk, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184726 PRK14527, PRK14527, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172997 PRK14531, PRK14531, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|38288 KOG3078, KOG3078, KOG3078, Adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|38289 KOG3079, KOG3079, KOG3079, Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|172992 PRK14526, PRK14526, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178279 PLN02674, PLN02674, adenylate kinase Back     alignment and domain information
>gnl|CDD|178435 PLN02842, PLN02842, nucleotide kinase Back     alignment and domain information
>gnl|CDD|178078 PLN02459, PLN02459, probable adenylate kinase Back     alignment and domain information
>gnl|CDD|173382 PTZ00088, PTZ00088, adenylate kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|130427 TIGR01360, aden_kin_iso1, adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>gnl|CDD|130426 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family Back     alignment and domain information
>gnl|CDD|184728 PRK14530, PRK14530, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184727 PRK14529, PRK14529, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|177851 PLN02200, PLN02200, adenylate kinase family protein Back     alignment and domain information
>gnl|CDD|30189 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>gnl|CDD|179240 PRK01184, PRK01184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179771 PRK04182, PRK04182, cytidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|162744 TIGR02173, cyt_kin_arch, cytidylate kinase, putative Back     alignment and domain information
>gnl|CDD|73296 cd02020, CMPK, Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>gnl|CDD|30631 COG0283, Cmk, Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|31299 COG1102, Cmk, Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181235 PRK08118, PRK08118, topology modulation protein; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 201 adenylate kinase [Candidatus Liberibacter asiaticus str
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 100.0
PRK13808297 adenylate kinase; Provisional 100.0
PRK00279215 adk adenylate kinase; Reviewed 100.0
TIGR01360191 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Mem 100.0
PRK02496185 adk adenylate kinase; Provisional 100.0
TIGR01359189 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006 100.0
PTZ00088225 adenylate kinase 1; Provisional 100.0
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 100.0
KOG3079195 consensus 100.0
pfam00406186 ADK Adenylate kinase. 100.0
KOG3078235 consensus 100.0
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 100.0
PRK01184183 hypothetical protein; Provisional 99.71
PRK08356195 hypothetical protein; Provisional 99.66
PRK03839180 putative kinase; Provisional 99.58
PRK13973216 thymidylate kinase; Provisional 99.55
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 99.54
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 99.53
PRK00698204 tmk thymidylate kinase; Validated 99.51
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 99.49
PRK13974212 thymidylate kinase; Provisional 99.46
PRK04182178 cytidylate kinase; Provisional 99.45
pfam02223186 Thymidylate_kin Thymidylate kinase. 99.43
PRK07933213 thymidylate kinase; Validated 99.42
PRK13975198 thymidylate kinase; Provisional 99.41
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 99.41
PRK00131175 aroK shikimate kinase; Reviewed 99.38
PRK06217185 hypothetical protein; Validated 99.38
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 99.35
PRK03731172 aroL shikimate kinase II; Reviewed 99.35
PRK05057172 aroK shikimate kinase I; Reviewed 99.34
PRK13946195 shikimate kinase; Provisional 99.31
PRK00625173 shikimate kinase; Provisional 99.31
PRK13947171 shikimate kinase; Provisional 99.3
PRK13976202 thymidylate kinase; Provisional 99.27
PRK09825176 idnK D-gluconate kinase; Provisional 99.27
TIGR00041211 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thy 99.27
KOG3347176 consensus 99.26
PRK13948182 shikimate kinase; Provisional 99.25
PRK13949169 shikimate kinase; Provisional 99.24
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and metabol 99.18
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.17
PRK00081199 coaE dephospho-CoA kinase; Reviewed 99.15
PRK00023225 cmk cytidylate kinase; Provisional 99.15
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 99.14
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 99.14
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 99.13
PRK04040189 adenylate kinase; Provisional 99.09
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 99.05
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.02
PRK11545177 gntK gluconate kinase 1; Provisional 99.0
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 99.0
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 98.93
KOG3220225 consensus 98.82
pfam01202158 SKI Shikimate kinase. 98.75
KOG3327208 consensus 98.73
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 98.71
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 98.7
PRK08233182 hypothetical protein; Provisional 98.67
pfam01121179 CoaE Dephospho-CoA kinase. This family catalyses the ph 98.62
PRK03333 394 coaE dephospho-CoA kinase/unknown domain fusion protein 98.6
PRK04220306 2-phosphoglycerate kinase; Provisional 98.56
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 98.5
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 98.5
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 98.43
PRK00300208 gmk guanylate kinase; Provisional 98.42
PRK05416 292 hypothetical protein; Provisional 98.4
PRK06696227 uridine kinase; Validated 98.39
KOG3354191 consensus 98.36
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 98.34
PRK05480209 uridine kinase; Provisional 98.32
PRK06762166 hypothetical protein; Provisional 98.3
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 98.29
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 98.25
pfam00625182 Guanylate_kin Guanylate kinase. 98.23
PRK09270230 frcK putative fructose transport system kinase; Reviewe 98.18
PRK12339197 2-phosphoglycerate kinase; Provisional 98.17
TIGR02322183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 98.14
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 98.13
PRK05541176 adenylylsulfate kinase; Provisional 98.1
pfam03668 284 ATP_bind_2 P-loop ATPase protein family. This family co 98.07
COG1660 286 Predicted P-loop-containing kinase [General function pr 98.06
pfam01591223 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a 97.96
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 97.94
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 97.84
PTZ00301210 uridine kinase; Provisional 97.76
COG3709192 Uncharacterized component of phosphonate metabolism [In 97.48
pfam03976229 PPK2 Polyphosphate kinase 2 (PPK2). Inorganic polyphosp 97.36
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Pr 96.96
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 96.89
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 96.89
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.81
KOG3308225 consensus 96.66
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.03
KOG0234 438 consensus 95.6
PRK08118167 topology modulation protein; Reviewed 99.4
PRK07261171 topology modulation protein; Provisional 99.31
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 98.98
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 98.94
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 98.85
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 98.65
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 98.59
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) ca 98.55
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 98.19
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 98.14
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 98.12
COG0645170 Predicted kinase [General function prediction only] 98.12
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 98.05
PRK00889175 adenylylsulfate kinase; Provisional 97.93
PRK03846198 adenylylsulfate kinase; Provisional 97.84
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 97.8
KOG3877393 consensus 97.8
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.74
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.73
COG4639168 Predicted kinase [General function prediction only] 97.61
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 97.58
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 97.47
KOG0730693 consensus 97.46
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 97.43
PRK06547184 hypothetical protein; Provisional 97.42
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 97.34
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 97.32
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 97.27
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 97.13
PRK07429 331 phosphoribulokinase; Provisional 97.13
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 97.1
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 97.1
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 97.09
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 97.09
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.02
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 96.88
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 96.87
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 96.79
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 96.75
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 96.72
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 96.68
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 96.58
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 96.52
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 96.44
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 96.42
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 96.4
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.19
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 95.88
PRK07940 395 DNA polymerase III subunit delta'; Validated 95.71
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 95.65
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 95.61
KOG0635207 consensus 95.59
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 95.17
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 94.25
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 99.05
PRK12338 320 hypothetical protein; Provisional 98.05
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 97.91
PRK09183258 transposase/IS protein; Provisional 97.7
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 97.69
PRK13341 726 recombination factor protein RarA/unknown domain fusion 97.65
PRK13342 417 recombination factor protein RarA; Reviewed 97.64
PRK04195 403 replication factor C large subunit; Provisional 97.62
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.59
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 97.57
PRK06526254 transposase; Provisional 97.57
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.56
pfam00004131 AAA ATPase family associated with various cellular acti 97.55
PRK08181269 transposase; Validated 97.54
cd01124187 KaiC KaiC is a circadian clock protein primarily found 97.54
PRK13768253 GTPase; Provisional 97.5
CHL00195491 ycf46 Ycf46; Provisional 97.43
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.42
PRK13695174 putative NTPase; Provisional 97.4
PRK03992390 proteasome-activating nucleotidase; Provisional 97.37
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.36
PRK04328250 hypothetical protein; Provisional 97.36
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 97.32
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 97.32
KOG0744423 consensus 97.32
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.29
PRK12377248 putative replication protein; Provisional 97.28
KOG0733 802 consensus 97.26
pfam06745231 KaiC KaiC. This family represents a conserved region wi 97.25
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 97.25
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 97.22
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 97.21
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 97.21
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 97.15
KOG0736953 consensus 97.13
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 97.12
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 97.07
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 97.07
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 97.06
PRK12402337 replication factor C small subunit 2; Reviewed 97.05
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 97.04
smart00382148 AAA ATPases associated with a variety of cellular activ 97.03
pfam07726131 AAA_3 ATPase family associated with various cellular ac 97.02
PRK00440318 rfc replication factor C small subunit; Reviewed 97.0
KOG2004 906 consensus 96.96
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 96.94
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 96.93
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 96.91
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 96.91
PRK06067241 flagellar accessory protein FlaH; Validated 96.9
pfam03266168 DUF265 Protein of unknown function, DUF265. 96.9
PRK13764 605 ATPase; Provisional 96.88
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 96.87
PRK12337492 2-phosphoglycerate kinase; Provisional 96.87
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 96.84
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.83
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.8
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 96.76
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.76
PRK10416499 cell division protein FtsY; Provisional 96.75
KOG0734 752 consensus 96.74
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 96.74
pfam06068 395 TIP49 TIP49 C-terminus. This family consists of the C-t 96.72
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 96.72
COG1484254 DnaC DNA replication protein [DNA replication, recombin 96.7
CHL00176 631 ftsH cell division protein; Validated 96.69
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 96.66
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 96.59
PRK05201 442 hslU ATP-dependent protease ATP-binding subunit; Provis 96.58
KOG0731 774 consensus 96.56
KOG1969 877 consensus 96.56
KOG1533290 consensus 96.55
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 96.52
PRK05342 411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 96.52
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.52
PRK07952242 DNA replication protein DnaC; Validated 96.48
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 96.45
KOG0735952 consensus 96.44
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 96.44
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.39
COG1855 604 ATPase (PilT family) [General function prediction only] 96.38
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 96.37
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 96.36
COG0714329 MoxR-like ATPases [General function prediction only] 96.3
PHA02244383 ATPase-like protein 96.3
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 96.29
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 96.26
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.25
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 96.22
KOG1970 634 consensus 96.21
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 96.2
KOG0737386 consensus 96.2
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.19
KOG0743457 consensus 96.17
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 96.15
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 96.14
KOG0738491 consensus 96.13
PRK06761281 hypothetical protein; Provisional 96.07
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 96.05
PRK09862506 putative ATP-dependent protease; Provisional 96.05
KOG0742630 consensus 96.05
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 96.02
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 96.02
KOG0780 483 consensus 95.98
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.93
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 95.93
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 95.93
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 95.92
KOG0739439 consensus 95.89
TIGR01186 372 proV glycine betaine/L-proline transport ATP binding su 95.88
COG3911183 Predicted ATPase [General function prediction only] 95.84
PRK08116262 hypothetical protein; Validated 95.81
TIGR00390 463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 95.79
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 95.77
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 95.74
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 95.69
COG0324 308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 95.67
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.66
PRK04841 903 transcriptional regulator MalT; Provisional 95.64
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.64
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 95.64
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.61
KOG0741 744 consensus 95.61
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 95.61
PRK00771 433 signal recognition particle protein Srp54; Provisional 95.6
PRK06851 368 hypothetical protein; Provisional 95.54
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.54
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 95.53
PRK00411 394 cdc6 cell division control protein 6; Reviewed 95.52
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.5
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.5
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.48
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 95.42
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 95.39
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 95.39
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 95.38
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 95.36
COG1100219 GTPase SAR1 and related small G proteins [General funct 95.36
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 95.35
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 95.33
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.31
KOG0651388 consensus 95.3
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.27
KOG0745 564 consensus 95.25
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.25
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.23
PRK06620214 hypothetical protein; Validated 95.22
KOG2028 554 consensus 95.22
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 95.22
PRK06921265 hypothetical protein; Provisional 95.21
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 95.21
PRK09087226 hypothetical protein; Validated 95.18
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.18
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.18
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 95.17
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 95.16
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.16
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.15
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 95.13
COG3842 352 PotA ABC-type spermidine/putrescine transport systems, 95.1
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 95.09
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.09
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 95.08
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 95.08
KOG0058716 consensus 95.06
PRK10865 857 protein disaggregation chaperone; Provisional 95.06
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 95.05
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.04
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 95.03
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 95.02
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.02
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.02
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 95.01
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.01
PRK10867 453 signal recognition particle protein; Provisional 95.01
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 95.0
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 94.99
cd01394218 radB RadB. The archaeal protein radB shares similarity 94.98
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 94.97
KOG0735 952 consensus 94.97
PRK13531 498 regulatory ATPase RavA; Provisional 94.95
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 94.95
cd03234226 ABCG_White The White subfamily represents ABC transport 94.95
KOG0055 1228 consensus 94.95
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 94.92
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 94.91
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 94.91
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 94.91
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 94.87
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 94.86
PRK06835330 DNA replication protein DnaC; Validated 94.86
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 94.85
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 94.81
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 94.8
TIGR01187 331 potA polyamine ABC transporter, ATP-binding protein; In 94.8
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 94.8
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.8
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 94.74
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 94.74
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 94.72
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 94.72
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 94.71
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 94.71
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 94.71
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 94.7
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 94.7
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 94.7
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 94.69
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.69
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 94.69
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.68
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.68
KOG0741744 consensus 94.67
KOG0729435 consensus 94.66
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.66
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.66
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.64
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 94.63
COG5635 824 Predicted NTPase (NACHT family) [Signal transduction me 94.63
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 94.61
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 94.61
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 94.61
PRK13851343 type IV secretion system protein VirB11; Provisional 94.61
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 94.6
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 94.6
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 94.59
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.55
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 94.55
pfam00308219 Bac_DnaA Bacterial dnaA protein. 94.54
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 94.54
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 94.53
cd03116159 MobB Molybdenum is an essential trace element in the fo 94.52
CHL00095823 clpC Clp protease ATP binding subunit 94.52
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 94.52
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 94.51
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 94.5
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 94.49
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 94.46
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 94.46
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 94.46
KOG0989346 consensus 94.45
KOG0727408 consensus 94.45
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 94.44
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 94.43
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.43
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 94.43
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 94.42
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 94.42
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 94.41
KOG0991333 consensus 94.39
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 94.37
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 94.36
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 94.36
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.36
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 94.36
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 94.36
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.35
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 94.33
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 94.31
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 94.29
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 94.28
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 94.28
COG2087175 CobU Adenosyl cobinamide kinase/adenosyl cobinamide pho 94.28
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 94.27
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 94.27
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 94.26
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 94.26
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 94.22
cd03114148 ArgK-like The function of this protein family is unkown 94.21
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.21
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 94.2
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 94.2
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 94.19
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 94.19
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 94.19
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 94.18
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 94.18
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 94.17
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 94.13
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.12
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 94.12
PRK11147 632 ABC transporter ATPase component; Reviewed 94.11
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 94.11
PRK10744257 phosphate transporter subunit; Provisional 94.1
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 94.09
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 94.07
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 94.07
PRK10636638 putative ABC transporter ATP-binding protein; Provision 94.05
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.04
KOG0728404 consensus 94.04
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 94.03
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 94.02
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 94.02
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.01
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 94.0
cd04123162 Rab21 Rab21 subfamily. The localization and function of 94.0
PRK13900332 type IV secretion system ATPase VirB11; Provisional 93.99
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 93.98
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 93.97
KOG0730 693 consensus 93.97
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 93.94
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 93.94
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 93.94
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 93.93
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.92
PRK09435325 arginine/ornithine transport system ATPase; Provisional 93.92
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 93.91
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 93.91
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 93.91
pfam00503 350 G-alpha G-protein alpha subunit. G proteins couple rece 93.9
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.9
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 93.89
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 93.89
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.89
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 93.87
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.86
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 93.86
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 93.86
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 93.85
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 93.85
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 93.82
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 93.79
KOG1942 456 consensus 93.78
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.77
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 93.77
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 93.76
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.75
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 98.94
KOG0707231 consensus 96.59
pfam01712146 dNK Deoxynucleoside kinase. This family consists of var 95.13
CHL00181287 cbbX CbbX; Provisional 98.1
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.32
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.15
PRK09302 501 circadian clock protein KaiC; Reviewed 97.13
PRK09302501 circadian clock protein KaiC; Reviewed 97.03
KOG0733802 consensus 96.65
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.42
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.29
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 95.2
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 94.98
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 94.97
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 94.94
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 94.8
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 94.54
COG4987573 CydC ABC-type transport system involved in cytochrome b 93.98
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 98.07
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 97.88
PRK07667190 uridine kinase; Provisional 97.77
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 96.15
TIGR00235220 udk uridine kinase; InterPro: IPR000764 Uridine kinase 95.72
KOG1534273 consensus 95.55
>TIGR01351 adk adenylate kinases; InterPro: IPR006259 Most members of this family are known or believed to be adenylate kinase Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Members of this family are adenylate kinase, 2 Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006266 This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>KOG3079 consensus Back     alignment and domain information
>pfam00406 ADK Adenylate kinase Back     alignment and domain information
>KOG3078 consensus Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892 Proteins in this family are believed to be cytidylate kinase Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>pfam02223 Thymidylate_kin Thymidylate kinase Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thymidylate kinase (2 Back     alignment and domain information
>KOG3347 consensus Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information