254780248

254780248

30S ribosomal protein S14

GeneID in NCBI database:8209229Locus tag:CLIBASIA_00665
Protein GI in NCBI database:254780248Protein Accession:YP_003064661.1
Gene range:-(136575, 136880)Protein Length:101aa
Gene description:30S ribosomal protein S14
COG prediction:[J] Ribosomal protein S14
KEGG prediction:rpsN; 30S ribosomal protein S14; K02954 small subunit ribosomal protein S14
SEED prediction:SSU ribosomal protein S14p (S29e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHcHHHHHHHHHHHcccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccHHccccccccccccHHHHcccHHHHHHHHHHccccccEEEccc
MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQlgslprdgsrvrvrnrceisgrsrgvyrdFRLSRLALRElggvgkipgiikssw
makvsavernkrrlrvvakqaskrlalkkivmdksvTLEERFDAMlqlgslprdgsrvrvrnrceisgrsrgvyrdfrlsrlalrelggvgkipgiikssw
MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW
*AKVSAVERNKRRLRVVAKQASKRLALKKI********EERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW
********RNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW
****SAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKS**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW
MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW
MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target101 30S ribosomal protein S14 [Candidatus Liberibacter asia
315122805101 30S ribosomal protein S14 [Candidatus Liberibacter sola 1 4e-41
227821769101 30S ribosomal protein S14 [Sinorhizobium fredii NGR234] 1 5e-33
86357318101 30S ribosomal protein S14 [Rhizobium etli CFN 42] Lengt 1 8e-33
15889230101 30S ribosomal protein S14 [Agrobacterium tumefaciens st 1 1e-32
222085688101 30S ribosomal protein S14 [Agrobacterium radiobacter K8 1 1e-32
116251553101 30S ribosomal protein S14 [Rhizobium leguminosarum bv. 1 4e-32
15965122101 30S ribosomal protein S14 [Sinorhizobium meliloti 1021] 1 8e-32
150396220101 30S ribosomal protein S14 [Sinorhizobium medicae WSM419 1 1e-31
222148379101 30S ribosomal protein S14 [Agrobacterium vitis S4] Leng 1 3e-31
49474391101 30S ribosomal protein S14 [Bartonella quintana str. Tou 1 2e-30
>gi|315122805|ref|YP_004063294.1| 30S ribosomal protein S14 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 101 Back     alignment and organism information
 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%)

Query: 1   MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRV 60
           MAKVS VE+NKRR R V  QASKRLALKKI+MDKSVTLEERF+AM+QLGSLPR+GS+VR 
Sbjct: 1   MAKVSLVEKNKRRFRTVNNQASKRLALKKILMDKSVTLEERFNAMIQLGSLPRNGSKVRT 60

Query: 61  RNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101
            NRCE+SGRS  VYRDFRLSRLALRELG VGKIPGIIKSSW
Sbjct: 61  CNRCEVSGRSHSVYRDFRLSRLALRELGSVGKIPGIIKSSW 101


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821769|ref|YP_002825739.1| 30S ribosomal protein S14 [Sinorhizobium fredii NGR234] Length = 101 Back     alignment and organism information
>gi|86357318|ref|YP_469210.1| 30S ribosomal protein S14 [Rhizobium etli CFN 42] Length = 101 Back     alignment and organism information
>gi|15889230|ref|NP_354911.1| 30S ribosomal protein S14 [Agrobacterium tumefaciens str. C58] Length = 101 Back     alignment and organism information
>gi|222085688|ref|YP_002544218.1| 30S ribosomal protein S14 [Agrobacterium radiobacter K84] Length = 101 Back     alignment and organism information
>gi|116251553|ref|YP_767391.1| 30S ribosomal protein S14 [Rhizobium leguminosarum bv. viciae 3841] Length = 101 Back     alignment and organism information
>gi|15965122|ref|NP_385475.1| 30S ribosomal protein S14 [Sinorhizobium meliloti 1021] Length = 101 Back     alignment and organism information
>gi|150396220|ref|YP_001326687.1| 30S ribosomal protein S14 [Sinorhizobium medicae WSM419] Length = 101 Back     alignment and organism information
>gi|222148379|ref|YP_002549336.1| 30S ribosomal protein S14 [Agrobacterium vitis S4] Length = 101 Back     alignment and organism information
>gi|49474391|ref|YP_032433.1| 30S ribosomal protein S14 [Bartonella quintana str. Toulouse] Length = 101 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target101 30S ribosomal protein S14 [Candidatus Liberibacter asia
PRK08881101 PRK08881, rpsN, 30S ribosomal protein S14; Reviewed 2e-34
KOG1741103 KOG1741, KOG1741, KOG1741, Mitochondrial/chloroplast ri 2e-12
PRK06911100 PRK06911, rpsN, 30S ribosomal protein S14; Reviewed 2e-09
CHL00074100 CHL00074, rps14, ribosomal protein S14 1e-22
pfam0025355 pfam00253, Ribosomal_S14, Ribosomal protein S14p/S29e 3e-13
COG019961 COG0199, RpsN, Ribosomal protein S14 [Translation, ribo 8e-12
PRK0806161 PRK08061, rpsN, 30S ribosomal protein S14; Reviewed 2e-10
>gnl|CDD|181574 PRK08881, rpsN, 30S ribosomal protein S14; Reviewed Back     alignment and domain information
>gnl|CDD|36952 KOG1741, KOG1741, KOG1741, Mitochondrial/chloroplast ribosomal protein S14/S29 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180742 PRK06911, rpsN, 30S ribosomal protein S14; Reviewed Back     alignment and domain information
>gnl|CDD|177013 CHL00074, rps14, ribosomal protein S14 Back     alignment and domain information
>gnl|CDD|144002 pfam00253, Ribosomal_S14, Ribosomal protein S14p/S29e Back     alignment and domain information
>gnl|CDD|30548 COG0199, RpsN, Ribosomal protein S14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181216 PRK08061, rpsN, 30S ribosomal protein S14; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 101 30S ribosomal protein S14 [Candidatus Liberibacter asia
PRK08881101 rpsN 30S ribosomal protein S14; Reviewed 100.0
PRK06911100 rpsN 30S ribosomal protein S14; Reviewed 100.0
CHL00074100 rps14 ribosomal protein S14 100.0
KOG1741103 consensus 100.0
PRK0806161 rpsN 30S ribosomal protein S14; Reviewed 99.87
COG019961 RpsN Ribosomal protein S14 [Translation, ribosomal stru 99.85
pfam0025355 Ribosomal_S14 Ribosomal protein S14p/S29e. This family 99.81
PRK0576652 rps14P 30S ribosomal protein S14P; Reviewed 93.36
PTZ0021854 40S ribosomal protein S29; Provisional 91.76
>PRK08881 rpsN 30S ribosomal protein S14; Reviewed Back     alignment and domain information
>PRK06911 rpsN 30S ribosomal protein S14; Reviewed Back     alignment and domain information
>CHL00074 rps14 ribosomal protein S14 Back     alignment and domain information
>KOG1741 consensus Back     alignment and domain information
>PRK08061 rpsN 30S ribosomal protein S14; Reviewed Back     alignment and domain information
>COG0199 RpsN Ribosomal protein S14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00253 Ribosomal_S14 Ribosomal protein S14p/S29e Back     alignment and domain information
>PRK05766 rps14P 30S ribosomal protein S14P; Reviewed Back     alignment and domain information
>PTZ00218 40S ribosomal protein S29; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target101 30S ribosomal protein S14 [Candidatus Liberibacter asia
1vs5_N101 Crystal Structure Of The Bacterial Ribosome From Es 3e-26
1p6g_N100 Real Space Refined Coordinates Of The 30s Subunit F 2e-25
3fih_N96 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 8e-22
3bbn_N100 Homology Model For The Spinach Chloroplast 30s Subu 2e-21
2gy9_N61 Structure Of The 30s Subunit Of A Pre-Translocation 2e-13
1i94_N60 Crystal Structures Of The Small Ribosomal Subunit W 2e-09
1fjg_N61 Structure Of The Thermus Thermophilus 30s Ribosomal 3e-09
gi|116666561|pdb|1VS5|N Chain N, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 101 Back     alignment and structure
 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 45/101 (44%), Positives = 64/101 (63%)

Query: 1   MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRV 60
           MAK S   R  +R+ +  K  +KR  LK I+ D + + E+R++A+L+L +LPRD S  R 
Sbjct: 1   MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQ 60

Query: 61  RNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101
           RNRC  +GR  G  R F LSR+ +RE    G+IPG+ K+SW
Sbjct: 61  RNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW 101


>gi|33357891|pdb|1P6G|N Chain N, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 100 Back     alignment and structure
>gi|224510715|pdb|3FIH|N Chain N, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 96 Back     alignment and structure
gi|188036215|pdb|3BBN|N Chain N, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. Length = 100 Back     alignment and structure
>gi|116667423|pdb|2GY9|N Chain N, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 61 Back     alignment and structure
>gi|14278543|pdb|1I94|N Chain N, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 60 Back     alignment and structure
gi|10835598|pdb|1FJG|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 61 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target101 30S ribosomal protein S14 [Candidatus Liberibacter asia
3i1m_N101 30S ribosomal protein S14; ribosome structure, protein- 3e-25
3ofo_N100 30S ribosomal protein S14; protein biosynthesis, riboso 3e-25
3bbn_N100 Ribosomal protein S14; small ribosomal subunit, spinach 2e-24
2vqe_N61 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-bi 1e-12
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.002
>3i1m_N 30S ribosomal protein S14; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_N* 3e1a_G 3e1c_G 1vs5_N 3i1o_N 3i1q_N 3i1s_N 3i1z_N 3i21_N 2qal_N* 1p6g_N 1p87_N 2aw7_N 2avy_N 2i2u_N 2i2p_N* 2qan_N* 2qb9_N* 2qbb_N* 2qbd_N ... Length = 101 Back     alignment and structure
 Score =  108 bits (271), Expect = 3e-25
 Identities = 45/101 (44%), Positives = 64/101 (63%)

Query: 1   MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRV 60
           MAK S   R  +R+ +  K  +KR  LK I+ D + + E+R++A+L+L +LPRD S  R 
Sbjct: 1   MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQ 60

Query: 61  RNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101
           RNRC  +GR  G  R F LSR+ +RE    G+IPG+ K+SW
Sbjct: 61  RNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW 101


>3ofo_N 30S ribosomal protein S14; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 1p6g_N 1p87_N 2aw7_N 2avy_N 2i2u_N 2i2p_N* 2qan_N* 2qb9_N* 2qbb_N* 2qbd_N 2qbf_N 2qbh_N* 2qbj_N* 2qou_N* 2qow_N* 2qoy_N* 2qp0_N* 2vho_N 2vhp_N 2z4k_N* ... Length = 100 Back     alignment and structure
>3bbn_N Ribosomal protein S14; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 100 Back     alignment and structure
>2vqe_N 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: g.39.1.7 PDB: 1gix_Q* 1hnw_N* 1hnx_N* 1hnz_N* 1hr0_N 1ibk_N* 1ibl_N* 1ibm_N 1jgo_Q* 1jgp_Q* 1jgq_Q* 1ml5_Q* 1xmo_N* 1xmq_N* 1xnq_N* 1xnr_N* 1yl4_Q 2b64_N* 2b9m_N* 2b9o_N* ... Length = 61 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 30S ribosomal protein S14 [Candidatus Liberibacter asia
3ofo_N100 30S ribosomal protein S14; protein biosynthesis, riboso 100.0
3bbn_N100 Ribosomal protein S14; small ribosomal subunit, spinach 100.0
2vqe_N61 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-bi 99.87
2zkq_n56 40S ribosomal protein S29E; protein-RNA complex, 40S ri 91.81
3jyv_N50 40S ribosomal protein S29(A); eukaryotic ribosome, RACK 91.54
>3ofo_N 30S ribosomal protein S14; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 1p6g_N 1p87_N 2aw7_N 2avy_N 2i2u_N 2i2p_N* 2qan_N* 2qb9_N* 2qbb_N* 2qbd_N 2qbf_N 2qbh_N* 2qbj_N* 2qou_N* 2qow_N* 2qoy_N* 2qp0_N* 2vho_N 2vhp_N 2z4k_N* ... Back     alignment and structure
Probab=100.00  E-value=4e-42  Score=275.78  Aligned_cols=100  Identities=44%  Similarity=0.714  Sum_probs=99.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCHHHHHHCHHH
Q ss_conf             12689999999999999999999999998348798989999999997208604432444022143566411440425629
Q gi|254780248|r    2 AKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSR   81 (101)
Q Consensus         2 akks~i~rd~kRr~l~~k~~~kR~~lk~~~~~~~l~~~~r~~a~~kL~~Lprnss~tRi~NRC~~TGR~Rgv~r~f~lSR   81 (101)
                      ||+|+|+||.+|++++++|+.+|.+||+++.|+++|++++++|+.+|++||+|||||||+|||++||||||||++|||||
T Consensus         1 AK~s~i~R~~kR~~l~~k~~~kR~~Lk~i~~~~~l~~~~r~~a~~kL~~LPrnSs~~RirNRC~~TGR~Rgv~r~f~lsR   80 (100)
T 3ofo_N            1 AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSR   80 (100)
T ss_dssp             CCHHHHHHHHHHHHHHHHSTTTGGGTTTTTTSSCC----CCTHHHHSCCCCSSCSGGGCCCCCTTTCCCSSEETTTTEEH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCHHHCCCHHCCCCCCCCCCCCCCHH
T ss_conf             90489999999999999999999999999847799999999999999847834200154046023796652213425439


Q ss_pred             HHHHHHHHCCCCCCCCCCCC
Q ss_conf             99999996589998321469
Q gi|254780248|r   82 LALRELGGVGKIPGIIKSSW  101 (101)
Q Consensus        82 i~fRela~~G~ipGv~KaSW  101 (101)
                      |+|||||+.|+||||+||||
T Consensus        81 i~fRela~~G~ipGv~KaSW  100 (100)
T 3ofo_N           81 IKVREAAMRGEIPGLKKASW  100 (100)
T ss_dssp             HHHHHHHTTSCSTTEEECCC
T ss_pred             HHHHHHHHCCCCCCEECCCC
T ss_conf             99999997697888431679



>3bbn_N Ribosomal protein S14; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2vqe_N 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: g.39.1.7 PDB: 1gix_Q* 1hnw_N* 1hnx_N* 1hnz_N* 1hr0_N 1ibk_N* 1ibl_N* 1ibm_N 1jgo_Q* 1jgp_Q* 1jgq_Q* 1ml5_Q* 1xmo_N* 1xmq_N* 1xnq_N* 1xnr_N* 1yl4_Q 2b64_N* 2b9m_N* 2b9o_N* ... Back     alignment and structure
>2zkq_n 40S ribosomal protein S29E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1h_N Back     alignment and structure
>3jyv_N 40S ribosomal protein S29(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 101 30S ribosomal protein S14 [Candidatus Liberibacter asia
d2qaln1100 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia c 2e-25
d2uubn160 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermo 7e-13
>d2qaln1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} Length = 100 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Ribosomal protein S14
domain: Ribosomal protein S14
species: Escherichia coli [TaxId: 562]
 Score =  108 bits (271), Expect = 2e-25
 Identities = 44/100 (44%), Positives = 63/100 (63%)

Query: 2   AKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVR 61
           AK S   R  +R+ +  K  +KR  LK I+ D + + E+R++A+L+L +LPRD S  R R
Sbjct: 1   AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQR 60

Query: 62  NRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101
           NRC  +GR  G  R F LSR+ +RE    G+IPG+ K+SW
Sbjct: 61  NRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW 100


>d2uubn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} Length = 60 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 30S ribosomal protein S14 [Candidatus Liberibacter asia
d2qaln1100 Ribosomal protein S14 {Escherichia coli [TaxId: 562]} 100.0
d2uubn160 Ribosomal protein S14 {Thermus thermophilus [TaxId: 274 99.85
>d2qaln1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Ribosomal protein S14
domain: Ribosomal protein S14
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.4e-42  Score=277.12  Aligned_cols=100  Identities=44%  Similarity=0.714  Sum_probs=99.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCHHHHHHCHHH
Q ss_conf             12689999999999999999999999998348798989999999997208604432444022143566411440425629
Q gi|254780248|r    2 AKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSR   81 (101)
Q Consensus         2 akks~i~rd~kRr~l~~k~~~kR~~lk~~~~~~~l~~~~r~~a~~kL~~Lprnss~tRi~NRC~~TGR~Rgv~r~f~lSR   81 (101)
                      ||||+|+||.+|++|+++|+.+|.+|++++.|+++|.|++++|+.+|++||+||||||++|||++||||||||++|||||
T Consensus         1 AKkS~i~Rd~kR~~l~~ky~~kR~~Lk~i~~n~~l~~e~r~~a~~kL~~LPrnss~tRirnRC~~TGR~Rg~~r~f~lsR   80 (100)
T d2qaln1           1 AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSR   80 (100)
T ss_dssp             CCHHHHHHHHHHHHHHHHTGGGTGGGTTTTTSSCC----CCHHHHHHTTTTSTTCSTTCCCCCSSSCCSSSCBTTTTBCH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCEEECCCCCHH
T ss_conf             90389999999999999999999999999847789999999999998627843036888751303797653312435329


Q ss_pred             HHHHHHHHCCCCCCCCCCCC
Q ss_conf             99999996589998321469
Q gi|254780248|r   82 LALRELGGVGKIPGIIKSSW  101 (101)
Q Consensus        82 i~fRela~~G~ipGv~KaSW  101 (101)
                      |+|||||+.|+||||+||||
T Consensus        81 i~fR~la~~G~lpGv~KaSW  100 (100)
T d2qaln1          81 IKVREAAMRGEIPGLKKASW  100 (100)
T ss_dssp             HHHHHHHHHTCSTTCEECCC
T ss_pred             HHHHHHHHCCCCCCEECCCC
T ss_conf             99999997697888622679



>d2uubn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 101 30S ribosomal protein S14 [Candidatus Liberibacter
3bbn_N_100 (N:) Ribosomal protein S14; small ribosomal subuni 2e-24
3i1m_N_46-10156 (N:46-101) 30S ribosomal protein S14; ribosome str 6e-16
2vqe_N_61 (N:) 30S ribosomal protein S14 type Z; tRNA-bindin 1e-14
>3bbn_N (N:) Ribosomal protein S14; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 100 Back     alignment and structure
 Score =  105 bits (264), Expect = 2e-24
 Identities = 33/101 (32%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 1   MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRV 60
           MA+ S ++R K+R  +  K    R + K+ +   + +L ++++   +L S PR+ +  R+
Sbjct: 1   MARKSLIQREKKRRNLEQKYHLIRRSSKQEIRKVT-SLSDKWEIHGKLQSPPRNSAPARL 59

Query: 61  RNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101
             RC ++GR R   RDF LS   LRE+     +PG  +SSW
Sbjct: 60  HRRCFLTGRPRANIRDFGLSGHILREMVHTCLLPGATRSSW 100


>3i1m_N (N:46-101) 30S ribosomal protein S14; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_N* 3e1a_G 3e1c_G 1vs5_N 3i1o_N 3i1q_N 3i1s_N 3i1z_N 3i21_N 2qal_N* 1p6g_N 1p87_N 2aw7_N 2avy_N 2i2u_N 2i2p_N* 2qan_N* 2qb9_N* 2qbb_N* 2qbd_N ...Length = 56 Back     alignment and structure
>2vqe_N (N:) 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 61 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 30S ribosomal protein S14 [Candidatus Liberibacter asia
3bbn_N_100 Ribosomal protein S14; small ribosomal subunit, sp 100.0
3i1m_N_46-10156 30S ribosomal protein S14; ribosome structure, pro 99.91
2vqe_N_61 30S ribosomal protein S14 type Z; tRNA-binding, rR 99.9
2zkq_n_56 40S ribosomal protein S29E; protein-RNA complex, 4 93.06
3jyv_N_50 40S ribosomal protein S29(A); eukaryotic ribosome, 92.67
>3bbn_N (N:) Ribosomal protein S14; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
Probab=100.00  E-value=5.4e-40  Score=263.79  Aligned_cols=100  Identities=32%  Similarity=0.504  Sum_probs=97.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCHHHHHHCHH
Q ss_conf             91268999999999999999999999999834879898999999999720860443244402214356641144042562
Q gi|254780248|r    1 MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLS   80 (101)
Q Consensus         1 Makks~i~rd~kRr~l~~k~~~kR~~lk~~~~~~~l~~~~r~~a~~kL~~Lprnss~tRi~NRC~~TGR~Rgv~r~f~lS   80 (101)
                      |||||+|+||.+|++++++||.+|..||++++|+++| +++++++.+|++||+||||||++|||++||||||||++||||
T Consensus         1 Makks~i~rd~krR~l~~k~e~~R~~lK~~~kn~~~p-~~r~~~~~~l~~lpr~ss~~ri~nRC~~tGR~rgv~r~f~ls   79 (100)
T 3bbn_N            1 MARKSLIQREKKRRNLEQKYHLIRRSSKQEIRKVTSL-SDKWEIHGKLQSPPRNSAPARLHRRCFLTGRPRANIRDFGLS   79 (100)
T ss_dssp             -CCTTHHHHHHTTTSSTTTTSSSTTTTTTTTSSCCSS-SCCCSHHHHSCCSCSSCCGGGCCCCCSSSCCSSSBCTTTCSB
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHHHCCCCCCHHHHCCCCCCCCCCEEECCCCCH
T ss_conf             9568899999999999999999999999988056886-689999999986433668278864864589966420122636


Q ss_pred             HHHHHHHHHCCCCCCCCCCCC
Q ss_conf             999999996589998321469
Q gi|254780248|r   81 RLALRELGGVGKIPGIIKSSW  101 (101)
Q Consensus        81 Ri~fRela~~G~ipGv~KaSW  101 (101)
                      ||+|||||+.|+||||+||||
T Consensus        80 Ri~fR~la~~G~lpGv~KaSW  100 (100)
T 3bbn_N           80 GHILREMVHTCLLPGATRSSW  100 (100)
T ss_dssp             TTHHHHHHTTTCSSSCEECCC
T ss_pred             HHHHHHHHHCCCCCCEECCCC
T ss_conf             999999998697988522779



>3i1m_N (N:46-101) 30S ribosomal protein S14; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_N* 3e1a_G 3e1c_G 1vs5_N 3i1o_N 3i1q_N 3i1s_N 3i1z_N 3i21_N 2qal_N* 1p6g_N 1p87_N 2aw7_N 2avy_N 2i2u_N 2i2p_N* 2qan_N* 2qb9_N* 2qbb_N* 2qbd_N ... Back     alignment and structure
>2vqe_N (N:) 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
>2zkq_n (n:) 40S ribosomal protein S29E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1h_N Back     alignment and structure
>3jyv_N (N:) 40S ribosomal protein S29(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} Back     alignment and structure