254780241

254780241

preprotein translocase subunit SecY

GeneID in NCBI database:8209222Locus tag:CLIBASIA_00630
Protein GI in NCBI database:254780241Protein Accession:YP_003064654.1
Gene range:-(132395, 133729)Protein Length:444aa
Gene description:preprotein translocase subunit SecY
COG prediction:[U] Preprotein translocase subunit SecY
KEGG prediction:secY; preprotein translocase subunit SecY; K03076 preprotein translocase subunit SecY
SEED prediction:Preprotein translocase secY subunit (TC 3.A.5.1.1)
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM10 TM-Helix
TOPPRED9 TM-Helix
HMMTOP10 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM9 TM-Helix
PHOBIUS10 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----
MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKNS
ccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccEEHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHEEEccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHEEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
ccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHccHHEccccccccccEEcccccccHHHHHHHHHcHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MASAVEQFVSNlnfasfsrakdlksRIVFTIIALIVYRfgtyiplpsidfisyskafqsksagifglfnmfsggaVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGlkngqgivsdsdyFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELgrvgsistPLMLLIFSSTVAVIALVIFFERAQRRLLIQypkrqvgnrmfqddvsylplklntagvvpsIFASSLLLLPATIMGfidvsssptWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNlkkhggfipgirpgdrtalhIDYVLTRVTVVGAGYLVCVCIFPealiavtgvpvslsgtSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKNS
MASAVEQFVsnlnfasfsrakdlksrIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIqypkrqvgnrmFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQqyegvfkksrskkkns
MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKNS
********VSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKE*EQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF****S*****
MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGV***********
****VEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRS*****
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKNS
MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKNS
MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKNS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target444 preprotein translocase subunit SecY [Candidatus Liberib
315122798445 preprotein translocase subunit SecY [Candidatus Liberib 1 0.0
222148386446 preprotein translocase subunit SecY [Agrobacterium viti 1 0.0
150396227446 preprotein translocase subunit SecY [Sinorhizobium medi 1 0.0
15965129446 preprotein translocase subunit SecY [Sinorhizobium meli 1 0.0
227821775446 preprotein translocase subunit SecY [Sinorhizobium fred 1 0.0
159184982446 preprotein translocase subunit SecY [Agrobacterium tume 1 0.0
325293316446 Preprotein translocase subunit SecY [Agrobacterium sp. 1 0.0
190891375446 protein-export translocase protein [Rhizobium etli CIAT 1 0.0
218674115446 preprotein translocase subunit SecY [Rhizobium etli GR5 1 0.0
86357325446 preprotein translocase subunit SecY [Rhizobium etli CFN 1 1e-180
>gi|315122798|ref|YP_004063287.1| preprotein translocase subunit SecY [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 445 Back     alignment and organism information
 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/444 (81%), Positives = 411/444 (92%), Gaps = 2/444 (0%)

Query: 3   SAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSA 62
           SAVEQFVSNL+ +SFS+AKDLKSRIVFT+IA++VYR GT+IPLPSID ++Y+KAFQSKSA
Sbjct: 2   SAVEQFVSNLSISSFSKAKDLKSRIVFTLIAIVVYRLGTHIPLPSIDLVAYTKAFQSKSA 61

Query: 63  GIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQ 122
           GIFG+FNMFSGGAVERMAVF+LGIMPYISASIIVQLI A VPSLE+LK+EGEQGRK+INQ
Sbjct: 62  GIFGIFNMFSGGAVERMAVFALGIMPYISASIIVQLIVAMVPSLESLKQEGEQGRKIINQ 121

Query: 123 YTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMR 182
           YTRYATV LGI+QAYGIA+GLKNG+GIVSDSD FFVFST++TLLGGTMFLVWLGEQIT R
Sbjct: 122 YTRYATVFLGIIQAYGIAIGLKNGRGIVSDSDSFFVFSTVVTLLGGTMFLVWLGEQITSR 181

Query: 183 GIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQ 242
           GIGNG+SLIIFSGIVAGLPS+ + VLELGRVGSI+TPL+LL+F S + VIA V+FFERAQ
Sbjct: 182 GIGNGISLIIFSGIVAGLPSAFIGVLELGRVGSIATPLILLVFVSIILVIAFVVFFERAQ 241

Query: 243 RRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT 302
           RRLLIQYPKRQVGNR+F DDVSYLPLKLNTAGVVPSIFASSLLLLPATI+GF+DVSSSP 
Sbjct: 242 RRLLIQYPKRQVGNRIFPDDVSYLPLKLNTAGVVPSIFASSLLLLPATIVGFVDVSSSPE 301

Query: 303 WIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDR 362
           W++ LV +LGHG+  YMVLY+  IVFF+FFYTAIVFNP EAA+NLKK GGF+PGIRPGDR
Sbjct: 302 WVINLVGALGHGQLLYMVLYAASIVFFSFFYTAIVFNPIEAANNLKKQGGFLPGIRPGDR 361

Query: 363 TALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQ 422
           TA HIDYVLTRVTVVGA YLV VCI PE L++VTG+PVSLSGTS+LIIVSVVLDT++Q+Q
Sbjct: 362 TAEHIDYVLTRVTVVGALYLVFVCILPEILVSVTGIPVSLSGTSILIIVSVVLDTVMQVQ 421

Query: 423 GYLIAQQYEGVFKKS--RSKKKNS 444
           GYLIAQQYEG+ KKS  R++KK S
Sbjct: 422 GYLIAQQYEGLVKKSKLRNRKKGS 445


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148386|ref|YP_002549343.1| preprotein translocase subunit SecY [Agrobacterium vitis S4] Length = 446 Back     alignment and organism information
>gi|150396227|ref|YP_001326694.1| preprotein translocase subunit SecY [Sinorhizobium medicae WSM419] Length = 446 Back     alignment and organism information
>gi|15965129|ref|NP_385482.1| preprotein translocase subunit SecY [Sinorhizobium meliloti 1021] Length = 446 Back     alignment and organism information
>gi|227821775|ref|YP_002825745.1| preprotein translocase subunit SecY [Sinorhizobium fredii NGR234] Length = 446 Back     alignment and organism information
>gi|159184982|ref|NP_354903.2| preprotein translocase subunit SecY [Agrobacterium tumefaciens str. C58] Length = 446 Back     alignment and organism information
>gi|325293316|ref|YP_004279180.1| Preprotein translocase subunit SecY [Agrobacterium sp. H13-3] Length = 446 Back     alignment and organism information
>gi|190891375|ref|YP_001977917.1| protein-export translocase protein [Rhizobium etli CIAT 652] Length = 446 Back     alignment and organism information
>gi|218674115|ref|ZP_03523784.1| preprotein translocase subunit SecY [Rhizobium etli GR56] Length = 446 Back     alignment and organism information
>gi|86357325|ref|YP_469217.1| preprotein translocase subunit SecY [Rhizobium etli CFN 42] Length = 446 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target444 preprotein translocase subunit SecY [Candidatus Liberib
PRK09204426 PRK09204, secY, preprotein translocase subunit SecY; Re 1e-164
TIGR00967410 TIGR00967, 3a0501s007, preprotein translocase, SecY sub 1e-102
CHL00161417 CHL00161, secY, preprotein translocase subunit SecY; Va 7e-82
PRK12907434 PRK12907, secY, preprotein translocase subunit SecY; Re 5e-74
PRK12417404 PRK12417, secY, preprotein translocase subunit SecY; Re 3e-37
TIGR02920395 TIGR02920, acc_sec_Y2, accessory Sec system translocase 5e-35
PRK08568462 PRK08568, PRK08568, preprotein translocase subunit SecY 3e-12
COG0201436 COG0201, SecY, Preprotein translocase subunit SecY [Int 1e-111
pfam00344340 pfam00344, SecY, eubacterial secY protein 5e-95
KOG1373476 KOG1373, KOG1373, KOG1373, Transport protein Sec61, alp 0.002
>gnl|CDD|181698 PRK09204, secY, preprotein translocase subunit SecY; Reviewed Back     alignment and domain information
>gnl|CDD|162138 TIGR00967, 3a0501s007, preprotein translocase, SecY subunit Back     alignment and domain information
>gnl|CDD|177074 CHL00161, secY, preprotein translocase subunit SecY; Validated Back     alignment and domain information
>gnl|CDD|183828 PRK12907, secY, preprotein translocase subunit SecY; Reviewed Back     alignment and domain information
>gnl|CDD|183517 PRK12417, secY, preprotein translocase subunit SecY; Reviewed Back     alignment and domain information
>gnl|CDD|131966 TIGR02920, acc_sec_Y2, accessory Sec system translocase SecY2 Back     alignment and domain information
>gnl|CDD|181475 PRK08568, PRK08568, preprotein translocase subunit SecY; Reviewed Back     alignment and domain information
>gnl|CDD|30550 COG0201, SecY, Preprotein translocase subunit SecY [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|144075 pfam00344, SecY, eubacterial secY protein Back     alignment and domain information
>gnl|CDD|36587 KOG1373, KOG1373, KOG1373, Transport protein Sec61, alpha subunit [Intracellular trafficking, secretion, and vesicular transport, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 444 preprotein translocase subunit SecY [Candidatus Liberib
PRK09204427 secY preprotein translocase subunit SecY; Reviewed 100.0
PRK12907434 secY preprotein translocase subunit SecY; Reviewed 100.0
CHL00161417 secY preprotein translocase subunit SecY; Validated 100.0
TIGR00967489 3a0501s007 preprotein translocase, SecY subunit; InterP 100.0
COG0201436 SecY Preprotein translocase subunit SecY [Intracellular 100.0
PRK12417399 secY preprotein translocase subunit SecY; Reviewed 100.0
PRK08568466 preprotein translocase subunit SecY; Reviewed 100.0
TIGR02920403 secY_rel translocase, putative; InterPro: IPR014269 Mem 100.0
PTZ00219472 Sec61 protein; Provisional 100.0
KOG1373476 consensus 100.0
pfam00344340 SecY eubacterial secY protein. 100.0
>PRK09204 secY preprotein translocase subunit SecY; Reviewed Back     alignment and domain information
>PRK12907 secY preprotein translocase subunit SecY; Reviewed Back     alignment and domain information
>CHL00161 secY preprotein translocase subunit SecY; Validated Back     alignment and domain information
>TIGR00967 3a0501s007 preprotein translocase, SecY subunit; InterPro: IPR002208 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>COG0201 SecY Preprotein translocase subunit SecY [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12417 secY preprotein translocase subunit SecY; Reviewed Back     alignment and domain information
>PRK08568 preprotein translocase subunit SecY; Reviewed Back     alignment and domain information
>TIGR02920 secY_rel translocase, putative; InterPro: IPR014269 Members of this entry are restricted to the Firmicutes lineage (low-GC Gram-positive bacteria) and appear to be paralogous to, and much more divergent than, the preprotein translocase SecY Back     alignment and domain information
>PTZ00219 Sec61 protein; Provisional Back     alignment and domain information
>KOG1373 consensus Back     alignment and domain information
>pfam00344 SecY eubacterial secY protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target444 preprotein translocase subunit SecY [Candidatus Liberib
3j01_A435 Structure Of The Ribosome-Secye Complex In The Memb 1e-110
3dl8_G429 Structure Of The Complex Of Aquifex Aeolicus Secyeg 1e-104
2zjs_Y434 Crystal Structure Of Secye Translocon From Thermus 1e-100
3din_C431 Crystal Structure Of The Protein-Translocation Comp 3e-98
2akh_Y400 Normal Mode-Based Flexible Fitted Coordinates Of A 8e-92
3bo0_A442 Ribosome-Secy Complex Length = 442 2e-42
3mp7_A482 Lateral Opening Of A Translocon Upon Entry Of Prote 3e-36
2wwb_A476 Cryo-Em Structure Of The Mammalian Sec61 Complex Bo 2e-30
1rh5_A436 The Structure Of A Protein Conducting Channel Lengt 2e-29
1rhz_A436 The Structure Of A Protein Conducting Channel Lengt 2e-29
3dkn_A430 Sec61 In The Canine Ribosome-Channel Complex From T 7e-29
2yxq_A431 The Plug Domain Of The Secy Protein Stablizes The C 2e-28
2yxr_A426 The Plug Domain Of The Secy Protein Stablizes The C 4e-28
2ww9_A490 Cryo-Em Structure Of The Active Yeast Ssh1 Complex 8e-07
>gi|329666015|pdb|3J01|A Chain A, Structure Of The Ribosome-Secye Complex In The Membrane Environment Length = 435 Back     alignment and structure
 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 207/423 (48%), Positives = 294/423 (69%), Gaps = 3/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F I ALIV+R G++IP+P ID    +K  + +   I  +FNMFSGGA+ R ++
Sbjct: 11  ELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTIIEMFNMFSGGALSRASI 70

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  +KKEGE GR+ I+QYTRY T++L I Q+ GIA 
Sbjct: 71  FALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYTRYGTLVLAIFQSIGIAT 130

Query: 142 GLKNGQGI---VSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           GL N  G+   V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S+IIF+GIVA
Sbjct: 131 GLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVA 190

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
           GLP ++   +E  R G +   ++LL+     AV   V+F ER QRR+++ Y KRQ G R+
Sbjct: 191 GLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRV 250

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFY 318
           +    ++LPLK+N AGV+P+IFASS++L PATI  +    +   W+  +   L  G+  Y
Sbjct: 251 YAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLY 310

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+VG
Sbjct: 311 VLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVG 370

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE +     VP    GTSLLI+V V++D + Q+Q  +++ QYE   KK+ 
Sbjct: 371 ALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKAN 430

Query: 439 SKK 441
            K 
Sbjct: 431 LKG 433


gi|215794644|pdb|3DL8|G Chain G, Structure Of The Complex Of Aquifex Aeolicus Secyeg And Bacillus Subtilis Seca Length = 429 Back     alignment and structure
>gi|209447387|pdb|2ZJS|Y Chain Y, Crystal Structure Of Secye Translocon From Thermus Thermophilus With A Fab Fragment Length = 434 Back     alignment and structure
gi|209156622|pdb|3DIN|C Chain C, Crystal Structure Of The Protein-Translocation Complex Formed By The Secy Channel And The Seca Atpase Length = 431 Back     alignment and structure
>gi|83754005|pdb|2AKH|Y Chain Y, Normal Mode-Based Flexible Fitted Coordinates Of A Non- Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli Length = 400 Back     alignment and structure
>gi|217035348|pdb|3BO0|A Chain A, Ribosome-Secy Complex Length = 442 Back     alignment and structure
>gi|308198535|pdb|3MP7|A Chain A, Lateral Opening Of A Translocon Upon Entry Of Protein Suggests The Mechanism Of Insertion Into Membranes Length = 482 Back     alignment and structure
gi|270346368|pdb|2WWB|A Chain A, Cryo-Em Structure Of The Mammalian Sec61 Complex Bound To The Actively Translating Wheat Germ 80s Ribosome Length = 476 Back     alignment and structure
>gi|40889639|pdb|1RH5|A Chain A, The Structure Of A Protein Conducting Channel Length = 436 Back     alignment and structure
gi|40889642|pdb|1RHZ|A Chain A, The Structure Of A Protein Conducting Channel Length = 436 Back     alignment and structure
>gi|197107393|pdb|3DKN|A Chain A, Sec61 In The Canine Ribosome-Channel Complex From The Endoplasmic Reticulum Length = 430 Back     alignment and structure
>gi|157836736|pdb|2YXQ|A Chain A, The Plug Domain Of The Secy Protein Stablizes The Closed State Of The Translocation Channel And Maintains A Membrane Seal Length = 431 Back     alignment and structure
>gi|157836739|pdb|2YXR|A Chain A, The Plug Domain Of The Secy Protein Stablizes The Closed State Of The Translocation Channel And Maintains A Membrane Seal Length = 426 Back     alignment and structure
gi|270346338|pdb|2WW9|A Chain A, Cryo-Em Structure Of The Active Yeast Ssh1 Complex Bound To The Yeast 80s Ribosome Length = 490 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target444 preprotein translocase subunit SecY [Candidatus Liberib
3dl8_G429 Preprotein translocase subunit SECY; RECA-type ATPase m 1e-105
2zjs_Y434 Preprotein translocase SECY subunit; translocon, SEC, p 8e-95
3din_C431 Preprotein translocase subunit SECY; protein translocat 3e-93
2akh_Y400 Preprotein translocase SECY subunit; protein transport, 2e-92
1rh5_A436 Preprotein translocase SECY subunit; protein translocat 7e-73
3mp7_A482 Preprotein translocase subunit SECY; protein transport, 6e-72
2wwb_A476 Protein transport protein SEC61 subunit alpha isoform 1 2e-68
2ww9_A490 SEC sixty-one protein homolog; ribonucleoprotein, trans 6e-66
>3dl8_G Preprotein translocase subunit SECY; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Length = 429 Back     alignment and structure
 Score =  376 bits (967), Expect = e-105
 Identities = 171/424 (40%), Positives = 274/424 (64%), Gaps = 10/424 (2%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
             K+L+ + +FT++  ++YR G++IP+P I+  +     ++    +F L+++FSGG + R
Sbjct: 10  ELKELRQKFIFTLLMFVIYRLGSHIPIPGINPEALRDFLKAFEGSVFALYDIFSGGNLGR 69

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENL-KKEGEQGRKVINQYTRYATVLLGILQAY 137
           + VF+LG+MPYISASI++QL+   +PSL+ L K+EG+ GR  IN+YT+Y T+ +  +Q+ 
Sbjct: 70  LTVFALGVMPYISASIMMQLLTVAIPSLQRLAKEEGDYGRYKINEYTKYLTLFVATVQSL 129

Query: 138 GIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           GIA  ++      G  +V +    F+  T++TL+ GTMFLVW+ ++IT +GIGNG SLII
Sbjct: 130 GIAFWIRGQVSPKGIPVVENPGISFILITVLTLVAGTMFLVWIADRITEKGIGNGASLII 189

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
           F+GIVA  P++++   E  + G I    +LLI +  +A+I  +++ + A+RR+ IQYP R
Sbjct: 190 FAGIVANFPNAVIQFYEKVKTGDIGPLTLLLIIALIIAIIVGIVYVQEAERRIPIQYPGR 249

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           QVG +++    +YLP+K+N AGV+P IFA +LLL+P+T++ F+       +I  + D   
Sbjct: 250 QVGRQLYAGRKTYLPIKINPAGVIPIIFAQALLLIPSTLLNFV----QNPFIKVIADMFQ 305

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
            G  FY  LY  FIVFF +FYTA++ NP E A+NL K G FIPG+RPG  T  +++ ++ 
Sbjct: 306 PGAIFYNFLYVTFIVFFTYFYTAVLINPVELAENLHKAGAFIPGVRPGQDTVKYLERIIN 365

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG 432
           R+   GA +L  + + P  +     +P    GT+ LI+V V LDT  QI+ YLI ++Y+ 
Sbjct: 366 RLIFFGALFLSVIALIPILISVWFNIPFYFGGTTALIVVGVALDTFRQIETYLIQKKYKS 425

Query: 433 VFKK 436
             ++
Sbjct: 426 YVRR 429


>2zjs_Y Preprotein translocase SECY subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_Y Length = 434 Back     alignment and structure
>3din_C Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8} Length = 431 Back     alignment and structure
>2akh_Y Preprotein translocase SECY subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_Y Length = 400 Back     alignment and structure
>1rh5_A Preprotein translocase SECY subunit; protein translocation, SECY, membrane protein, protein channels, protein transport; 3.20A {Methanocaldococcus jannaschii} SCOP: f.41.1.1 PDB: 1rhz_A 2yxq_A 3dkn_A 2yxr_A 3bo0_A 3bo1_A Length = 436 Back     alignment and structure
>3mp7_A Preprotein translocase subunit SECY; protein transport, membrane protein complex, preprotein TRAN membrane insertion,; 2.90A {Pyrococcus furiosus} Length = 482 Back     alignment and structure
>2wwb_A Protein transport protein SEC61 subunit alpha isoform 1; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris} Length = 476 Back     alignment and structure
>2ww9_A SEC sixty-one protein homolog; ribonucleoprotein, transmembrane, phosphoprotein, signal sequence, membrane, ribosome, cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_A Length = 490 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target444 preprotein translocase subunit SecY [Candidatus Liberib
3din_C431 Preprotein translocase subunit SECY; protein translocat 100.0
2zjs_Y434 Preprotein translocase SECY subunit; translocon, SEC, p 100.0
3dl8_G429 Preprotein translocase subunit SECY; RECA-type ATPase m 100.0
2akh_Y400 Preprotein translocase SECY subunit; protein transport, 100.0
1rh5_A436 Preprotein translocase SECY subunit; protein translocat 100.0
3mp7_A482 Preprotein translocase subunit SECY; protein transport, 100.0
2wwb_A476 Protein transport protein SEC61 subunit alpha isoform 1 100.0
2ww9_A490 SEC sixty-one protein homolog; ribonucleoprotein, trans 100.0
>3din_C Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=100.00  E-value=0  Score=868.25  Aligned_cols=421  Identities=37%  Similarity=0.745  Sum_probs=385.5

Q ss_pred             CCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH-----CCCCHHHHHHHHCCCCHHHHHHHHHCC
Q ss_conf             588988358788999999999999998506798987398899998730-----355378899864277022204687354
Q gi|254780241|r   12 LNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQS-----KSAGIFGLFNMFSGGAVERMAVFSLGI   86 (444)
Q Consensus        12 ~~~~~~~~~~el~~Kil~Tl~il~iyrlg~~IPlPGid~~~~~~~~~~-----~~~~~~~~l~~~sGga~~~~sif~LGI   86 (444)
                      .+|+|+||+||||||++||+++|++||+|++||+||+|++++.+.+++     +++++++++|+|+|||++|+|+|+|||
T Consensus         3 ~~~~~~~k~~eLr~ri~~Tl~iL~iyr~g~~IPlpGid~~~~~~~~~~~~~~~~~~~ll~~~~~fsGGa~~~~Sif~LGI   82 (431)
T 3din_C            3 QAFKNAFKIPELRDRIIFTFLALIVFRMGIYIPVPGLNLEAWGEIFRRIAETAGVAGILSFYDVFTGGALSRFSVFTMSV   82 (431)
T ss_dssp             -----CCSCSCCSSHHHHHHHHHHHHHHHHSCSSCCCCC--------------------CTTHHHHCSSSSCCCSSSSSH
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHCHHHHHCH
T ss_conf             88999976788999999999999999973348999869899999999865124420288999986033341050988455


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC---CCCCCCCHHHHHHHH
Q ss_conf             78999999999998521547864114636899999886999999999999999972355676---225875047999999
Q gi|254780241|r   87 MPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQG---IVSDSDYFFVFSTII  163 (444)
Q Consensus        87 ~PyItASIi~QLL~~~~P~l~~l~kege~gr~ki~~~tr~ltl~~a~iQs~~~~~~l~~~~~---~~~~~~~~~~~~~il  163 (444)
                      +|||||||+||||++.+|.++|+|||||+||||++++||++|+++|++||++++.++.+...   ...++...+.+.+++
T Consensus        83 ~PyItAsII~QLL~~~~p~l~~~~~ege~gr~k~~~~tr~lti~la~iqs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (431)
T 3din_C           83 TPYITASIILQLLASVMPSLKEMLREGEEGRKKFAKYTRRLTLLIGGFQAFFVSFSLARSNPDMVAPGVNVLQFTVLSTM  162 (431)
T ss_dssp             HHHHHHHHHHHHHHHHSCSSSSCSCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSCCCCCCCSSHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             89999999999999755508874000265689999999999999999999999999861688512678615899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999874088987520362101465767887433332001232158999999999999999998865332
Q gi|254780241|r  164 TLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQR  243 (444)
Q Consensus       164 ~L~aGs~il~wl~e~It~~GIGnG~SLiI~~gIi~~lp~~l~~~~~~~~~~~~~~~~~l~~~~~~l~vi~~iV~v~~~~r  243 (444)
                      +|++||+++||+||+|||||+|||+|++|++||++++|+.+.+.+.    +..........+...++++.++|++++++|
T Consensus       163 ~L~~Gt~~l~Wl~e~it~~GiGnGiSliI~~gI~~~lp~~~~~~~~----~~~~~~~~~~~~~~~l~~i~~~V~v~~~~r  238 (431)
T 3din_C          163 SMLAGTMFLLWLGERITEKGIGNGISILIFAGIVARYPSYIRQAYL----GGLNLLEWIFLIAVALITIFGIILVQQAER  238 (431)
T ss_dssp             HHHHHHHHHHHHHHHHTTTTCTTHHHHHHHHHHHHHSTTSSSCCSS----CCSCTHHHHHHHHHHHHHHHHHTTTCCBCC
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHEE
T ss_conf             9999999999998787664317784034357676543599986431----000179999999999999999998764104


Q ss_pred             HHHHCCCHHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             32101101211664235643114442000023799999999986888887507777247999887530667631699999
Q gi|254780241|r  244 RLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYS  323 (444)
Q Consensus       244 rIPi~y~~~~~~~~~~~~~~sylPiKin~aGvmPiIfassll~~p~~i~~~~~~~~~~~~~~~~~~~~~~~~~~y~i~y~  323 (444)
                      |||+||+++.++++.++++++|+|+|+|||||||+||||+++++|++++++++....       .+.++++.++|.++|+
T Consensus       239 ripi~~~~~~~~~~~~~~~~~ylPiKln~aGvmPiIfassll~~p~~i~~~~~~~~~-------~~~~~~~~~~y~~~~~  311 (431)
T 3din_C          239 RITIQYARRVTGRRVYGGASTYLPIKVNQGGVIPIIFASAIVSIPSAIASITNNETL-------KNLFRAGGFLYLLIYG  311 (431)
T ss_dssp             CCCCCBTTTBCCCCCCCCCCCCCCCCCCCCCSSHHHHHHHHHHHHHHHTTSSTTCCC-------CCCSSTTHHHHHHHHH
T ss_pred             EEEEEEHHHHCCCCCCCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHCCCCC-------CCCCCCCCCHHHHHHH
T ss_conf             898775233325554588775054223142237999999999889999987166332-------3303688735599999


Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH
Q ss_conf             99999999998623798999999996388447627985799999999999999999999999999999999848841002
Q gi|254780241|r  324 VFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLS  403 (444)
Q Consensus       324 ilii~Fs~f~~~i~~~P~~iAe~L~k~g~~IpGiRPG~~T~~yL~~v~~rit~~Ga~~l~~la~~p~~~~~~~~~~~~~g  403 (444)
                      +++++|+|||+.+++||||+||||+|+|++|||+||||+|++||+|+++|+|++||+|++++|++|++++...+.+..+|
T Consensus       312 ~lii~fs~f~~~i~~~p~~iAe~L~k~G~~IpGiRpG~~T~~yL~~~i~rlt~~Gsi~l~~ia~lp~l~~~~~~~~~~~g  391 (431)
T 3din_C          312 LLVFFFTYFYSVVIFDPREISENIRKYGGYIPGLRPGRSTEQYLHRVLNRVTFIGAVFLVVIALLPYLVQGAIKVNVWIG  391 (431)
T ss_dssp             HHHHHHHHHHHTCTTHHHHHTTSCCCCBCSSCCCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSCCSCCTT
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99999999999976688999999998698657939986789999999999999989999999999999998548872444


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             5799999999999999999999998526564311016777
Q gi|254780241|r  404 GTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKN  443 (444)
Q Consensus       404 GTslLI~Vgv~l~~~~qi~a~~~~~~Y~~~~~~~~~~~~~  443 (444)
                      |||+||+|||++||+||+|||+.|||||+++||+|.|+|.
T Consensus       392 GTslLI~VgV~~~~~~qi~~~~~~~~Y~~~l~~~~~~~r~  431 (431)
T 3din_C          392 GTSALIAVGVALDIIQQMETHMVMRHYEGFIKKGKIRGRR  431 (431)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCCCCCSSTTCC--------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             5778747999999999999999999878887535666799



>2zjs_Y Preprotein translocase SECY subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_Y Back     alignment and structure
>3dl8_G Preprotein translocase subunit SECY; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Back     alignment and structure
>2akh_Y Preprotein translocase SECY subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_Y Back     alignment and structure
>1rh5_A Preprotein translocase SECY subunit; protein translocation, SECY, membrane protein, protein channels, protein transport; 3.20A {Methanocaldococcus jannaschii} SCOP: f.41.1.1 PDB: 1rhz_A 2yxq_A 3dkn_A 2yxr_A 3bo0_A 3bo1_A Back     alignment and structure
>3mp7_A Preprotein translocase subunit SECY; protein transport, membrane protein complex, preprotein TRAN membrane insertion,; 2.90A {Pyrococcus furiosus} Back     alignment and structure
>2wwb_A Protein transport protein SEC61 subunit alpha isoform 1; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris} Back     alignment and structure
>2ww9_A SEC sixty-one protein homolog; ribonucleoprotein, transmembrane, phosphoprotein, signal sequence, membrane, ribosome, cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 444 preprotein translocase subunit SecY [Candidatus Liberib
d1rh5a_422 f.41.1.1 (A:) Preprotein translocase SecY subunit {Arch 9e-71
>d1rh5a_ f.41.1.1 (A:) Preprotein translocase SecY subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 422 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Preprotein translocase SecY subunit
superfamily: Preprotein translocase SecY subunit
family: Preprotein translocase SecY subunit
domain: Preprotein translocase SecY subunit
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  261 bits (668), Expect = 9e-71
 Identities = 70/432 (16%), Positives = 158/432 (36%), Gaps = 59/432 (13%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           +    K ++ +T I L++Y     I + +           ++   IF  +   +      
Sbjct: 18  KEITFKEKLKWTGIVLVLYFIMGCIDVYTAG---------AQIPAIFEFWQTITAS--RI 66

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
             + +LGI P ++A II+QL+      +  +     + R +     +  ++++  ++A  
Sbjct: 67  GTLITLGIGPIVTAGIIMQLL--VGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVL 124

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
                  G G          F  II +  G++ L++L E ++  GIG+G+ L I +G+  
Sbjct: 125 FV-----GAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQ 179

Query: 199 GLPS------SLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
            +          +       +  +     +     T+ V  +V++ E  +  + + + + 
Sbjct: 180 TIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRI 239

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIM-------------------- 292
           +     +       P+K      +P I A++L                            
Sbjct: 240 KGAVGKY-------PIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAV 292

Query: 293 -GFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHG 351
            G     S+P  +  ++    H   + + +    ++F  F+      +PK  A  +   G
Sbjct: 293 DGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLG 352

Query: 352 GFIPGIRPGDRTALH-IDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
             I G R  ++   H +   +  +TV+ + ++  +      + A+ G      GT +L+ 
Sbjct: 353 MAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGG------GTGVLLT 406

Query: 411 VSVVLDTIVQIQ 422
           VS+V     Q+ 
Sbjct: 407 VSIVYRMYEQLL 418


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target444 preprotein translocase subunit SecY [Candidatus Liberib
d1rh5a_422 Preprotein translocase SecY subunit {Archaeon Methanoco 100.0
>d1rh5a_ f.41.1.1 (A:) Preprotein translocase SecY subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Preprotein translocase SecY subunit
superfamily: Preprotein translocase SecY subunit
family: Preprotein translocase SecY subunit
domain: Preprotein translocase SecY subunit
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=100.00  E-value=0  Score=715.76  Aligned_cols=378  Identities=18%  Similarity=0.282  Sum_probs=319.7

Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             83587889999999999999985067989873988999987303553788998642770222046873547899999999
Q gi|254780241|r   17 FSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV   96 (444)
Q Consensus        17 ~~~~~el~~Kil~Tl~il~iyrlg~~IPlPGid~~~~~~~~~~~~~~~~~~l~~~sGga~~~~sif~LGI~PyItASIi~   96 (444)
                      -.|+.|+|||++||++++++||+|++||+||+|.         +..+.+++++.++|+  +++|+|+|||+|||||||+|
T Consensus        16 p~~~~~lr~kil~T~~~l~iy~igs~IPlpgi~~---------~~~~~~~~~~~~~a~--~~~Sif~LGI~PyItASIIm   84 (422)
T d1rh5a_          16 PVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGA---------QIPAIFEFWQTITAS--RIGTLITLGIGPIVTAGIIM   84 (422)
T ss_dssp             CSSCCCHHHHHHHHHHHHHHHHHHTTSBCCCSSC---------CCCSCCTTHHHHHTC--CTTBTTTTTTHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCC---------CCCCHHHHHHHHHCC--CCCCHHHHCHHHHHHHHHHH
T ss_conf             8888978879999999999999843697688898---------864378899998433--30639996819999999999


Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99985215478641146368999998869999999999999999723556762258750479999999999999999999
Q gi|254780241|r   97 QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLG  176 (444)
Q Consensus        97 QLL~~~~P~l~~l~kege~gr~ki~~~tr~ltl~~a~iQs~~~~~~l~~~~~~~~~~~~~~~~~~il~L~aGs~il~wl~  176 (444)
                      |||+.  |+++++|||||+||+|+|++|||+|+++|++||++++....     ..+.+....+.++++|++||+++||||
T Consensus        85 QLL~~--~~l~~~~~~~~~gr~k~~~~tr~ltl~la~iQa~~~~~~~~-----~~~~~~~~~~~iv~~L~aGt~~lmwL~  157 (422)
T d1rh5a_          85 QLLVG--SGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGA-----FGILTPLLAFLVIIQIAFGSIILIYLD  157 (422)
T ss_dssp             HHHHH--HTTSCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS-----SCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHH--HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99975--16777640166579999999999999999999999995052-----577771599999999999999999999


Q ss_pred             HHHHHCCCCCCCHHHHCCCHHHHHHHHHHHHHHH------HCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9874088987520362101465767887433332------0012321589999999999999999988653323210110
Q gi|254780241|r  177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLEL------GRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP  250 (444)
Q Consensus       177 e~It~~GIGnG~SLiI~~gIi~~lp~~l~~~~~~------~~~~~~~~~~~l~~~~~~l~vi~~iV~v~~~~rrIPi~y~  250 (444)
                      |+|||||+|||+|++|++||++++|+...+....      ...+.......++.+..++++++++||+|+++||||+||+
T Consensus       158 E~It~~GiGnGiSLiI~~gI~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~i~~~vv~~~~~~~~IPv~~~  237 (422)
T d1rh5a_         158 EIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHG  237 (422)
T ss_dssp             HHHHHHSSSCHHHHHHHHHHHHHHHHHHHSTTCHHHHHHHHTTTTCCCGGGTHHHHHHHHHHHHHHHHTTCEEEEECCCS
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99850183543099999999999887501506799999986401433288999999999999999999774313343333


Q ss_pred             HHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCC--------CCCHHHHHHHHHHCCC---------
Q ss_conf             12116642356431144420000237999999999868888875077--------7724799988753066---------
Q gi|254780241|r  251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV--------SSSPTWIVGLVDSLGH---------  313 (444)
Q Consensus       251 ~~~~~~~~~~~~~sylPiKin~aGvmPiIfassll~~p~~i~~~~~~--------~~~~~~~~~~~~~~~~---------  313 (444)
                      |+       +++++|+|+|+|+|||||+|||++++++|.++++++..        .....+..++.+++.+         
T Consensus       238 ~~-------~~~~~~~PiKln~aGviPiIfassll~~p~~i~~~l~~~~~~~l~~~~~~~~~~~i~~~~~~~~~~~~~~~  310 (422)
T d1rh5a_         238 RI-------KGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVIS  310 (422)
T ss_dssp             SS-------TTCCCEEEEESCTTCSHHHHHHHHHHHHHHHHHHHHHTTSCCTTCCBCSSSBSSSTTGGGCCCCSSSCCCS
T ss_pred             CC-------CCCCCCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCHHHCCCC
T ss_conf             22-------34445665003245578999999999708999886331156532566777268899999688320101335


Q ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHHC-CCHHHHHHHHHHCCCCCCCCCCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---763169999999999999998623-7989999999963884476279857999-99999999999999999999999
Q gi|254780241|r  314 ---GRSFYMVLYSVFIVFFAFFYTAIV-FNPKEAADNLKKHGGFIPGIRPGDRTAL-HIDYVLTRVTVVGAGYLVCVCIF  388 (444)
Q Consensus       314 ---~~~~y~i~y~ilii~Fs~f~~~i~-~~P~~iAe~L~k~g~~IpGiRPG~~T~~-yL~~v~~rit~~Ga~~l~~la~~  388 (444)
                         +.++|.++|.+++++|++||+.++ +||||+||||||+|++|||+||||+|.+ ||+|+++|+|++||+|++++|++
T Consensus       311 ~p~~~~~Y~i~~~~l~i~Fs~f~~~~~~~~p~~iAe~lkk~g~~IpGiRpG~~T~~~~L~~vi~rit~~Ga~~l~~ia~~  390 (422)
T d1rh5a_         311 DPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATI  390 (422)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHTCSHHHHHHHC------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             76405899999999999999999997577999999999986981778899930499999989999999999999999999


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999998488410025799999999999999999999
Q gi|254780241|r  389 PEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYL  425 (444)
Q Consensus       389 p~~~~~~~~~~~~~gGTslLI~Vgv~l~~~~qi~a~~  425 (444)
                      |++++..+      ||||+||+|||++||+||+++++
T Consensus       391 p~~l~~~~------gGTslLI~V~v~l~~~~qi~~e~  421 (422)
T d1rh5a_         391 ANFIGALG------GGTGVLLTVSIVYRMYEQLLRER  421 (422)
T ss_dssp             HHHHCCTT------CSHHHHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHC------CHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998843------56879999999999999999821



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 444 preprotein translocase subunit SecY [Candidatus Li
2akh_Y_41-400360 (Y:41-400) Preprotein translocase SECY subunit; pr 2e-91
1rh5_A_436 (A:) Preprotein translocase SECY subunit; protein 1e-78
2zjs_Y_211-434224 (Y:211-434) Preprotein translocase SECY subunit; t 1e-50
2wwb_A_252-476225 (A:252-476) Protein transport protein SEC61 subuni 4e-38
2ww9_A_241-490250 (A:241-490) SEC sixty-one protein homolog; ribonuc 3e-36
2zjs_Y_12-195184 (Y:12-195) Preprotein translocase SECY subunit; tr 2e-49
3dl8_G_1-181181 (G:1-181) Preprotein translocase subunit SECY; REC 6e-44
3din_C_1-183183 (C:1-183) Preprotein translocase subunit SECY; pro 8e-44
2ww9_A_1-215215 (A:1-215) SEC sixty-one protein homolog; ribonucle 3e-39
3din_C_208-387180 (C:208-387) Preprotein translocase subunit SECY; p 8e-42
3dl8_G_232-271_331-35262 (G:232-271,G:331-352) Preprotein translocase subun 4e-14
3dl8_G_272-33059 (G:272-330) Preprotein translocase subunit SECY; R 9e-12
>2akh_Y (Y:41-400) Preprotein translocase SECY subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_YLength = 360 Back     alignment and structure
 Score =  331 bits (849), Expect = 2e-91
 Identities = 180/360 (50%), Positives = 254/360 (70%), Gaps = 3/360 (0%)

Query: 81  VFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIA 140
           +F+LGIMPYISASII+QL+    P+L  +KKEGE GR+ I+QYTRY T++L I Q+ GIA
Sbjct: 1   IFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYTRYGTLVLAIFQSIGIA 60

Query: 141 VGLKN---GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
            GL N    QG+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S+IIF+GIV
Sbjct: 61  TGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIV 120

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLP ++   +E  R G +   ++LL+     AV   V+F ER QRR+++ Y KRQ G R
Sbjct: 121 AGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRR 180

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    ++LPLK+N AGV+P+IFASS++L PATI  +    +   W+  +   L  G+  
Sbjct: 181 VYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPL 240

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+V
Sbjct: 241 YVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLV 300

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE +     VP    GTSLLI+V V++D + Q+Q  +++ QYE   KK+
Sbjct: 301 GALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKA 360


>1rh5_A (A:) Preprotein translocase SECY subunit; protein translocation, SECY, membrane protein, protein channels, protein transport; 3.20A {Methanocaldococcus jannaschii}Length = 436 Back     alignment and structure
>2zjs_Y (Y:211-434) Preprotein translocase SECY subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_YLength = 224 Back     alignment and structure
>2wwb_A (A:252-476) Protein transport protein SEC61 subunit alpha isoform 1; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris}Length = 225 Back     alignment and structure
>2ww9_A (A:241-490) SEC sixty-one protein homolog; ribonucleoprotein, transmembrane, phosphoprotein, signal sequence, membrane, ribosome, cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_ALength = 250 Back     alignment and structure
>2zjs_Y (Y:12-195) Preprotein translocase SECY subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_YLength = 184 Back     alignment and structure
>3dl8_G (G:1-181) Preprotein translocase subunit SECY; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus}Length = 181 Back     alignment and structure
>3din_C (C:1-183) Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8}Length = 183 Back     alignment and structure
>2ww9_A (A:1-215) SEC sixty-one protein homolog; ribonucleoprotein, transmembrane, phosphoprotein, signal sequence, membrane, ribosome, cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_ALength = 215 Back     alignment and structure
>3din_C (C:208-387) Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8}Length = 180 Back     alignment and structure
>3dl8_G (G:232-271,G:331-352) Preprotein translocase subunit SECY; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus}Length = 62 Back     alignment and structure
>3dl8_G (G:272-330) Preprotein translocase subunit SECY; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus}Length = 59 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target444 preprotein translocase subunit SecY [Candidatus Liberib
1rh5_A_436 Preprotein translocase SECY subunit; protein trans 100.0
2akh_Y_41-400360 Preprotein translocase SECY subunit; protein trans 100.0
2zjs_Y_211-434224 Preprotein translocase SECY subunit; translocon, S 100.0
2ww9_A_241-490250 SEC sixty-one protein homolog; ribonucleoprotein, 100.0
2wwb_A_252-476225 Protein transport protein SEC61 subunit alpha isof 100.0
2zjs_Y_12-195184 Preprotein translocase SECY subunit; translocon, S 100.0
3din_C_1-183183 Preprotein translocase subunit SECY; protein trans 100.0
2ww9_A_1-215215 SEC sixty-one protein homolog; ribonucleoprotein, 100.0
3dl8_G_1-181181 Preprotein translocase subunit SECY; RECA-type ATP 100.0
3din_C_208-387180 Preprotein translocase subunit SECY; protein trans 100.0
3dl8_G_232-271_331-35262 Preprotein translocase subunit SECY; RECA-type ATP 99.56
2wwb_A_63-15492 Protein transport protein SEC61 subunit alpha isof 99.34
3dl8_G_272-33059 Preprotein translocase subunit SECY; RECA-type ATP 99.21
>1rh5_A (A:) Preprotein translocase SECY subunit; protein translocation, SECY, membrane protein, protein channels, protein transport; 3.20A {Methanocaldococcus jannaschii} Back     alignment and structure
Probab=100.00  E-value=0  Score=735.34  Aligned_cols=395  Identities=17%  Similarity=0.224  Sum_probs=354.8

Q ss_pred             CHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHCCHHHHHH
Q ss_conf             88988358788999999999999998506798987398899998730355378899864277022204687354789999
Q gi|254780241|r   13 NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA   92 (444)
Q Consensus        13 ~~~~~~~~~el~~Kil~Tl~il~iyrlg~~IPlPGid~~~~~~~~~~~~~~~~~~l~~~sGga~~~~sif~LGI~PyItA   92 (444)
                      .+++.||++|+|+|++||++++++||+|++||+||+|++           .+.+++++++|||++++|+|+|||+|||||
T Consensus        13 ~~~~~~~~~~l~~ki~~Tl~il~iy~ig~~IplpGi~~~-----------~~~~~~~~~~g~a~~~~slf~LGI~P~ItA   81 (436)
T 1rh5_A           13 EVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQ-----------IPAIFEFWQTITASRIGTLITLGIGPIVTA   81 (436)
T ss_dssp             CCCCCSSCCCHHHHHHHHHHHHHHHHHHTTSBCCCSSCC-----------CCSCCTTHHHHHTCCTTBTTTTTTHHHHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCC-----------CCCHHHHHHHHHCCCCCHHHHHCHHHHHHH
T ss_conf             877988889788799999999999998336875888988-----------653789999872431042999772999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999998521547864114636899999886999999999999999972355676225875047999999999999999
Q gi|254780241|r   93 SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFL  172 (444)
Q Consensus        93 SIi~QLL~~~~P~l~~l~kege~gr~ki~~~tr~ltl~~a~iQs~~~~~~l~~~~~~~~~~~~~~~~~~il~L~aGs~il  172 (444)
                      ||+||||+..  +++++||+||+||+|+|++||++|+++|++||++++.++.     ..+.+..+++.++++|++|++++
T Consensus        82 sIi~QLl~~~--~l~~~~~~~~~gr~k~~~~tr~ltl~~a~iqa~~~~~~~~-----~~~~~~~~~~~~~~~L~~Gs~i~  154 (436)
T 1rh5_A           82 GIIMQLLVGS--GIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGA-----FGILTPLLAFLVIIQIAFGSIIL  154 (436)
T ss_dssp             HHHHHHHHHH--TTSCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS-----SCCCCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHC--HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999735--2767630267589999999999999999999999996221-----57886189999999999999999


Q ss_pred             HHHHHHHHHCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHCC------CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999874088987520362101465767887433332001------232158999999999999999998865332321
Q gi|254780241|r  173 VWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRV------GSISTPLMLLIFSSTVAVIALVIFFERAQRRLL  246 (444)
Q Consensus       173 ~wl~e~It~~GIGnG~SLiI~~gIi~~lp~~l~~~~~~~~~------~~~~~~~~l~~~~~~l~vi~~iV~v~~~~rrIP  246 (444)
                      +|+||+|||||+|||+|++|++||++++|+++.+.++....      +.......+..+..++++++++||+|+++||||
T Consensus       155 iwL~e~it~~GiGnG~SliI~~~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~~~~Ip  234 (436)
T 1rh5_A          155 IYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIP  234 (436)
T ss_dssp             HHHHHHHHHHSSSCHHHHHHHHHHHHHHHHHHHSTTCHHHHHHHHTTTTCCCGGGTHHHHHHHHHHHHHHHHTTCEEEEE
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999985028564528999999999988750150469999998874033218899999999999999999878742223


Q ss_pred             HCCCHHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCC--------HHHHHHHHHHCCC-----
Q ss_conf             011012116642356431144420000237999999999868888875077772--------4799988753066-----
Q gi|254780241|r  247 IQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS--------PTWIVGLVDSLGH-----  313 (444)
Q Consensus       247 i~y~~~~~~~~~~~~~~sylPiKin~aGvmPiIfassll~~p~~i~~~~~~~~~--------~~~~~~~~~~~~~-----  313 (444)
                      +||+|       .+++++|+|+|+||+|+||+||||+++++|++++++++....        .+|..++.+++++     
T Consensus       235 i~~~~-------~~~~~~~~PiKln~~GvmPiIfassll~~p~~i~~~l~~~~~~~~~~~~~~~~~~~i~~yls~p~~~~  307 (436)
T 1rh5_A          235 LAHGR-------IKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLS  307 (436)
T ss_dssp             CCCSS-------STTCCCEEEEESCTTCSHHHHHHHHHHHHHHHHHHHHHTTSCCTTCCBCSSSBSSSTTGGGCCCCSSS
T ss_pred             CCCCC-------CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHCCCCHHH
T ss_conf             33432-------23444467755440124689999999985899988632036653345677745788999958841121


Q ss_pred             -------CCCHHHHHHHHHHHHHHHHHHHHC-CCHHHHHHHHHHCCCCCCCCCCCHHHH-HHHHHHHHHHHHHHHHHHHH
Q ss_conf             -------763169999999999999998623-798999999996388447627985799-99999999999999999999
Q gi|254780241|r  314 -------GRSFYMVLYSVFIVFFAFFYTAIV-FNPKEAADNLKKHGGFIPGIRPGDRTA-LHIDYVLTRVTVVGAGYLVC  384 (444)
Q Consensus       314 -------~~~~y~i~y~ilii~Fs~f~~~i~-~~P~~iAe~L~k~g~~IpGiRPG~~T~-~yL~~v~~rit~~Ga~~l~~  384 (444)
                             +.++|.++|.+++++|++||+.++ +||||+||||+|+|++|||+||||+|. +||+|+++|+|++||+++++
T Consensus       308 ~~~~~~~~~~~y~~~~~~l~i~Fs~f~~~~~~~~p~~ia~~l~k~g~~IpGvrpg~~T~~~~L~~~i~~~t~~G~~~l~~  387 (436)
T 1rh5_A          308 SVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGF  387 (436)
T ss_dssp             CCCSCHHHHHHHHHHHHHHHHHHHHHHHHHHTCSHHHHHHHC------------CHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             02357641278999999999999999999867887999999998598077879994149999998999999999999999


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999984884100257999999999999999999999985265643110
Q gi|254780241|r  385 VCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR  438 (444)
Q Consensus       385 la~~p~~~~~~~~~~~~~gGTslLI~Vgv~l~~~~qi~a~~~~~~Y~~~~~~~~  438 (444)
                      +|++|++++..+      ||||+||+|||++|++||+++++.+++|++++||.+
T Consensus       388 la~~p~~~~~~~------~gtsilI~V~v~~~~~~qi~~~~~~~~y~~~~~~~~  435 (436)
T 1rh5_A          388 LATIANFIGALG------GGTGVLLTVSIVYRMYEQLLRERTSELHPAIAKLLN  435 (436)
T ss_dssp             HHHHHHHHCCTT------CSHHHHHHHHHHHHHHHHHHTTCC------------
T ss_pred             HHHHHHHHHHHC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             999999998713------378799999999999999999999987289998717



>2akh_Y (Y:41-400) Preprotein translocase SECY subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_Y Back     alignment and structure
>2zjs_Y (Y:211-434) Preprotein translocase SECY subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_Y Back     alignment and structure
>2ww9_A (A:241-490) SEC sixty-one protein homolog; ribonucleoprotein, transmembrane, phosphoprotein, signal sequence, membrane, ribosome, cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_A Back     alignment and structure
>2wwb_A (A:252-476) Protein transport protein SEC61 subunit alpha isoform 1; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris} Back     alignment and structure
>2zjs_Y (Y:12-195) Preprotein translocase SECY subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_Y Back     alignment and structure
>3din_C (C:1-183) Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8} Back     alignment and structure
>2ww9_A (A:1-215) SEC sixty-one protein homolog; ribonucleoprotein, transmembrane, phosphoprotein, signal sequence, membrane, ribosome, cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_A Back     alignment and structure
>3dl8_G (G:1-181) Preprotein translocase subunit SECY; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Back     alignment and structure
>3din_C (C:208-387) Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8} Back     alignment and structure
>3dl8_G (G:232-271,G:331-352) Preprotein translocase subunit SECY; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Back     alignment and structure
>2wwb_A (A:63-154) Protein transport protein SEC61 subunit alpha isoform 1; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris} Back     alignment and structure
>3dl8_G (G:272-330) Preprotein translocase subunit SECY; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} Back     alignment and structure