254780246

254780246

50S ribosomal protein L6

GeneID in NCBI database:8209227Locus tag:CLIBASIA_00655
Protein GI in NCBI database:254780246Protein Accession:YP_003064659.1
Gene range:-(135595, 136128)Protein Length:177aa
Gene description:50S ribosomal protein L6
COG prediction:[J] Ribosomal protein L6P/L9E
KEGG prediction:rplF; 50S ribosomal protein L6; K02933 large subunit ribosomal protein L6
SEED prediction:LSU ribosomal protein L6p (L9e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK
cccccccccccccccEEEEEccEEEEEEcccEEEEEccccEEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHHEEcccEEEEEEEEcccEEEEEcccEEEEEcccccEEEEEcccccEEEEccccEEEEEEccHHHHHHHHHHHHccccccccccccEEEcccEEEEEEcccc
ccccccccEEcccccEEEEEccEEEEEEccEEEEEEcccccEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEccccEEEEEccEEEEEccccccEEEcccccEEEEEEEccEEEEEEccHHHHHHHHHHHHcccccccccccEEEEcccccEEEccccc
msrigkkaiqvplgvdvavedheikvkgpkgqlsfMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGvtkgyerkleisgvgcrafmdgrnlkmslgfshdvlytplegisifvskpteiIVSGIDKQKVGHVAAEIRSYrsaepykgkgirysGEVIIRKEGKKK
msrigkkaiqvplgvdvavedheikvkgpkgqlsfMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVsgidkqkvghVAAEIrsyrsaepykgkgirysgeviirkegkkk
MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK
MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGK**
MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK
****GKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK
MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK
MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
315122803177 50S ribosomal protein L6 [Candidatus Liberibacter solan 1 3e-75
227821771177 50S ribosomal protein L6 [Sinorhizobium fredii NGR234] 1 3e-60
222148381177 50S ribosomal protein L6 [Agrobacterium vitis S4] Lengt 1 3e-59
222085690177 50S ribosomal protein L6 [Agrobacterium radiobacter K84 1 5e-59
86357320177 50S ribosomal protein L6 [Rhizobium etli CFN 42] Length 1 5e-59
150396222177 50S ribosomal protein L6 [Sinorhizobium medicae WSM419] 1 9e-59
325293321177 50S ribosomal protein L6 [Agrobacterium sp. H13-3] Leng 1 9e-59
15965124177 50S ribosomal protein L6 [Sinorhizobium meliloti 1021] 1 1e-58
159184985177 50S ribosomal protein L6 [Agrobacterium tumefaciens str 1 2e-58
116251555177 50S ribosomal protein L6 [Rhizobium leguminosarum bv. v 1 7e-58
>gi|315122803|ref|YP_004063292.1| 50S ribosomal protein L6 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 177 Back     alignment and organism information
 Score =  284 bits (727), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 157/177 (88%)

Query: 1   MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKK 60
           MSRIGKK+IQ+P GVDVA+E+ EIKVKGPKGQLSFM++D I V   +GMLSV  +  SK 
Sbjct: 1   MSRIGKKSIQIPSGVDVAIENREIKVKGPKGQLSFMVTDDIDVVSDKGMLSVNVVGNSKV 60

Query: 61  ARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEG 120
           +R+ WGMSRTMI+NLFHGVT GY+RKLEISGVGCRAFMDG NLKMSLGFSHD++Y+PLEG
Sbjct: 61  SRSIWGMSRTMISNLFHGVTNGYQRKLEISGVGCRAFMDGANLKMSLGFSHDIIYSPLEG 120

Query: 121 ISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK 177
           +SI VSK TEI+VSGIDKQKVG VAA+IRSYR+AEPYKGKGI+YS EV++RK GKKK
Sbjct: 121 VSISVSKSTEIVVSGIDKQKVGQVAADIRSYRTAEPYKGKGIKYSDEVVVRKIGKKK 177


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821771|ref|YP_002825741.1| 50S ribosomal protein L6 [Sinorhizobium fredii NGR234] Length = 177 Back     alignment and organism information
>gi|222148381|ref|YP_002549338.1| 50S ribosomal protein L6 [Agrobacterium vitis S4] Length = 177 Back     alignment and organism information
>gi|222085690|ref|YP_002544220.1| 50S ribosomal protein L6 [Agrobacterium radiobacter K84] Length = 177 Back     alignment and organism information
>gi|86357320|ref|YP_469212.1| 50S ribosomal protein L6 [Rhizobium etli CFN 42] Length = 177 Back     alignment and organism information
>gi|150396222|ref|YP_001326689.1| 50S ribosomal protein L6 [Sinorhizobium medicae WSM419] Length = 177 Back     alignment and organism information
>gi|325293321|ref|YP_004279185.1| 50S ribosomal protein L6 [Agrobacterium sp. H13-3] Length = 177 Back     alignment and organism information
>gi|15965124|ref|NP_385477.1| 50S ribosomal protein L6 [Sinorhizobium meliloti 1021] Length = 177 Back     alignment and organism information
>gi|159184985|ref|NP_354909.2| 50S ribosomal protein L6 [Agrobacterium tumefaciens str. C58] Length = 177 Back     alignment and organism information
>gi|116251555|ref|YP_767393.1| 50S ribosomal protein L6 [Rhizobium leguminosarum bv. viciae 3841] Length = 177 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
PRK05498178 PRK05498, rplF, 50S ribosomal protein L6; Validated 2e-73
TIGR03654175 TIGR03654, L6_bact, ribosomal protein L6, bacterial typ 1e-69
COG0097178 COG0097, RplF, Ribosomal protein L6P/L9E [Translation, 9e-52
KOG3254211 KOG3254, KOG3254, KOG3254, Mitochondrial/chloroplast ri 1e-35
PRK05518180 PRK05518, rpl6p, 50S ribosomal protein L6P; Reviewed 3e-16
TIGR03653170 TIGR03653, arch_L6P, archaeal ribosomal protein L6P 8e-15
CHL00140178 CHL00140, rpl6, ribosomal protein L6; Validated 9e-54
pfam0034776 pfam00347, Ribosomal_L6, Ribosomal protein L6 2e-17
pfam0034776 pfam00347, Ribosomal_L6, Ribosomal protein L6 8e-07
>gnl|CDD|180118 PRK05498, rplF, 50S ribosomal protein L6; Validated Back     alignment and domain information
>gnl|CDD|163378 TIGR03654, L6_bact, ribosomal protein L6, bacterial type Back     alignment and domain information
>gnl|CDD|30446 COG0097, RplF, Ribosomal protein L6P/L9E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|38464 KOG3254, KOG3254, KOG3254, Mitochondrial/chloroplast ribosomal protein L6 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180122 PRK05518, rpl6p, 50S ribosomal protein L6P; Reviewed Back     alignment and domain information
>gnl|CDD|163377 TIGR03653, arch_L6P, archaeal ribosomal protein L6P Back     alignment and domain information
>gnl|CDD|177062 CHL00140, rpl6, ribosomal protein L6; Validated Back     alignment and domain information
>gnl|CDD|109407 pfam00347, Ribosomal_L6, Ribosomal protein L6 Back     alignment and domain information
>gnl|CDD|109407 pfam00347, Ribosomal_L6, Ribosomal protein L6 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
PRK05498178 rplF 50S ribosomal protein L6; Validated 100.0
CHL00140178 rpl6 ribosomal protein L6; Validated 100.0
TIGR03654175 L6_bact ribosomal protein L6, bacterial type. 100.0
COG0097178 RplF Ribosomal protein L6P/L9E [Translation, ribosomal 100.0
PRK05518181 rpl6p 50S ribosomal protein L6P; Reviewed 100.0
TIGR03653170 arch_L6P archaeal ribosomal protein L6P. Members of thi 100.0
KOG3254211 consensus 100.0
PTZ00179189 60S ribosomal protein L9; Provisional 100.0
PTZ00027190 60S ribosomal protein L6; Provisional 100.0
KOG3255179 consensus 99.62
pfam0034776 Ribosomal_L6 Ribosomal protein L6. 99.73
pfam0034776 Ribosomal_L6 Ribosomal protein L6. 99.24
>PRK05498 rplF 50S ribosomal protein L6; Validated Back     alignment and domain information
>CHL00140 rpl6 ribosomal protein L6; Validated Back     alignment and domain information
>TIGR03654 L6_bact ribosomal protein L6, bacterial type Back     alignment and domain information
>COG0097 RplF Ribosomal protein L6P/L9E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05518 rpl6p 50S ribosomal protein L6P; Reviewed Back     alignment and domain information
>TIGR03653 arch_L6P archaeal ribosomal protein L6P Back     alignment and domain information
>KOG3254 consensus Back     alignment and domain information
>PTZ00179 60S ribosomal protein L9; Provisional Back     alignment and domain information
>PTZ00027 60S ribosomal protein L6; Provisional Back     alignment and domain information
>KOG3255 consensus Back     alignment and domain information
>pfam00347 Ribosomal_L6 Ribosomal protein L6 Back     alignment and domain information
>pfam00347 Ribosomal_L6 Ribosomal protein L6 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
1rl6_A177 Ribosomal Protein L6 Length = 177 6e-50
1vs6_G177 Crystal Structure Of The Bacterial Ribosome From Es 4e-49
1eg0_J171 Fitting Of Components With Known Structure Into An 6e-49
1p85_E176 Real Space Refined Coordinates Of The 50s Subunit F 6e-48
487d_J164 Seven Ribosomal Proteins Fitted To A Cryo-Electron 2e-44
1nkw_E212 Crystal Structure Of The Large Ribosomal Subunit Fr 3e-44
1nwx_E185 Complex Of The Large Ribosomal Subunit From Deinoco 5e-43
2gya_E167 Structure Of The 50s Subunit Of A Pre-Translocation 5e-43
3bbo_I223 Homology Model For The Spinach Chloroplast 50s Subu 1e-42
1pnu_E177 Crystal Structure Of A Streptomycin Dependent Ribos 6e-42
2j01_H180 Structure Of The Thermus Thermophilus 70s Ribosome 4e-39
3fin_H160 T. Thermophilus 70s Ribosome In Complex With Mrna, 7e-31
3pyo_G159 Crystal Structure Of A Complex Containing Domain 3 1e-30
1s72_E178 Refined Crystal Structure Of The Haloarcula Marismo 9e-19
1ffk_1177 Crystal Structure Of The Large Ribosomal Subunit Fr 3e-18
3g4s_E172 Co-Crystal Structure Of Tiamulin Bound To The Large 4e-18
2zkr_e192 Structure Of A Mammalian Ribosomal 60s Subunit With 1e-16
3izr_F190 Localization Of The Large Subunit Ribosomal Protein 4e-16
1s1i_H191 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 2e-13
3jyw_H179 Structure Of The 60s Proteins For Eukaryotic Riboso 2e-13
2cql_A100 Solution Structure Of The N-Terminal Domain Of Huma 7e-07
>gi|4388840|pdb|1RL6|A Chain A, Ribosomal Protein L6 Length = 177 Back     alignment and structure
 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 82/174 (47%), Positives = 117/174 (67%)

Query: 2   SRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKA 61
           SR+GKK I++P GV V V  + + VKGPKG+L+      +++T++  +++V   +  K  
Sbjct: 1   SRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITVEGNVITVTRPSDEKHH 60

Query: 62  RAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGI 121
           RA  G +R+++ N+  GV+KGYE+ LE+ GVG RA   G+ L +S+G+SH V   P EG+
Sbjct: 61  RALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEGL 120

Query: 122 SIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGK 175
            I V   T+IIV G DKQ+VG +AA IR+ R  EPYKGKGIRY GE++  KEGK
Sbjct: 121 EIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIRYEGELVRLKEGK 174


gi|116666577|pdb|1VS6|G Chain G, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 177 Back     alignment and structure
>gi|33357906|pdb|1P85|E Chain E, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 176 Back     alignment and structure
>gi|7767186|pdb|487D|J Chain J, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution Length = 164 Back     alignment and structure
>gi|28948924|pdb|1NKW|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 212 Back     alignment and structure
gi|29726792|pdb|1NWX|E Chain E, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 Length = 185 Back     alignment and structure
>gi|116667439|pdb|2GYA|E Chain E, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 167 Back     alignment and structure
gi|189096131|pdb|3BBO|I Chain I, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 223 Back     alignment and structure
>gi|34811558|pdb|1PNU|E Chain E, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 177 Back     alignment and structure
gi|116668239|pdb|2J01|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 180 Back     alignment and structure
>gi|224510786|pdb|3FIN|H Chain H, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 160 Back     alignment and structure
>gi|322812578|pdb|3PYO|G Chain G, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 159 Back     alignment and structure
gi|50513474|pdb|1S72|E Chain E, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 178 Back     alignment and structure
>gi|10120946|pdb|1FFK|1 Chain 1, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 177 Back     alignment and structure
>gi|228312146|pdb|3G4S|E Chain E, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 172 Back     alignment and structure
gi|187609303|pdb|2ZKR|EE Chain e, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 192 Back     alignment and structure
>gi|315113252|pdb|3IZR|F Chain F, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 190 Back     alignment and structure
gi|49258846|pdb|1S1I|H Chain H, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h. Length = 191 Back     alignment and structure
>gi|281500838|pdb|3JYW|H Chain H, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 179 Back     alignment and structure
>gi|159163871|pdb|2CQL|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Ribosomal Protein L9 Length = 100 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
3ofq_G176 50S ribosomal protein L6; protein biosynthesis, ribosom 2e-51
1nkw_E212 50S ribosomal protein L6; ribosome, large subunit, X- R 1e-48
1rl6_A177 Protein (ribosomal protein L6); RNA-binding protein, ge 2e-42
3i1n_G177 50S ribosomal protein L6; ribosome structure, protein-R 2e-41
3bbo_I223 Ribosomal protein L6; large ribosomal subunit, spinach 3e-41
2j01_H180 50S ribosomal protein L6; ribosome, tRNA, paromomycin, 6e-41
2zjr_E185 50S ribosomal protein L6; ribosome, large ribosomal sub 1e-40
3jyw_H179 60S ribosomal protein L9(A); eukaryotic ribosome, RACK1 2e-35
2zkr_e192 60S ribosomal protein L9; protein-RNA complex, 60S ribo 1e-32
1vq8_E178 50S ribosomal protein L6P; ribosome 50S, protein-protei 4e-29
2cql_A100 OK/SW-CL.103, 60S ribosomal protein L9; N-terminal doma 1e-14
>3ofq_G 50S ribosomal protein L6; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* 2qbe_G 2qbg_G 2qbi_G* 2qbk_G* 2qov_G 2qox_G 2qoz_G* 2qp1_G* 2rdo_G 2vhm_G ... Length = 176 Back     alignment and structure
 Score =  197 bits (501), Expect = 2e-51
 Identities = 73/176 (41%), Positives = 109/176 (61%)

Query: 2   SRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKA 61
           SR+ K  + VP GVDV +    I +KG  G+L+  ++D + V   +  L+    +G    
Sbjct: 1   SRVAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEVKHADNTLTFGPRDGYADG 60

Query: 62  RAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGI 121
            A  G +R ++N++  GVT+G+ +KL++ GVG RA + G  + +SLGFSH V +    GI
Sbjct: 61  WAQAGTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAGI 120

Query: 122 SIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK 177
           +      TEI++ G DKQ +G VAA++R+YR  EPYKGKG+RY+ EV+  KE KKK
Sbjct: 121 TAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVRTKEAKKK 176


>1nkw_E 50S ribosomal protein L6; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1sm1_E* Length = 212 Back     alignment and structure
>1rl6_A Protein (ribosomal protein L6); RNA-binding protein, gentamicin resistance, alpha/beta protein; 2.00A {Geobacillus stearothermophilus} SCOP: d.141.1.1 d.141.1.1 PDB: 1giy_H 1ml5_h* 1c04_B 1yl3_H 2b66_H 2b9n_H 2b9p_H 1eg0_J 487d_J Length = 177 Back     alignment and structure
>3i1n_G 50S ribosomal protein L6; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_G 3e1b_3 3e1d_3 1vs6_G 3i1p_G 3i1r_G 3i1t_G 3i20_G 3i22_G 2qam_G* 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* ... Length = 177 Back     alignment and structure
>3bbo_I Ribosomal protein L6; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Length = 223 Back     alignment and structure
>2j01_H 50S ribosomal protein L6; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: d.141.1.1 d.141.1.1 PDB: 1vsp_F 2hgj_H 2hgq_H 2hgu_H 1vsa_F 2j03_H 2jl6_H 2jl8_H 2v47_H 2v49_H 2wdi_H 2wdj_H 2wdl_H 2wdn_H 2wh2_H 2wh4_H 3d5b_H 3d5d_H 3f1f_H 3f1h_H ... Length = 180 Back     alignment and structure
>2zjr_E 50S ribosomal protein L6; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.141.1.1 d.141.1.1 PDB: 1nwx_E* 1xbp_E* 2zjp_E* 2zjq_E 1nwy_E 3cf5_E* 3dll_E* 1pnu_E 1pny_E 1vor_H 1vou_H 1vow_H 1voy_H 1vp0_H Length = 185 Back     alignment and structure
>3jyw_H 60S ribosomal protein L9(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_H Length = 179 Back     alignment and structure
>2zkr_e 60S ribosomal protein L9; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 192 Back     alignment and structure
>1vq8_E 50S ribosomal protein L6P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.141.1.1 d.141.1.1 PDB: 1vq4_E* 1vq5_E* 1vq6_E* 1vq7_E* 1s72_E* 1vq9_E* 1vqk_E* 1vql_E* 1vqm_E* 1vqn_E* 1vqo_E* 1vqp_E* 1yhq_E* 1yi2_E* 1yij_E* 1yit_E* 1yj9_E* 1yjn_E* 1yjw_E* 2otj_E* ... Length = 178 Back     alignment and structure
>2cql_A OK/SW-CL.103, 60S ribosomal protein L9; N-terminal domain, alpha and beta (A+B), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.141.1.1 Length = 100 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
1nkw_E212 50S ribosomal protein L6; ribosome, large subunit, X- R 100.0
3bbo_I223 Ribosomal protein L6; large ribosomal subunit, spinach 100.0
1rl6_A177 Protein (ribosomal protein L6); RNA-binding protein, ge 100.0
2j01_H180 50S ribosomal protein L6; ribosome, tRNA, paromomycin, 100.0
2zjr_E185 50S ribosomal protein L6; ribosome, large ribosomal sub 100.0
3ofq_G176 50S ribosomal protein L6; protein biosynthesis, ribosom 100.0
1vq8_E178 50S ribosomal protein L6P; ribosome 50S, protein-protei 100.0
2zkr_e192 60S ribosomal protein L9; protein-RNA complex, 60S ribo 100.0
3jyw_H179 60S ribosomal protein L9(A); eukaryotic ribosome, RACK1 100.0
2bol_A314 TSP36, small heat shock protein; A-crystallin, molecula 90.75
2cql_A100 OK/SW-CL.103, 60S ribosomal protein L9; N-terminal doma 99.92
>1nkw_E 50S ribosomal protein L6; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1sm1_E* Back     alignment and structure
Probab=100.00  E-value=0  Score=447.61  Aligned_cols=176  Identities=45%  Similarity=0.748  Sum_probs=174.6

Q ss_pred             CCCCCCCCCCCCCCCEEEEECCEEEEEECCCEEEEEECCCEEEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEECC
Q ss_conf             97444645107997589997998999906946999826863999707589985055432201338887521125897511
Q gi|254780246|r    1 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVT   80 (177)
Q Consensus         1 MSrIgk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~~~v~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GVt   80 (177)
                      ||||||+||.||++|+|+++++.|+|+||+|+|++.+++++.++.+++++.+.+++++++++|||||+||||+|||+||+
T Consensus        28 MSRIGk~pI~IP~gV~v~i~~~~v~VkGp~G~ls~~~~~~v~i~~~~~~i~v~~~~~~k~~kal~GT~rslI~NmI~GVs  107 (212)
T 1nkw_E           28 MSRIGKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVS  107 (212)
T ss_pred             CCHHCCCCEECCCCCEEEEECCEEEEEECCEEEEEECCCCEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCEEEEEE
T ss_conf             06304776117999789997999999908956999848872888459999999775413689999899987536799982


Q ss_pred             EEEEEEEEEECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             00377787404763012204249999515676552588503899769988999957998987999874100747985787
Q gi|254780246|r   81 KGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGK  160 (177)
Q Consensus        81 ~Gf~~~L~lvgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGK  160 (177)
                      +||+|+|+++|+||||+++++.|.|+|||||++.+.||+||+++++++|+|+|+|+|||.||||||+||++|+|||||||
T Consensus       108 ~Gf~k~L~lvGvGyra~v~~~~L~l~LG~Sh~i~~~IP~gV~v~v~~~t~I~I~GiDKe~Vgq~AA~Ir~~rkpepYKGK  187 (212)
T 1nkw_E          108 DGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGK  187 (212)
T ss_pred             CCEEEEEEEEECCCCCEECCCEEEEEECCCCCEEEECCCCCEEEECCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             35089999864313111057455777501143464289985898448998999978999999999998614899896898


Q ss_pred             CEEECCEEEEEEECCC
Q ss_conf             4345370999710566
Q gi|254780246|r  161 GIRYSGEVIIRKEGKK  176 (177)
Q Consensus       161 gI~~~~e~I~~KegKk  176 (177)
                      ||||+||||++|||||
T Consensus       188 GI~~~ge~I~~K~GKk  203 (212)
T 1nkw_E          188 GVRFVGEQIALKAGKA  203 (212)
T ss_pred             CCCCCCEEEEEECCCC
T ss_conf             7079788999826544



>3bbo_I Ribosomal protein L6; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure
>1rl6_A Protein (ribosomal protein L6); RNA-binding protein, gentamicin resistance, alpha/beta protein; 2.00A {Geobacillus stearothermophilus} SCOP: d.141.1.1 d.141.1.1 PDB: 1giy_H 1ml5_h* 1c04_B 1yl3_H 2b66_H 2b9n_H 2b9p_H 1eg0_J 487d_J Back     alignment and structure
>2j01_H 50S ribosomal protein L6; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: d.141.1.1 d.141.1.1 PDB: 1vsp_F 2hgj_H 2hgq_H 2hgu_H 1vsa_F 2j03_H 2jl6_H 2jl8_H 2v47_H 2v49_H 2wdi_H 2wdj_H 2wdl_H 2wdn_H 2wh2_H 2wh4_H 2wrj_H 2wrl_H 2wro_H 2wrr_H ... Back     alignment and structure
>2zjr_E 50S ribosomal protein L6; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.141.1.1 d.141.1.1 PDB: 1nwx_E* 1xbp_E* 2zjp_E* 2zjq_E 1nwy_E 3cf5_E* 3dll_E* 1pnu_E 1pny_E 1vor_H 1vou_H 1vow_H 1voy_H 1vp0_H Back     alignment and structure
>3ofq_G 50S ribosomal protein L6; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* 2qbe_G 2qbg_G 2qbi_G* 2qbk_G* 2qov_G 2qox_G 2qoz_G* 2qp1_G* 2rdo_G 2vhm_G ... Back     alignment and structure
>1vq8_E 50S ribosomal protein L6P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.141.1.1 d.141.1.1 PDB: 1vq4_E* 1vq5_E* 1vq6_E* 1vq7_E* 1s72_E* 1vq9_E* 1vqk_E* 1vql_E* 1vqm_E* 1vqn_E* 1vqo_E* 1vqp_E* 1yhq_E* 1yi2_E* 1yij_E* 1yit_E* 1yj9_E* 1yjn_E* 1yjw_E* 2otj_E* ... Back     alignment and structure
>2zkr_e 60S ribosomal protein L9; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3jyw_H 60S ribosomal protein L9(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_H Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2cql_A OK/SW-CL.103, 60S ribosomal protein L9; N-terminal domain, alpha and beta (A+B), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.141.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
d2qamg295 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia 4e-32
d2j01h289 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus ther 4e-29
d2zjre190 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus 4e-28
d1rl6a289 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillus ste 2e-27
d2qamg181 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia co 2e-18
d2zjre278 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus ra 1e-16
d1rl6a175 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stear 1e-15
d2j01h171 d.141.1.1 (H:12-82) Ribosomal protein L6 {Thermus therm 2e-15
d2cqla187 d.141.1.1 (A:1-87) Ribosomal protein L6 {Human (Homo sa 6e-14
d1vqoe179 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloa 2e-13
>d2qamg2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} Length = 95 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein L6
superfamily: Ribosomal protein L6
family: Ribosomal protein L6
domain: Ribosomal protein L6
species: Escherichia coli [TaxId: 562]
 Score =  131 bits (331), Expect = 4e-32
 Identities = 47/95 (49%), Positives = 65/95 (68%)

Query: 83  YERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVG 142
           + +KL++ GVG RA + G  + +SLGFSH V +    GI+      TEI++ G DKQ +G
Sbjct: 1   FTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAGITAECPTQTEIVLKGADKQVIG 60

Query: 143 HVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK 177
            VAA++R+YR  EPYKGKG+RY+ EV+  KE KKK
Sbjct: 61  QVAADLRAYRRPEPYKGKGVRYADEVVRTKEAKKK 95


>d2j01h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} Length = 89 Back     information, alignment and structure
>d2zjre1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} Length = 90 Back     information, alignment and structure
>d1rl6a2 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Length = 89 Back     information, alignment and structure
>d2qamg1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} Length = 81 Back     information, alignment and structure
>d2zjre2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} Length = 78 Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Length = 75 Back     information, alignment and structure
>d2j01h1 d.141.1.1 (H:12-82) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} Length = 71 Back     information, alignment and structure
>d2cqla1 d.141.1.1 (A:1-87) Ribosomal protein L6 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1vqoe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 79 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
d2qamg295 Ribosomal protein L6 {Escherichia coli [TaxId: 562]} 100.0
d2zjre190 Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1 100.0
d1rl6a289 Ribosomal protein L6 {Bacillus stearothermophilus [TaxI 100.0
d2j01h289 Ribosomal protein L6 {Thermus thermophilus [TaxId: 274] 100.0
d1vqoe293 Ribosomal protein L6 {Archaeon Haloarcula marismortui [ 99.81
d2qamg181 Ribosomal protein L6 {Escherichia coli [TaxId: 562]} 99.92
d2cqla187 Ribosomal protein L6 {Human (Homo sapiens) [TaxId: 9606 99.89
d1rl6a175 Ribosomal protein L6 {Bacillus stearothermophilus [TaxI 99.88
d2zjre278 Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1 99.87
d1vqoe179 Ribosomal protein L6 {Archaeon Haloarcula marismortui [ 99.87
d2j01h171 Ribosomal protein L6 {Thermus thermophilus [TaxId: 274] 99.79
>d2qamg2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein L6
superfamily: Ribosomal protein L6
family: Ribosomal protein L6
domain: Ribosomal protein L6
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.1e-40  Score=253.87  Aligned_cols=95  Identities=49%  Similarity=0.816  Sum_probs=93.9

Q ss_pred             EEEEEEEECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCCE
Q ss_conf             37778740476301220424999951567655258850389976998899995799898799987410074798578743
Q gi|254780246|r   83 YERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGI  162 (177)
Q Consensus        83 f~~~L~lvgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGKgI  162 (177)
                      |+++|+++|+||||+++|+.|.|+|||||++.+.+|++++++++++|.|+|+|+|||.||||||+||++|+|||||||||
T Consensus         1 f~k~L~lvGVGYRa~~~g~~L~l~LGySH~i~~~iP~gI~v~~~~~t~i~i~g~dKq~vg~~Aa~Ir~~r~pepYKGKGI   80 (95)
T d2qamg2           1 FTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGV   80 (95)
T ss_dssp             CCCCCCBCSSSCCCCCCTTEECCCSSSSSCCCEECCSSEECCCSSTTCCCCEESCHHHHHHHHHHHHTTTCCCTTSCCSB
T ss_pred             CEEEEEEEEEEEEEEECCCEEEEEEECCEECEECCCCCCEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCCE
T ss_conf             95899999689999976998999981320010419988479706887899998289999899999861589989689757


Q ss_pred             EECCEEEEEEECCCC
Q ss_conf             453709997105669
Q gi|254780246|r  163 RYSGEVIIRKEGKKK  177 (177)
Q Consensus       163 ~~~~e~I~~KegKkK  177 (177)
                      +|+||+|.|||||||
T Consensus        81 ~y~~E~i~~K~gKkK   95 (95)
T d2qamg2          81 RYADEVVRTKEAKKK   95 (95)
T ss_dssp             CCTTCCCCCCCCCCC
T ss_pred             EECCEEEEECCCCCC
T ss_conf             698819993164679



>d2zjre1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1rl6a2 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j01h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vqoe2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2qamg1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cqla1 d.141.1.1 (A:1-87) Ribosomal protein L6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2zjre2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1vqoe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2j01h1 d.141.1.1 (H:12-82) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 177 50S ribosomal protein L6 [Candidatus Liberibacter
3i1n_G_82-17796 (G:82-177) 50S ribosomal protein L6; ribosome stru 2e-34
1rl6_A_81-17797 (A:81-177) Protein (ribosomal protein L6); RNA-bin 6e-34
2zjr_E_83-185103 (E:83-185) 50S ribosomal protein L6; ribosome, lar 1e-32
1nkw_E_110-212103 (E:110-212) 50S ribosomal protein L6; ribosome, la 1e-32
3bbo_I_124-223100 (I:124-223) Ribosomal protein L6; large ribosomal 1e-28
2j01_H_82-18099 (H:82-180) 50S ribosomal protein L6; ribosome, tRN 3e-28
1nkw_E_1-109109 (E:1-109) 50S ribosomal protein L6; ribosome, larg 5e-23
2zjr_E_1-8282 (E:1-82) 50S ribosomal protein L6; ribosome, large 6e-22
2j01_H_1-8181 (H:1-81) 50S ribosomal protein L6; ribosome, tRNA, 9e-22
3i1n_G_1-8181 (G:1-81) 50S ribosomal protein L6; ribosome struct 2e-21
1rl6_A_1-8080 (A:1-80) Protein (ribosomal protein L6); RNA-bindi 2e-21
3bbo_I_1-123123 (I:1-123) Ribosomal protein L6; large ribosomal su 7e-20
2cql_A_100 (A:) OK/SW-CL.103, 60S ribosomal protein L9; N-ter 2e-18
2zkr_e_1-8686 (e:1-86) 60S ribosomal protein L9; protein-RNA com 6e-18
1vq8_E_1-7979 (E:1-79) 50S ribosomal protein L6P; ribosome 50S, 2e-17
3jyw_H_1-7979 (H:1-79) 60S ribosomal protein L9(A); eukaryotic r 1e-16
>3i1n_G (G:82-177) 50S ribosomal protein L6; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_G 3e1b_3 3e1d_3 1vs6_G 3i1p_G 3i1r_G 3i1t_G 3i20_G 3i22_G 2qam_G* 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* ...Length = 96 Back     alignment and structure
 Score =  139 bits (352), Expect = 2e-34
 Identities = 48/96 (50%), Positives = 66/96 (68%)

Query: 82  GYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKV 141
           G+ +KL++ GVG RA + G  + +SLGFSH V +    GI+      TEI++ G DKQ +
Sbjct: 1   GFTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAGITAECPTQTEIVLKGADKQVI 60

Query: 142 GHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK 177
           G VAA++R+YR  EPYKGKG+RY+ EV+  KE KKK
Sbjct: 61  GQVAADLRAYRRPEPYKGKGVRYADEVVRTKEAKKK 96


>1rl6_A (A:81-177) Protein (ribosomal protein L6); RNA-binding protein, gentamicin resistance, alpha/beta protein; 2.00A {Geobacillus stearothermophilus}Length = 97 Back     alignment and structure
>2zjr_E (E:83-185) 50S ribosomal protein L6; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 103 Back     alignment and structure
>1nkw_E (E:110-212) 50S ribosomal protein L6; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans}Length = 103 Back     alignment and structure
>3bbo_I (I:124-223) Ribosomal protein L6; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana}Length = 100 Back     alignment and structure
>2j01_H (H:82-180) 50S ribosomal protein L6; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 99 Back     alignment and structure
>1nkw_E (E:1-109) 50S ribosomal protein L6; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans}Length = 109 Back     alignment and structure
>2zjr_E (E:1-82) 50S ribosomal protein L6; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 82 Back     alignment and structure
>2j01_H (H:1-81) 50S ribosomal protein L6; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 81 Back     alignment and structure
>3i1n_G (G:1-81) 50S ribosomal protein L6; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_G 3e1b_3 3e1d_3 1vs6_G 3i1p_G 3i1r_G 3i1t_G 3i20_G 3i22_G 2qam_G* 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* ...Length = 81 Back     alignment and structure
>1rl6_A (A:1-80) Protein (ribosomal protein L6); RNA-binding protein, gentamicin resistance, alpha/beta protein; 2.00A {Geobacillus stearothermophilus}Length = 80 Back     alignment and structure
>3bbo_I (I:1-123) Ribosomal protein L6; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana}Length = 123 Back     alignment and structure
>2cql_A (A:) OK/SW-CL.103, 60S ribosomal protein L9; N-terminal domain, alpha and beta (A+B), structural genomics, NPPSFA; NMR {Homo sapiens}Length = 100 Back     alignment and structure
>2zkr_e (e:1-86) 60S ribosomal protein L9; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 86 Back     alignment and structure
>1vq8_E (E:1-79) 50S ribosomal protein L6P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 79 Back     alignment and structure
>3jyw_H (H:1-79) 60S ribosomal protein L9(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_HLength = 79 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 50S ribosomal protein L6 [Candidatus Liberibacter asiat
1rl6_A_81-17797 Protein (ribosomal protein L6); RNA-binding protei 100.0
1nkw_E_110-212103 50S ribosomal protein L6; ribosome, large subunit, 100.0
3i1n_G_82-17796 50S ribosomal protein L6; ribosome structure, prot 100.0
2zjr_E_83-185103 50S ribosomal protein L6; ribosome, large ribosoma 100.0
2j01_H_82-18099 50S ribosomal protein L6; ribosome, tRNA, paromomy 100.0
3bbo_I_124-223100 Ribosomal protein L6; large ribosomal subunit, spi 100.0
1vq8_E_80-17899 50S ribosomal protein L6P; ribosome 50S, protein-p 99.81
2zkr_e_87-192106 60S ribosomal protein L9; protein-RNA complex, 60S 99.79
3jyw_H_80-179100 60S ribosomal protein L9(A); eukaryotic ribosome, 99.75
1nkw_E_1-109109 50S ribosomal protein L6; ribosome, large subunit, 99.95
2cql_A_100 OK/SW-CL.103, 60S ribosomal protein L9; N-terminal 99.94
3i1n_G_1-8181 50S ribosomal protein L6; ribosome structure, prot 99.93
2zjr_E_1-8282 50S ribosomal protein L6; ribosome, large ribosoma 99.93
2j01_H_1-8181 50S ribosomal protein L6; ribosome, tRNA, paromomy 99.93
1rl6_A_1-8080 Protein (ribosomal protein L6); RNA-binding protei 99.92
3bbo_I_1-123123 Ribosomal protein L6; large ribosomal subunit, spi 99.92
2zkr_e_1-8686 60S ribosomal protein L9; protein-RNA complex, 60S 99.91
1vq8_E_1-7979 50S ribosomal protein L6P; ribosome 50S, protein-p 99.88
3jyw_H_1-7979 60S ribosomal protein L9(A); eukaryotic ribosome, 99.84
>1rl6_A (A:81-177) Protein (ribosomal protein L6); RNA-binding protein, gentamicin resistance, alpha/beta protein; 2.00A {Geobacillus stearothermophilus} Back     alignment and structure
Probab=100.00  E-value=1.7e-39  Score=249.31  Aligned_cols=96  Identities=55%  Similarity=0.893  Sum_probs=95.0

Q ss_pred             EEEEEEEEECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             03777874047630122042499995156765525885038997699889999579989879998741007479857874
Q gi|254780246|r   82 GYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKG  161 (177)
Q Consensus        82 Gf~~~L~lvgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGKg  161 (177)
                      ||+++|+++|+||||+++++.|.|+|||||++.+.||++++++|++||.|+|+|+|||.|+||||+||++|+||||||||
T Consensus         1 Gf~~~LelvGvGYra~~~~~~L~l~LG~SH~i~~~iP~~i~v~~~k~t~i~i~g~dKq~vg~fAa~Ir~~R~pepYKGKG   80 (97)
T 1rl6_A            1 GYEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKG   80 (97)
T ss_dssp             CEEEEEEEESTTCEEEEETTEEEEESSSSSCEEECCCTTEEEEEEETTEEEEEESCHHHHHHHHHHHHTTSCCCTTTCCE
T ss_pred             CCEEEEEEECCCCEEECCCCEEEEECCCCCCCCCCCCCCEEEEECCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             50789998516522560497999971655453235899779995478500685168999999999987307998845998


Q ss_pred             EEECCEEEEEEECCCC
Q ss_conf             3453709997105669
Q gi|254780246|r  162 IRYSGEVIIRKEGKKK  177 (177)
Q Consensus       162 I~~~~e~I~~KegKkK  177 (177)
                      |||+||+|.||||||+
T Consensus        81 I~y~~E~i~~K~gKk~   96 (97)
T 1rl6_A           81 IRYEGELVRLKEGKTG   96 (97)
T ss_dssp             EEETTCCCCC------
T ss_pred             CCCCCEEEEECCCCCC
T ss_conf             6687869997375578



>1nkw_E (E:110-212) 50S ribosomal protein L6; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} Back     alignment and structure
>3i1n_G (G:82-177) 50S ribosomal protein L6; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_G 3e1b_3 3e1d_3 1vs6_G 3i1p_G 3i1r_G 3i1t_G 3i20_G 3i22_G 2qam_G* 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* ... Back     alignment and structure
>2zjr_E (E:83-185) 50S ribosomal protein L6; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
>2j01_H (H:82-180) 50S ribosomal protein L6; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>3bbo_I (I:124-223) Ribosomal protein L6; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure
>1vq8_E (E:80-178) 50S ribosomal protein L6P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>2zkr_e (e:87-192) 60S ribosomal protein L9; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3jyw_H (H:80-179) 60S ribosomal protein L9(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_H Back     alignment and structure
>1nkw_E (E:1-109) 50S ribosomal protein L6; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} Back     alignment and structure
>2cql_A (A:) OK/SW-CL.103, 60S ribosomal protein L9; N-terminal domain, alpha and beta (A+B), structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i1n_G (G:1-81) 50S ribosomal protein L6; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_G 3e1b_3 3e1d_3 1vs6_G 3i1p_G 3i1r_G 3i1t_G 3i20_G 3i22_G 2qam_G* 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* ... Back     alignment and structure
>2zjr_E (E:1-82) 50S ribosomal protein L6; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
>2j01_H (H:1-81) 50S ribosomal protein L6; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>1rl6_A (A:1-80) Protein (ribosomal protein L6); RNA-binding protein, gentamicin resistance, alpha/beta protein; 2.00A {Geobacillus stearothermophilus} Back     alignment and structure
>3bbo_I (I:1-123) Ribosomal protein L6; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure
>2zkr_e (e:1-86) 60S ribosomal protein L9; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1vq8_E (E:1-79) 50S ribosomal protein L6P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>3jyw_H (H:1-79) 60S ribosomal protein L9(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_H Back     alignment and structure