254780249

254780249

50S ribosomal protein L5

GeneID in NCBI database:8209230Locus tag:CLIBASIA_00670
Protein GI in NCBI database:254780249Protein Accession:YP_003064662.1
Gene range:-(136902, 137459)Protein Length:185aa
Gene description:50S ribosomal protein L5
COG prediction:[J] Ribosomal protein L5
KEGG prediction:rplE; 50S ribosomal protein L5; K02931 large subunit ribosomal protein L5
SEED prediction:LSU ribosomal protein L5p (L11e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK
ccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEEEEEEHHHHHHHHHHHHHHccccEEccccccccccccccEEEcccccHHcccccccccccccccEEEEEEEccccHHHHHHHHHHHcccccc
cccccccHHHHHHHHHcHHHHHHHHHccccHHHcccEEEEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccEEEEEEEEcHHHHHHHHHHHHHccHHHccccccEccccEcccccEEEEEccHHHcccccHHHccccccEEEEEEEccccHHHHHHHHHHHcccEcc
mvdckyeprlkKEYCLRIREAMQQEfsyknvmqipkIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGfklrtgmpigtkvtlrgtnmYDFLDRLINMgmprirdfhglnsrsfdgsgnfsfgirehivfpeinydkvdcvlgmdisictttrsDREAKYLLTlfgfpfpk
mvdckyeprlkkEYCLRIREAMQqefsyknvmqipKIEKVVVNMGVGESIADSKKAESAAADLalitgqkpvitrARRSiagfklrtgmpigtkvtlrgtnMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK
MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGesiadskkaesaaadlaliTGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK
****KYE*RLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFP*
MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK
****KYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK
MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK
MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
315122806185 50S ribosomal protein L5 [Candidatus Liberibacter solan 1 8e-91
163760811185 putative 50S ribosomal protein L5 [Hoeflea phototrophic 1 5e-73
325293324184 50S ribosomal protein L5 [Agrobacterium sp. H13-3] Leng 1 2e-72
15889231184 50S ribosomal protein L5 [Agrobacterium tumefaciens str 1 1e-70
304391465193 50S ribosomal protein L5 [Ahrensia sp. R2A130] Length = 1 7e-69
114704496187 50S ribosomal protein L5 [Fulvimarina pelagi HTCC2506] 1 5e-68
167645590185 50S ribosomal protein L5 [Caulobacter sp. K31] Length = 1 8e-68
190891367185 50S ribosomal protein L5 [Rhizobium etli CIAT 652] Leng 1 1e-67
227821768185 50S ribosomal protein L5 [Sinorhizobium fredii NGR234] 1 1e-67
86357317185 50S ribosomal protein L5 [Rhizobium etli CFN 42] Length 1 1e-67
>gi|315122806|ref|YP_004063295.1| 50S ribosomal protein L5 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 185 Back     alignment and organism information
 Score =  336 bits (862), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 159/185 (85%), Positives = 173/185 (93%)

Query: 1   MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAA 60
           M D KYEPRLKKEY  RIRE MQ+EFSYKNVMQIPKIEKVVVNMGVGESI+DSKK +SAA
Sbjct: 1   MSDYKYEPRLKKEYRERIREGMQKEFSYKNVMQIPKIEKVVVNMGVGESISDSKKLDSAA 60

Query: 61  ADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDF 120
           +DLALITGQKPV+TRARRSIAGFKLR GMPIGTKVTLRGTNMY+FLD LINMGMPR+RDF
Sbjct: 61  SDLALITGQKPVVTRARRSIAGFKLREGMPIGTKVTLRGTNMYEFLDSLINMGMPRMRDF 120

Query: 121 HGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFG 180
           HGLNS+SFDG GNFSFGI+EHI+FP+INYDKV  +LGMDISICTTT SD+EAK+LLTLFG
Sbjct: 121 HGLNSKSFDGRGNFSFGIKEHIIFPQINYDKVSSILGMDISICTTTGSDKEAKHLLTLFG 180

Query: 181 FPFPK 185
           FPFPK
Sbjct: 181 FPFPK 185


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163760811|ref|ZP_02167890.1| putative 50S ribosomal protein L5 [Hoeflea phototrophica DFL-43] Length = 185 Back     alignment and organism information
>gi|325293324|ref|YP_004279188.1| 50S ribosomal protein L5 [Agrobacterium sp. H13-3] Length = 184 Back     alignment and organism information
>gi|15889231|ref|NP_354912.1| 50S ribosomal protein L5 [Agrobacterium tumefaciens str. C58] Length = 184 Back     alignment and organism information
>gi|304391465|ref|ZP_07373407.1| 50S ribosomal protein L5 [Ahrensia sp. R2A130] Length = 193 Back     alignment and organism information
>gi|114704496|ref|ZP_01437404.1| 50S ribosomal protein L5 [Fulvimarina pelagi HTCC2506] Length = 187 Back     alignment and organism information
>gi|167645590|ref|YP_001683253.1| 50S ribosomal protein L5 [Caulobacter sp. K31] Length = 185 Back     alignment and organism information
>gi|190891367|ref|YP_001977909.1| 50S ribosomal protein L5 [Rhizobium etli CIAT 652] Length = 185 Back     alignment and organism information
>gi|227821768|ref|YP_002825738.1| 50S ribosomal protein L5 [Sinorhizobium fredii NGR234] Length = 185 Back     alignment and organism information
>gi|86357317|ref|YP_469209.1| 50S ribosomal protein L5 [Rhizobium etli CFN 42] Length = 185 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
PRK00010179 PRK00010, rplE, 50S ribosomal protein L5; Validated 5e-92
CHL00078181 CHL00078, rpl5, ribosomal protein L5 6e-71
KOG0398278 KOG0398, KOG0398, KOG0398, Mitochondrial/chloroplast ri 2e-49
PRK04219177 PRK04219, rpl5p, 50S ribosomal protein L5P; Reviewed 5e-34
PTZ00156172 PTZ00156, PTZ00156, 60S ribosomal protein L11; Provisio 6e-19
KOG0397176 KOG0397, KOG0397, KOG0397, 60S ribosomal protein L11 [T 2e-15
COG0094180 COG0094, RplE, Ribosomal protein L5 [Translation, ribos 4e-72
pfam0067395 pfam00673, Ribosomal_L5_C, ribosomal L5P family C-termi 4e-41
pfam0028156 pfam00281, Ribosomal_L5, Ribosomal protein L5 4e-17
>gnl|CDD|178791 PRK00010, rplE, 50S ribosomal protein L5; Validated Back     alignment and domain information
>gnl|CDD|177017 CHL00078, rpl5, ribosomal protein L5 Back     alignment and domain information
>gnl|CDD|35619 KOG0398, KOG0398, KOG0398, Mitochondrial/chloroplast ribosomal protein L5/L7 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179792 PRK04219, rpl5p, 50S ribosomal protein L5P; Reviewed Back     alignment and domain information
>gnl|CDD|185485 PTZ00156, PTZ00156, 60S ribosomal protein L11; Provisional Back     alignment and domain information
>gnl|CDD|35618 KOG0397, KOG0397, KOG0397, 60S ribosomal protein L11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30443 COG0094, RplE, Ribosomal protein L5 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144317 pfam00673, Ribosomal_L5_C, ribosomal L5P family C-terminus Back     alignment and domain information
>gnl|CDD|109342 pfam00281, Ribosomal_L5, Ribosomal protein L5 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
PRK00010179 rplE 50S ribosomal protein L5; Validated 100.0
CHL00078180 rpl5 ribosomal protein L5 100.0
COG0094180 RplE Ribosomal protein L5 [Translation, ribosomal struc 100.0
KOG0398278 consensus 100.0
PRK04219177 rpl5p 50S ribosomal protein L5P; Reviewed 100.0
PTZ00156172 60S ribosomal protein L11; Provisional 100.0
KOG0397176 consensus 99.9
pfam0067395 Ribosomal_L5_C ribosomal L5P family C-terminus. This re 100.0
pfam0028156 Ribosomal_L5 Ribosomal protein L5. 99.74
>PRK00010 rplE 50S ribosomal protein L5; Validated Back     alignment and domain information
>CHL00078 rpl5 ribosomal protein L5 Back     alignment and domain information
>COG0094 RplE Ribosomal protein L5 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0398 consensus Back     alignment and domain information
>PRK04219 rpl5p 50S ribosomal protein L5P; Reviewed Back     alignment and domain information
>PTZ00156 60S ribosomal protein L11; Provisional Back     alignment and domain information
>KOG0397 consensus Back     alignment and domain information
>pfam00673 Ribosomal_L5_C ribosomal L5P family C-terminus Back     alignment and domain information
>pfam00281 Ribosomal_L5 Ribosomal protein L5 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
1iq4_A179 5s-Rrna Binding Ribosomal Protein L5 From Bacillus 1e-68
3mrz_F181 Recognition Of The Amber Stop Codon By Release Fact 2e-64
3fin_G181 T. Thermophilus 70s Ribosome In Complex With Mrna, 2e-64
1vsa_E182 Crystal Structure Of A 70s Ribosome-Trna Complex Re 4e-64
2j01_G182 Structure Of The Thermus Thermophilus 70s Ribosome 4e-64
1pnu_D178 Crystal Structure Of A Streptomycin Dependent Ribos 3e-63
1nkw_D180 Crystal Structure Of The Large Ribosomal Subunit Fr 4e-63
1mji_A182 Detailed Analysis Of Rna-Protein Interactions Withi 6e-63
1p85_D178 Real Space Refined Coordinates Of The 50s Subunit F 6e-63
2gya_D177 Structure Of The 50s Subunit Of A Pre-Translocation 1e-62
1vs6_F179 Crystal Structure Of The Bacterial Ribosome From Es 1e-62
3ofr_F177 Crystal Structure Of The E. Coli Ribosome Bound To 3e-62
3bbo_H220 Homology Model For The Spinach Chloroplast 50s Subu 1e-60
1s72_D177 Refined Crystal Structure Of The Haloarcula Marismo 2e-27
1ffk_D176 Crystal Structure Of The Large Ribosomal Subunit Fr 2e-27
3jyw_J151 Structure Of The 60s Proteins For Eukaryotic Riboso 3e-20
1s1i_J173 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 3e-20
2noq_H165 Structure Of Ribosome-Bound Cricket Paralysis Virus 4e-20
3izs_E174 Localization Of The Large Subunit Ribosomal Protein 4e-20
2zkr_d178 Structure Of A Mammalian Ribosomal 60s Subunit With 7e-19
3izr_E180 Localization Of The Large Subunit Ribosomal Protein 8e-17
>gi|14719574|pdb|1IQ4|A Chain A, 5s-Rrna Binding Ribosomal Protein L5 From Bacillus Stearothermophilus Length = 179 Back     alignment and structure
 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 100/177 (56%), Positives = 139/177 (78%)

Query: 9   RLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITG 68
           RLK++Y   +  A+  +F+YK++MQ+PKIEK+V+NMGVG+++ + K  +SA  +L LI G
Sbjct: 3   RLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIAG 62

Query: 69  QKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSF 128
           Q+PV+TRA++SIAGF+LR GMPIG KVTLRG  MY+FLD+LI++ +PR RDF G++ +SF
Sbjct: 63  QRPVVTRAKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLISVSLPRARDFRGVSKKSF 122

Query: 129 DGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK 185
           DG GN++ GI+E ++FPEI+YDKV+ V GMDI I TT  +D EA+ LL L G PF K
Sbjct: 123 DGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTANTDEEARELLALLGMPFQK 179


>gi|300508634|pdb|3MRZ|F Chain F, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 181 Back     alignment and structure
>gi|224510785|pdb|3FIN|G Chain G, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 181 Back     alignment and structure
gi|149240890|pdb|1VSA|E Chain E, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome Subunit Is In The File 2ow8 Length = 182 Back     alignment and structure
gi|116668238|pdb|2J01|G Chain G, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 182 Back     alignment and structure
>gi|34811557|pdb|1PNU|D Chain D, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 178 Back     alignment and structure
gi|28948923|pdb|1NKW|D Chain D, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 180 Back     alignment and structure
>gi|28373675|pdb|1MJI|A Chain A, Detailed Analysis Of Rna-Protein Interactions Within The Bacterial Ribosomal Protein L55S RRNA COMPLEX Length = 182 Back     alignment and structure
>gi|33357905|pdb|1P85|D Chain D, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 178 Back     alignment and structure
>gi|116667438|pdb|2GYA|D Chain D, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 177 Back     alignment and structure
gi|116666576|pdb|1VS6|F Chain F, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 179 Back     alignment and structure
>gi|308388043|pdb|3OFR|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To Erythromycin. This File Contains The 50s Subunit Of The First 70s Ribosome With Erthromycin Bound. Length = 177 Back     alignment and structure
gi|189096130|pdb|3BBO|H Chain H, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 220 Back     alignment and structure
gi|50513473|pdb|1S72|D Chain D, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 177 Back     alignment and structure
>gi|10120923|pdb|1FFK|D Chain D, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 176 Back     alignment and structure
>gi|281500840|pdb|3JYW|J Chain J, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 151 Back     alignment and structure
>gi|49258848|pdb|1S1I|J Chain J, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 173 Back     alignment and structure
>gi|119390530|pdb|2NOQ|H Chain H, Structure Of Ribosome-Bound Cricket Paralysis Virus Ires Rna Length = 165 Back     alignment and structure
>gi|315113304|pdb|3IZS|E Chain E, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 174 Back     alignment and structure
gi|187609302|pdb|2ZKR|DD Chain d, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 178 Back     alignment and structure
>gi|315113251|pdb|3IZR|E Chain E, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 180 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
1iq4_A179 50S ribosomal protein L5; rRNA-binding, RNP motif, RNA 6e-67
1mji_A182 50S ribosomal protein L5; ribosomal protein - 5S rRNA c 1e-66
3ofq_F178 50S ribosomal protein L5; protein biosynthesis, ribosom 1e-65
3bbo_H220 Ribosomal protein L5; large ribosomal subunit, spinach 2e-58
3i1n_F179 50S ribosomal protein L5; ribosome structure, protein-R 3e-54
1vq8_D177 50S ribosomal protein L5P; ribosome 50S, protein-protei 1e-44
2noq_H165 60S ribosomal protein L11-B; IRES RNA, ribosome, transl 6e-41
>1iq4_A 50S ribosomal protein L5; rRNA-binding, RNP motif, RNA binding protein; 1.80A {Geobacillus stearothermophilus} SCOP: d.77.1.1 Length = 179 Back     alignment and structure
 Score =  248 bits (634), Expect = 6e-67
 Identities = 100/178 (56%), Positives = 139/178 (78%)

Query: 8   PRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALIT 67
            RLK++Y   +  A+  +F+YK++MQ+PKIEK+V+NMGVG+++ + K  +SA  +L LI 
Sbjct: 2   NRLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIA 61

Query: 68  GQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRS 127
           GQ+PV+TRA++SIAGF+LR GMPIG KVTLRG  MY+FLD+LI++ +PR RDF G++ +S
Sbjct: 62  GQRPVVTRAKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLISVSLPRARDFRGVSKKS 121

Query: 128 FDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK 185
           FDG GN++ GI+E ++FPEI+YDKV+ V GMDI I TT  +D EA+ LL L G PF K
Sbjct: 122 FDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTANTDEEARELLALLGMPFQK 179


>1mji_A 50S ribosomal protein L5; ribosomal protein - 5S rRNA complex, ribosome; 2.50A {Thermus thermophilus} SCOP: d.77.1.1 PDB: 2hgj_G 2hgq_G 2hgu_G 2j01_G 2j03_G 2jl6_G 2jl8_G 2v47_G 2v49_G 2wdi_G 2wdj_G 2wdl_G 2wdn_G 2wh2_G 2wh4_G 2wrj_G 2wrl_G 2wro_G 2wrr_G 3hux_G ... Length = 182 Back     alignment and structure
>3ofq_F 50S ribosomal protein L5; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_D 1p86_D 2awb_F 2aw4_F 2i2v_F 2j28_F 2i2t_F* 2qao_F* 2qba_F* 2qbc_F* 2qbe_F 2qbg_F 2qbi_F* 2qbk_F* 2qov_F 2qox_F 2qoz_F* 2qp1_F* 2rdo_F 2vhm_F ... Length = 178 Back     alignment and structure
>3bbo_H Ribosomal protein L5; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.2 Length = 220 Back     alignment and structure
>3i1n_F 50S ribosomal protein L5; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_F 1vs6_F 3i1p_F 3i1r_F 3i1t_F 3i20_F 3i22_F 2qam_F* 1p85_D 1p86_D 2awb_F 2aw4_F 2i2v_F 2j28_F 2i2t_F* 2qao_F* 2qba_F* 2qbc_F* 2qbe_F 2qbg_F ... Length = 179 Back     alignment and structure
>1vq8_D 50S ribosomal protein L5P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.77.1.1 PDB: 1vq4_D* 1vq5_D* 1vq6_D* 1vq7_D* 1s72_D* 1vq9_D* 1vqk_D* 1vql_D* 1vqm_D* 1vqn_D* 1vqo_D* 1vqp_D* 1yhq_D* 1yi2_D* 1yij_D* 1yit_D* 1yj9_D* 1yjn_D* 1yjw_D* 2otj_D* ... Length = 177 Back     alignment and structure
>2noq_H 60S ribosomal protein L11-B; IRES RNA, ribosome, translation, internal initiation; 7.30A {Saccharomyces cerevisiae} PDB: 1s1i_J 2zkr_d Length = 165 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
1mji_A182 50S ribosomal protein L5; ribosomal protein - 5S rRNA c 100.0
3bbo_H220 Ribosomal protein L5; large ribosomal subunit, spinach 100.0
1iq4_A179 50S ribosomal protein L5; rRNA-binding, RNP motif, RNA 100.0
3ofq_F178 50S ribosomal protein L5; protein biosynthesis, ribosom 100.0
1vq8_D177 50S ribosomal protein L5P; ribosome 50S, protein-protei 100.0
2noq_H165 60S ribosomal protein L11-B; IRES RNA, ribosome, transl 100.0
>1mji_A 50S ribosomal protein L5; ribosomal protein - 5S rRNA complex, ribosome; 2.50A {Thermus thermophilus} SCOP: d.77.1.1 PDB: 2hgj_G 2hgq_G 2hgu_G 2j01_G 2j03_G 2jl6_G 2jl8_G 2v47_G 2v49_G 2wdi_G 2wdj_G 2wdl_G 2wdn_G 2wh2_G 2wh4_G 2wrj_G 2wrl_G 2wro_G 2wrr_G 2x9s_G ... Back     alignment and structure
Probab=100.00  E-value=0  Score=477.20  Aligned_cols=182  Identities=53%  Similarity=0.957  Sum_probs=179.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             87561189999999999999982699822286044999974578756537899999998776538961354123764211
Q gi|254780249|r    4 CKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGF   83 (185)
Q Consensus         4 ~~~~pRLk~~Y~~~i~~dL~~k~~~~N~~~vPki~KIvin~gvg~a~~dkk~l~~~~~~L~~ITGqkP~~~~aKksi~~f   83 (185)
                      +.+.+|||+||+++|++||+++|+|+|+||+|+|+||+||+|+|+++.|++.++.+..+|+.||||+|++++||+||++|
T Consensus         1 ~~~~~rLk~~Y~~~i~~~L~~k~~y~N~m~vPkl~KIvvn~gvg~a~~d~k~l~~~~~~l~~ItGQkp~~tkakksia~F   80 (182)
T 1mji_A            1 MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNF   80 (182)
T ss_dssp             --CCCHHHHHHHHTHHHHHHHHSCCSSGGGSCCEEEEEEEEECTTTCCCHHHHHHHHHHHHHHHTSCCEEEECCSCCCCS
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCHHHCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
T ss_conf             99566899999999889999985899962167565899977898112166899999999998638744788625662111


Q ss_pred             CCCCCCEEEEEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCEECCCCCCCCCCCCCCCEEEEE
Q ss_conf             15589862889996034289999999998767752046887110157773143301110068754014688554359998
Q gi|254780249|r   84 KLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISIC  163 (185)
Q Consensus        84 kiRkG~piG~kvTLRg~~my~FL~kli~~vlPrikdf~g~~~~~~d~~Gn~sfGi~e~~~FPEi~yd~~~~~~G~~Iti~  163 (185)
                      |+|+|+|+||+|||||++||+||+||+++||||+|||+|++.++||++|||+||++||++||||+||.+++++|||||||
T Consensus        81 klRkg~piG~kvTLRg~~my~FL~kli~i~lpri~df~g~~~~sfd~~gn~s~Gi~e~~~FPEi~yd~~~~i~G~~Itiv  160 (182)
T 1mji_A           81 KLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVV  160 (182)
T ss_dssp             SSSCCSEEEEEEEECHHHHHHHHHHHHHTTTTTCSSCCCBCTTCBCSSSEEEEEECSCEECSSCEECCTTTSCCEEEEEE
T ss_pred             CCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEECCCCEEEECHHHHEECCCCCCCCCCCCCCCEEEEE
T ss_conf             31379820699983788999999999997720201011355300216864654212620477624366689776159999


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             0448968999999980898689
Q gi|254780249|r  164 TTTRSDREAKYLLTLFGFPFPK  185 (185)
Q Consensus       164 Tta~~~~ea~~Lls~~g~Pf~k  185 (185)
                      |||++++||++|||+|||||+|
T Consensus       161 Tsa~t~~ea~~Lls~~g~Pf~k  182 (182)
T 1mji_A          161 TTAETDEEARALLELLGFPFRK  182 (182)
T ss_dssp             ESCSSHHHHHHHHHHHTCCBCC
T ss_pred             ECCCCHHHHHHHHHHCCCCCCC
T ss_conf             4769989999999985997249



>3bbo_H Ribosomal protein L5; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.2 Back     alignment and structure
>1iq4_A 50S ribosomal protein L5; rRNA-binding, RNP motif, RNA binding protein; 1.80A {Geobacillus stearothermophilus} SCOP: d.77.1.1 Back     alignment and structure
>3ofq_F 50S ribosomal protein L5; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_D 1p86_D 2awb_F 2aw4_F 2i2v_F 2j28_F 2i2t_F* 2qao_F* 2qba_F* 2qbc_F* 2qbe_F 2qbg_F 2qbi_F* 2qbk_F* 2qov_F 2qox_F 2qoz_F* 2qp1_F* 2rdo_F 2vhm_F ... Back     alignment and structure
>1vq8_D 50S ribosomal protein L5P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.77.1.1 PDB: 1vq4_D* 1vq5_D* 1vq6_D* 1vq7_D* 1s72_D* 1vq9_D* 1vqk_D* 1vql_D* 1vqm_D* 1vqn_D* 1vqo_D* 1vqp_D* 1yhq_D* 1yi2_D* 1yij_D* 1yit_D* 1yj9_D* 1yjn_D* 1yjw_D* 2otj_D* ... Back     alignment and structure
>2noq_H 60S ribosomal protein L11-B; IRES RNA, ribosome, translation, internal initiation; 7.30A {Saccharomyces cerevisiae} PDB: 1s1i_J 3jyw_J 2zkr_d Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
d1mjia_180 d.77.1.1 (A:) Ribosomal protein L5 {Thermus thermophilu 2e-57
d1iq4a_179 d.77.1.1 (A:) Ribosomal protein L5 {Bacillus stearother 3e-55
d2zjrd1177 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus ra 2e-54
d2gycd1177 d.77.1.1 (D:2-178) Ribosomal protein L5 {Escherichia co 2e-53
d1vqod1165 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Halo 5e-42
>d1mjia_ d.77.1.1 (A:) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: RL5-like
superfamily: RL5-like
family: Ribosomal protein L5
domain: Ribosomal protein L5
species: Thermus thermophilus [TaxId: 274]
 Score =  215 bits (549), Expect = 2e-57
 Identities = 96/179 (53%), Positives = 134/179 (74%)

Query: 7   EPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALI 66
           +  LK++Y   +R  + + F Y+NV ++P++EKVV+N G+GE+  D++  E AA +LALI
Sbjct: 2   DVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALI 61

Query: 67  TGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSR 126
           TGQKP +TRA++SI+ FKLR GMPIG +VTLR   M+ FL++L+N+ +PRIRDF GLN  
Sbjct: 62  TGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPN 121

Query: 127 SFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK 185
           SFDG GN++ G+RE ++FPEI YD VD + GMDI++ TT  +D EA+ LL L GFPF K
Sbjct: 122 SFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK 180


>d1iq4a_ d.77.1.1 (A:) Ribosomal protein L5 {Bacillus stearothermophilus [TaxId: 1422]} Length = 179 Back     information, alignment and structure
>d2zjrd1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]} Length = 177 Back     information, alignment and structure
>d2gycd1 d.77.1.1 (D:2-178) Ribosomal protein L5 {Escherichia coli [TaxId: 562]} Length = 177 Back     information, alignment and structure
>d1vqod1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 165 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
d1mjia_180 Ribosomal protein L5 {Thermus thermophilus [TaxId: 274] 100.0
d1iq4a_179 Ribosomal protein L5 {Bacillus stearothermophilus [TaxI 100.0
d2zjrd1177 Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1 100.0
d2gycd1177 Ribosomal protein L5 {Escherichia coli [TaxId: 562]} 100.0
d1vqod1165 Ribosomal protein L5 {Archaeon Haloarcula marismortui [ 100.0
>d1mjia_ d.77.1.1 (A:) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: RL5-like
superfamily: RL5-like
family: Ribosomal protein L5
domain: Ribosomal protein L5
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=476.25  Aligned_cols=180  Identities=53%  Similarity=0.970  Sum_probs=177.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             56118999999999999998269982228604499997457875653789999999877653896135412376421115
Q gi|254780249|r    6 YEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKL   85 (185)
Q Consensus         6 ~~pRLk~~Y~~~i~~dL~~k~~~~N~~~vPki~KIvin~gvg~a~~dkk~l~~~~~~L~~ITGqkP~~~~aKksi~~fki   85 (185)
                      +..|||++|+++|+++|+++++|+|+||+|+|+|||||+|+|+|+.|++.++.+..+|+.||||+|++++||+||++||+
T Consensus         1 ~~~rLk~~Y~~~i~~~L~~k~~~~N~m~vPkl~KIvvn~gvg~a~~d~k~l~~~~~~L~~ItGQkp~~t~akksia~Fkl   80 (180)
T d1mjia_           1 LDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKL   80 (180)
T ss_dssp             CCCHHHHHHHHTHHHHHHHHSCCSSGGGSCCEEEEEEEEECTTTCCCHHHHHHHHHHHHHHHTSCCEEEECCSCCCCSSS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEE
T ss_conf             97378999999999999998489983005635699997888820016578999999887531513799862665665043


Q ss_pred             CCCCEEEEEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCEECCCCCCCCCCCCCCCEEEEECC
Q ss_conf             58986288999603428999999999876775204688711015777314330111006875401468855435999804
Q gi|254780249|r   86 RTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTT  165 (185)
Q Consensus        86 RkG~piG~kvTLRg~~my~FL~kli~~vlPrikdf~g~~~~~~d~~Gn~sfGi~e~~~FPEi~yd~~~~~~G~~Iti~Tt  165 (185)
                      |+|+|+||+|||||++||+||+||+++||||||||+|++.++||+.|||+||++||++|||++||++++++|||||||||
T Consensus        81 Rkg~piG~kvTLRg~~m~~FL~rli~i~lprirdf~g~~~~sfd~~Gn~sfGi~e~~~FPEi~~d~~~~i~G~~ItivTt  160 (180)
T d1mjia_          81 RKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTT  160 (180)
T ss_dssp             SCCSEEEEEEEECHHHHHHHHHHHHHTTTTTCSSCCCBCTTCBCSSSEEEEEECSCEECSSCEECCTTTSCCEEEEEEES
T ss_pred             ECCCCEEEEEEECHHHHHHHHHHHHHHHHHHEECCCCCCCCCCCCCEEEEECCHHEEECCCCCCCCCCCCCCCEEEEEEC
T ss_conf             04982258986317779999999999775320024667820036751687433230333544435446847626999947


Q ss_pred             CCCHHHHHHHHHHHCCCCCC
Q ss_conf             48968999999980898689
Q gi|254780249|r  166 TRSDREAKYLLTLFGFPFPK  185 (185)
Q Consensus       166 a~~~~ea~~Lls~~g~Pf~k  185 (185)
                      |++++||++|||+|||||+|
T Consensus       161 a~~~~ea~~Lls~~g~Pf~~  180 (180)
T d1mjia_         161 AETDEEARALLELLGFPFRK  180 (180)
T ss_dssp             CSSHHHHHHHHHHHTCCBCC
T ss_pred             CCCHHHHHHHHHHCCCCCCC
T ss_conf             69979999999986998459



>d1iq4a_ d.77.1.1 (A:) Ribosomal protein L5 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2zjrd1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2gycd1 d.77.1.1 (D:2-178) Ribosomal protein L5 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqod1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 185 50S ribosomal protein L5 [Candidatus Liberibacter
1iq4_A_179 (A:) 50S ribosomal protein L5; rRNA-binding, RNP m 1e-63
3bbo_H_220 (H:) Ribosomal protein L5; large ribosomal subunit 1e-62
3i1n_F_179 (F:) 50S ribosomal protein L5; ribosome structure, 4e-62
1mji_A_182 (A:) 50S ribosomal protein L5; ribosomal protein - 9e-62
1vq8_D_177 (D:) 50S ribosomal protein L5P; ribosome 50S, prot 1e-52
2noq_H_165 (H:) 60S ribosomal protein L11-B; IRES RNA, riboso 1e-49
>1iq4_A (A:) 50S ribosomal protein L5; rRNA-binding, RNP motif, RNA binding protein; 1.80A {Geobacillus stearothermophilus}Length = 179 Back     alignment and structure
 Score =  236 bits (604), Expect = 1e-63
 Identities = 100/178 (56%), Positives = 139/178 (78%)

Query: 8   PRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALIT 67
            RLK++Y   +  A+  +F+YK++MQ+PKIEK+V+NMGVG+++ + K  +SA  +L LI 
Sbjct: 2   NRLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIA 61

Query: 68  GQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRS 127
           GQ+PV+TRA++SIAGF+LR GMPIG KVTLRG  MY+FLD+LI++ +PR RDF G++ +S
Sbjct: 62  GQRPVVTRAKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLISVSLPRARDFRGVSKKS 121

Query: 128 FDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFGFPFPK 185
           FDG GN++ GI+E ++FPEI+YDKV+ V GMDI I TT  +D EA+ LL L G PF K
Sbjct: 122 FDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTANTDEEARELLALLGMPFQK 179


>3bbo_H (H:) Ribosomal protein L5; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 220 Back     alignment and structure
>3i1n_F (F:) 50S ribosomal protein L5; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_F 1vs6_F 3i1p_F 3i1r_F 3i1t_F 3i20_F 3i22_F 2qam_F* 1p85_D 1p86_D 2awb_F 2aw4_F 2i2v_F 2j28_F 2i2t_F* 2qao_F* 2qba_F* 2qbc_F* 2qbe_F 2qbg_F ...Length = 179 Back     alignment and structure
>1mji_A (A:) 50S ribosomal protein L5; ribosomal protein - 5S rRNA complex, ribosome; 2.50A {Thermus thermophilus}Length = 182 Back     alignment and structure
>1vq8_D (D:) 50S ribosomal protein L5P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 177 Back     alignment and structure
>2noq_H (H:) 60S ribosomal protein L11-B; IRES RNA, ribosome, translation, internal initiation; 7.30A {Saccharomyces cerevisiae} PDB: 1s1i_J 2zkr_dLength = 165 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target185 50S ribosomal protein L5 [Candidatus Liberibacter asiat
1mji_A_182 50S ribosomal protein L5; ribosomal protein - 5S r 100.0
1iq4_A_179 50S ribosomal protein L5; rRNA-binding, RNP motif, 100.0
3i1n_F_179 50S ribosomal protein L5; ribosome structure, prot 100.0
3bbo_H_220 Ribosomal protein L5; large ribosomal subunit, spi 100.0
1vq8_D_177 50S ribosomal protein L5P; ribosome 50S, protein-p 100.0
2noq_H_165 60S ribosomal protein L11-B; IRES RNA, ribosome, t 100.0
>1mji_A (A:) 50S ribosomal protein L5; ribosomal protein - 5S rRNA complex, ribosome; 2.50A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=0  Score=460.34  Aligned_cols=182  Identities=52%  Similarity=0.941  Sum_probs=180.3

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             87561189999999999999982699822286044999974578756537899999998776538961354123764211
Q gi|254780249|r    4 CKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAAADLALITGQKPVITRARRSIAGF   83 (185)
Q Consensus         4 ~~~~pRLk~~Y~~~i~~dL~~k~~~~N~~~vPki~KIvin~gvg~a~~dkk~l~~~~~~L~~ITGqkP~~~~aKksi~~f   83 (185)
                      +.|+|||+.||+++|++||+++++|+|+|++|+|+||+||+|+|+++.|++.++.+..+|+.||||+|++++||+||++|
T Consensus         1 m~~m~~l~~~Y~~~v~~dL~~k~~~~N~~~~Pki~KIvi~~g~g~~~~d~k~l~~~~~~L~~ItGQkp~~t~aKksi~~F   80 (182)
T 1mji_A            1 MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNF   80 (182)
T ss_dssp             --CCCHHHHHHHHTHHHHHHHHSCCSSGGGSCCEEEEEEEEECTTTCCCHHHHHHHHHHHHHHHTSCCEEEECCSCCCCS
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCHHHCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             99566899999999989999985899940056566999978888200066899999998987538735787615555552


Q ss_pred             CCCCCCEEEEEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCEECCCCCCCCCCCCCCCEEEEE
Q ss_conf             15589862889996034289999999998767752046887110157773143301110068754014688554359998
Q gi|254780249|r   84 KLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISIC  163 (185)
Q Consensus        84 kiRkG~piG~kvTLRg~~my~FL~kli~~vlPrikdf~g~~~~~~d~~Gn~sfGi~e~~~FPEi~yd~~~~~~G~~Iti~  163 (185)
                      |+|||+|+||+|||||++||+||+||+++|+||+|||+|++.++||++|||+||++|+++|||++||++++++||||+|+
T Consensus        81 kirkg~piG~kVTLRg~~my~FL~kli~~vlPrirdf~g~~~~sfd~~gn~sfGi~e~~~FPEi~yd~~~~i~G~~Itiv  160 (182)
T 1mji_A           81 KLRKGMPIGLRVTLRRDRXWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGXDIAVV  160 (182)
T ss_dssp             SSSCCSEEEEEEEECHHHHHHHHHHHHHTTTTTCSSCCCBCTTCBCSSSEEEEEECSCEECSSCEECCTTTSCCEEEEEE
T ss_pred             EECCCCCEEEEEEECHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECHHHEEECCCCCCCCCCCCCCCEEEEE
T ss_conf             01179801699994588999999999997630111002355301147714753522504677613266689786269999


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             0448968999999980898689
Q gi|254780249|r  164 TTTRSDREAKYLLTLFGFPFPK  185 (185)
Q Consensus       164 Tta~~~~ea~~Lls~~g~Pf~k  185 (185)
                      |+|++++|++.||+++||||+|
T Consensus       161 t~a~~~~~~~~ll~~~~~Pf~k  182 (182)
T 1mji_A          161 TTAETDEEARALLELLGFPFRK  182 (182)
T ss_dssp             ESCSSHHHHHHHHHHHTCCBCC
T ss_pred             ECCCCHHHHHHHHHHCCCCCCC
T ss_conf             3769979999999985997459



>1iq4_A (A:) 50S ribosomal protein L5; rRNA-binding, RNP motif, RNA binding protein; 1.80A {Geobacillus stearothermophilus} Back     alignment and structure
>3i1n_F (F:) 50S ribosomal protein L5; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_F 1vs6_F 3i1p_F 3i1r_F 3i1t_F 3i20_F 3i22_F 2qam_F* 1p85_D 1p86_D 2awb_F 2aw4_F 2i2v_F 2j28_F 2i2t_F* 2qao_F* 2qba_F* 2qbc_F* 2qbe_F 2qbg_F ... Back     alignment and structure
>3bbo_H (H:) Ribosomal protein L5; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1vq8_D (D:) 50S ribosomal protein L5P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>2noq_H (H:) 60S ribosomal protein L11-B; IRES RNA, ribosome, translation, internal initiation; 7.30A {Saccharomyces cerevisiae} PDB: 1s1i_J 2zkr_d Back     alignment and structure