254780252

254780252

30S ribosomal protein S17

GeneID in NCBI database:8209233Locus tag:CLIBASIA_00685
Protein GI in NCBI database:254780252Protein Accession:YP_003064665.1
Gene range:-(138268, 138507)Protein Length:79aa
Gene description:30S ribosomal protein S17
COG prediction:[J] Ribosomal protein S17
KEGG prediction:rpsQ; 30S ribosomal protein S17; K02961 small subunit ribosomal protein S17
SEED prediction:SSU ribosomal protein S17p (S11e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------8
MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEGV
cccEEEEEEEEEcccccEEEEEEccEEEcccccEEEEccccEEEcccHHccccccEEEEEEcccccccEEEEEEEEEcc
ccccEEEEEEEccccccEEEEEEEEccccccccEEEEEEEEEEEcccccccccccEEEEEEEcccccccEEEEEEEEcc
mpkrvlqgmvvsdksEKTIIVLVERrfshprfqktirrskryavhdennkykvgdfvsieesapiskkkswlvidsegv
mpkrvlqgmvvsdksektiivlverrfshprfqktirrskryavhdennkykvgdfvsieesapiskkkswlvidsegv
MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEGV
*PKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEG*
********MVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEGV
**KRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEGV
MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEGV
MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEGV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target79 30S ribosomal protein S17 [Candidatus Liberibacter asia
31512280979 30S ribosomal protein S17 [Candidatus Liberibacter sola 1 1e-28
22208568479 30S ribosomal protein S17 [Agrobacterium radiobacter K8 1 2e-26
1798704980 30S ribosomal protein S17 [Brucella melitensis bv. 1 st 1 2e-26
20954894479 30S ribosomal protein S17 [Rhizobium leguminosarum bv. 1 2e-26
11625154979 30S ribosomal protein S17 [Rhizobium leguminosarum bv. 1 2e-26
19089136479 30S ribosomal protein S17 [Rhizobium etli CIAT 652] Len 1 2e-26
32529332778 30S ribosomal protein S17 [Agrobacterium sp. H13-3] Len 1 3e-26
16384349080 30S ribosomal protein S17 [Brucella suis ATCC 23445] Le 1 3e-26
8635731479 30S ribosomal protein S17 [Rhizobium etli CFN 42] Lengt 1 3e-26
23983211380 30S ribosomal protein S17 [Ochrobactrum intermedium LMG 1 4e-26
>gi|315122809|ref|YP_004063298.1| 30S ribosomal protein S17 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 79 Back     alignment and organism information
 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%)

Query: 1  MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE 60
          MPKRVLQG+VVSDKSEKTIIVLVERRFSHP FQKTIRRSK+YAVHD+NN++K+GD VSIE
Sbjct: 1  MPKRVLQGVVVSDKSEKTIIVLVERRFSHPLFQKTIRRSKKYAVHDKNNRFKIGDHVSIE 60

Query: 61 ESAPISKKKSWLVIDSEG 78
          E  P+SK+KSW V+ +E 
Sbjct: 61 ECPPVSKRKSWSVVYTES 78


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085684|ref|YP_002544214.1| 30S ribosomal protein S17 [Agrobacterium radiobacter K84] Length = 79 Back     alignment and organism information
>gi|17987049|ref|NP_539683.1| 30S ribosomal protein S17 [Brucella melitensis bv. 1 str. 16M] Length = 80 Back     alignment and organism information
>gi|209548944|ref|YP_002280861.1| 30S ribosomal protein S17 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 79 Back     alignment and organism information
>gi|116251549|ref|YP_767387.1| 30S ribosomal protein S17 [Rhizobium leguminosarum bv. viciae 3841] Length = 79 Back     alignment and organism information
>gi|190891364|ref|YP_001977906.1| 30S ribosomal protein S17 [Rhizobium etli CIAT 652] Length = 79 Back     alignment and organism information
>gi|325293327|ref|YP_004279191.1| 30S ribosomal protein S17 [Agrobacterium sp. H13-3] Length = 78 Back     alignment and organism information
>gi|163843490|ref|YP_001627894.1| 30S ribosomal protein S17 [Brucella suis ATCC 23445] Length = 80 Back     alignment and organism information
>gi|86357314|ref|YP_469206.1| 30S ribosomal protein S17 [Rhizobium etli CFN 42] Length = 79 Back     alignment and organism information
>gi|239832113|ref|ZP_04680442.1| 30S ribosomal protein S17 [Ochrobactrum intermedium LMG 3301] Length = 80 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target79 30S ribosomal protein S17 [Candidatus Liberibacter asia
PRK0561084 PRK05610, rpsQ, 30S ribosomal protein S17; Reviewed 2e-26
TIGR0363571 TIGR03635, S17_bact, 30S ribosomal protein S17 2e-24
CHL0014284 CHL00142, rps17, ribosomal protein S17; Validated 1e-18
pfam0036669 pfam00366, Ribosomal_S17, Ribosomal protein S17 1e-16
KOG1740107 KOG1740, KOG1740, KOG1740, Predicted mitochondrial/chlo 2e-11
PRK08572108 PRK08572, rps17p, 30S ribosomal protein S17P; Reviewed 6e-09
TIGR03630102 TIGR03630, arch_S17P, archaeal ribosomal protein S17P 3e-08
KOG1728156 KOG1728, KOG1728, KOG1728, 40S ribosomal protein S11 [T 7e-04
COG018687 COG0186, RpsQ, Ribosomal protein S17 [Translation, ribo 7e-19
>gnl|CDD|180162 PRK05610, rpsQ, 30S ribosomal protein S17; Reviewed Back     alignment and domain information
>gnl|CDD|163368 TIGR03635, S17_bact, 30S ribosomal protein S17 Back     alignment and domain information
>gnl|CDD|177064 CHL00142, rps17, ribosomal protein S17; Validated Back     alignment and domain information
>gnl|CDD|109426 pfam00366, Ribosomal_S17, Ribosomal protein S17 Back     alignment and domain information
>gnl|CDD|36951 KOG1740, KOG1740, KOG1740, Predicted mitochondrial/chloroplast ribosomal protein S17 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181479 PRK08572, rps17p, 30S ribosomal protein S17P; Reviewed Back     alignment and domain information
>gnl|CDD|132669 TIGR03630, arch_S17P, archaeal ribosomal protein S17P Back     alignment and domain information
>gnl|CDD|36939 KOG1728, KOG1728, KOG1728, 40S ribosomal protein S11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30535 COG0186, RpsQ, Ribosomal protein S17 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 79 30S ribosomal protein S17 [Candidatus Liberibacter asia
CHL0014284 rps17 ribosomal protein S17; Validated 100.0
COG018687 RpsQ Ribosomal protein S17 [Translation, ribosomal stru 100.0
PRK0561084 rpsQ 30S ribosomal protein S17; Reviewed 99.98
PRK08572108 rps17p 30S ribosomal protein S17P; Reviewed 99.97
TIGR03630102 arch_S17P archaeal ribosomal protein S17P. This model d 99.97
TIGR0363571 S17_bact 30S ribosomal protein S17. This model describe 99.97
pfam0036669 Ribosomal_S17 Ribosomal protein S17. 99.96
KOG1740107 consensus 99.92
PTZ00241158 40S ribosomal protein S11; Provisional 99.91
KOG1728156 consensus 99.85
KOG3447150 consensus 99.25
>CHL00142 rps17 ribosomal protein S17; Validated Back     alignment and domain information
>COG0186 RpsQ Ribosomal protein S17 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05610 rpsQ 30S ribosomal protein S17; Reviewed Back     alignment and domain information
>PRK08572 rps17p 30S ribosomal protein S17P; Reviewed Back     alignment and domain information
>TIGR03630 arch_S17P archaeal ribosomal protein S17P Back     alignment and domain information
>TIGR03635 S17_bact 30S ribosomal protein S17 Back     alignment and domain information
>pfam00366 Ribosomal_S17 Ribosomal protein S17 Back     alignment and domain information
>KOG1740 consensus Back     alignment and domain information
>PTZ00241 40S ribosomal protein S11; Provisional Back     alignment and domain information
>KOG1728 consensus Back     alignment and domain information
>KOG3447 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target79 30S ribosomal protein S17 [Candidatus Liberibacter asia
1fjg_Q105 Structure Of The Thermus Thermophilus 30s Ribosomal 4e-25
2j00_Q105 Structure Of The Thermus Thermophilus 70s Ribosome 5e-25
1j5e_Q104 Structure Of The Thermus Thermophilus 30s Ribosomal 4e-24
1i94_Q104 Crystal Structures Of The Small Ribosomal Subunit W 4e-24
2gy9_Q79 Structure Of The 30s Subunit Of A Pre-Translocation 6e-24
3mr8_Q99 Recognition Of The Amber Stop Codon By Release Fact 8e-24
1p6g_Q83 Real Space Refined Coordinates Of The 30s Subunit F 1e-23
1vs5_Q84 Crystal Structure Of The Bacterial Ribosome From Es 1e-23
3fic_Q100 T. Thermophilus 70s Ribosome In Complex With Mrna, 1e-23
3fih_Q80 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 3e-23
1eg0_G93 Fitting Of Components With Known Structure Into An 5e-21
1rip_A81 Ribosomal Protein S17: Characterization Of The Thre 1e-20
1qd7_I89 Partial Model For 30s Ribosomal Subunit Length = 89 1e-20
3bbn_Q142 Homology Model For The Spinach Chloroplast 30s Subu 1e-17
3izb_P156 Localization Of The Small Subunit Ribosomal Protein 2e-16
2zkq_q158 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-16
3iz6_P161 Localization Of The Small Subunit Ribosomal Protein 8e-15
3jyv_Q80 Structure Of The 40s Rrna And Proteins And PE TRNA 1e-14
1s1h_Q76 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 6e-14
2xzm_Q157 Crystal Structure Of The Eukaryotic 40s Ribosomal S 4e-13
gi|10835601|pdb|1FJG|Q Chain Q, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 105 Back     alignment and structure
 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (75%)

Query: 1  MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE 60
          MPK+VL G+VVSDK +KT+ VLVER+F HP + K I+RSK+Y  HD   KYK+GD V I 
Sbjct: 1  MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEII 60

Query: 61 ESAPISKKKSWLVI 74
          ES PISK+K + V+
Sbjct: 61 ESRPISKRKRFRVL 74


gi|116668213|pdb|2J00|Q Chain Q, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, A-, P- And E-Site Trnas And Paromomycin For Molecule I. Length = 105 Back     alignment and structure
>gi|20663902|pdb|1J5E|Q Chain Q, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Length = 104 Back     alignment and structure
>gi|14278546|pdb|1I94|Q Chain Q, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 104 Back     alignment and structure
>gi|116667426|pdb|2GY9|Q Chain Q, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 79 Back     alignment and structure
>gi|300508621|pdb|3MR8|Q Chain Q, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mr8 Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 3ms1. Molecule B In The Same Asymmetric Unit Is Deposited As 3mrz (50s) And 3ms0 (30s). Length = 99 Back     alignment and structure
>gi|33357894|pdb|1P6G|Q Chain Q, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 83 Back     alignment and structure
gi|116666564|pdb|1VS5|Q Chain Q, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 84 Back     alignment and structure
>gi|224510694|pdb|3FIC|Q Chain Q, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 100 Back     alignment and structure
>gi|224510718|pdb|3FIH|Q Chain Q, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 80 Back     alignment and structure
>gi|253723092|pdb|1RIP|A Chain A, Ribosomal Protein S17: Characterization Of The Three- Dimensional Structure By 1h-And 15n-Nmr Length = 81 Back     alignment and structure
>gi|6137693|pdb|1QD7|I Chain I, Partial Model For 30s Ribosomal Subunit Length = 89 Back     alignment and structure
>gi|188036218|pdb|3BBN|Q Chain Q, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 142 Back     alignment and structure
gi|313103680|pdb|3IZB|P Chain P, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 156 Back     alignment and structure
gi|187609269|pdb|2ZKQ|QQ Chain q, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 158 Back     alignment and structure
gi|313103641|pdb|3IZ6|P Chain P, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 161 Back     alignment and structure
>gi|281500821|pdb|3JYV|Q Chain Q, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 80 Back     alignment and structure
>gi|49258835|pdb|1S1H|Q Chain Q, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 76 Back     alignment and structure
gi|319443372|pdb|2XZM|Q Chain Q, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 157 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target79 30S ribosomal protein S17 [Candidatus Liberibacter asia
3ofo_Q80 30S ribosomal protein S17; protein biosynthesis, riboso 7e-22
2vqe_Q105 30S ribosomal protein S17; tRNA-binding, rRNA-binding, 1e-21
1qd7_I89 S17 ribosomal protein; 30S ribosomal subunit, low resol 7e-21
3bbn_Q142 Ribosomal protein S17; small ribosomal subunit, spinach 4e-19
3i1m_Q84 30S ribosomal protein S17; ribosome structure, protein- 5e-18
2zkq_q158 40S ribosomal protein S11E; protein-RNA complex, 40S ri 3e-17
>3ofo_Q 30S ribosomal protein S17; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_Q* 3iy8_Q 2wwl_Q 3ofp_Q 3i1m_Q 1vs7_Q* 3e1a_J 3e1c_J 1vs5_Q 3i1o_Q 3i1q_Q 3i1s_Q 3i1z_Q 3i21_Q 3kc4_Q 3or9_Q 3ora_Q 2qal_Q* 1p6g_Q 1p87_Q ... Length = 80 Back     alignment and structure
 Score = 97.3 bits (243), Expect = 7e-22
 Identities = 37/72 (51%), Positives = 49/72 (68%)

Query: 4  RVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESA 63
          R LQG VVSDK EK+I+V +ER   HP + K I+R+ +  VHDENN+  +GD V I E  
Sbjct: 3  RTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIRECR 62

Query: 64 PISKKKSWLVID 75
          P+SK KSW ++ 
Sbjct: 63 PLSKTKSWTLVR 74


>2vqe_Q 30S ribosomal protein S17; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: b.40.4.5 PDB: 1gix_T* 1hnw_Q* 1hnx_Q* 1hnz_Q* 1hr0_Q 1ibk_Q* 1ibl_Q* 1ibm_Q 1jgo_T* 1jgp_T* 1jgq_T* 1ml5_T* 1xmo_Q* 1xmq_Q* 1xnq_Q* 1xnr_Q* 1yl4_T 2b64_Q* 2b9m_Q* 2b9o_Q* ... Length = 105 Back     alignment and structure
>1qd7_I S17 ribosomal protein; 30S ribosomal subunit, low resolution model, ribosome; 5.50A {Thermus thermophilus} SCOP: i.1.1.3 PDB: 1eg0_G 1rip_A Length = 89 Back     alignment and structure
>3bbn_Q Ribosomal protein S17; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} SCOP: i.1.1.1 Length = 142 Back     alignment and structure
>3i1m_Q 30S ribosomal protein S17; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_Q* 3e1a_J 3e1c_J 1vs5_Q 3i1o_Q 3i1q_Q 3i1s_Q 3i1z_Q 3i21_Q 2qal_Q* 1p6g_Q 1p87_Q 2aw7_Q 2avy_Q 2i2u_Q 2i2p_Q* 2qan_Q* 2qb9_Q* 2qbb_Q* 2qbd_Q ... Length = 84 Back     alignment and structure
>2zkq_q 40S ribosomal protein S11E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1h_Q Length = 158 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target79 30S ribosomal protein S17 [Candidatus Liberibacter asia
2vqe_Q105 30S ribosomal protein S17; tRNA-binding, rRNA-binding, 100.0
3bbn_Q142 Ribosomal protein S17; small ribosomal subunit, spinach 99.97
1qd7_I89 S17 ribosomal protein; 30S ribosomal subunit, low resol 99.97
2zkq_q158 40S ribosomal protein S11E; protein-RNA complex, 40S ri 99.96
3ofo_Q80 30S ribosomal protein S17; protein biosynthesis, riboso 99.96
>2vqe_Q 30S ribosomal protein S17; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: b.40.4.5 PDB: 1gix_T* 1hnw_Q* 1hnx_Q* 1hnz_Q* 1hr0_Q 1ibk_Q* 1ibl_Q* 1ibm_Q 1jgo_T* 1jgp_T* 1jgq_T* 1ml5_T* 1xmo_Q* 1xmq_Q* 1xnq_Q* 1xnr_Q* 1yl4_T 2b64_Q* 2b9m_Q* 2b9o_Q* ... Back     alignment and structure
Probab=100.00  E-value=3.6e-33  Score=201.64  Aligned_cols=77  Identities=57%  Similarity=0.896  Sum_probs=76.0

Q ss_pred             CCCEEEEEEEEEECCCCEEEEEEEEEEECCCCCEEECCCEEEEECCCCCCCCCCCEEEEEECCCCCCCEEEEEEEEE
Q ss_conf             97347999999608986199999718878641308735103898688660406878999963775432039999764
Q gi|254780252|r    1 MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSE   77 (79)
Q Consensus         1 m~~k~l~G~Vvs~km~KTv~V~v~r~~~~~ky~K~~~~~kk~~vHD~~~~~~~GD~V~i~e~rPiSK~K~~~vve~~   77 (79)
                      ||+|+|.|+|+|++|+||++|.++|+++||+|+|+++++++|+||||+|+|++||+|+|.|||||||+|+|+|+|+.
T Consensus         1 M~kk~l~G~Vvs~km~KTv~V~V~r~~~h~ky~K~~kr~kk~~aHDe~~~~~~GD~V~I~e~rPlSK~K~~~v~~I~   77 (105)
T 2vqe_Q            1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLV   77 (105)
T ss_dssp             -CCCEEEEEEEEEEETTEEEEEEEEEEECTTTCCEEEEEEEEEEECTTCCCCTTCEEEEEEEEEEETTEEEEEEEEE
T ss_pred             CCCEEEEEEEEEECCCCCEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEEE
T ss_conf             99608999999407997299999999973876779885559999998998999989999988778896879999998



>3bbn_Q Ribosomal protein S17; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} SCOP: i.1.1.1 Back     alignment and structure
>1qd7_I S17 ribosomal protein; 30S ribosomal subunit, low resolution model, ribosome; 5.50A {Thermus thermophilus} SCOP: i.1.1.3 PDB: 1eg0_G 1rip_A Back     alignment and structure
>2zkq_q 40S ribosomal protein S11E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 3jyv_Q* 1s1h_Q Back     alignment and structure
>3ofo_Q 30S ribosomal protein S17; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_Q* 3iy8_Q 2wwl_Q 3ofp_Q 3i1m_Q 1vs7_Q* 3e1a_J 3e1c_J 1vs5_Q 3i1o_Q 3i1q_Q 3i1s_Q 3i1z_Q 3i21_Q 3kc4_Q 3or9_Q 3ora_Q 2qal_Q* 1p6g_Q 1p87_Q ... Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 79 30S ribosomal protein S17 [Candidatus Liberibacter asia
d2uubq1100 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus therm 4e-21
d2gy9q178 b.40.4.5 (Q:5-82) Ribosomal protein S17 {Escherichia co 2e-18
d1ripa_81 b.40.4.5 (A:) Ribosomal protein S17 {Bacillus stearothe 2e-18
>d2uubq1 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} Length = 100 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Ribosomal protein S17
species: Thermus thermophilus [TaxId: 274]
 Score = 93.6 bits (233), Expect = 4e-21
 Identities = 43/74 (58%), Positives = 55/74 (74%)

Query: 2  PKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEE 61
          PK+VL G+VVSDK +KT+ VLVER+F HP + K I+RSK+Y  HD   KYK+GD V I E
Sbjct: 1  PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIE 60

Query: 62 SAPISKKKSWLVID 75
          S PISK+K + V+ 
Sbjct: 61 SRPISKRKRFRVLR 74


>d2gy9q1 b.40.4.5 (Q:5-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1ripa_ b.40.4.5 (A:) Ribosomal protein S17 {Bacillus stearothermophilus [TaxId: 1422]} Length = 81 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target79 30S ribosomal protein S17 [Candidatus Liberibacter asia
d2uubq1100 Ribosomal protein S17 {Thermus thermophilus [TaxId: 274 99.97
d2gy9q178 Ribosomal protein S17 {Escherichia coli [TaxId: 562]} 99.97
d1ripa_81 Ribosomal protein S17 {Bacillus stearothermophilus [Tax 99.95
>d2uubq1 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Ribosomal protein S17
species: Thermus thermophilus [TaxId: 274]
Probab=99.97  E-value=2.8e-32  Score=195.49  Aligned_cols=76  Identities=57%  Similarity=0.889  Sum_probs=74.8

Q ss_pred             CCEEEEEEEEEECCCCEEEEEEEEEEECCCCCEEECCCEEEEECCCCCCCCCCCEEEEEECCCCCCCEEEEEEEEE
Q ss_conf             7347999999608986199999718878641308735103898688660406878999963775432039999764
Q gi|254780252|r    2 PKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSE   77 (79)
Q Consensus         2 ~~k~l~G~Vvs~km~KTv~V~v~r~~~~~ky~K~~~~~kk~~vHD~~~~~~~GD~V~i~e~rPiSK~K~~~vve~~   77 (79)
                      |+|+|.|+|+|++|+|||+|+++|+++||+|+|+++++++|+||||+|+|++||.|.|.|||||||+|+|.|+|+.
T Consensus         1 pkr~l~G~Vvs~km~KTv~V~v~r~~~h~ky~K~~~r~kk~~vHD~~n~~k~GD~V~I~e~rPlSK~K~~~v~~Iv   76 (100)
T d2uubq1           1 PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLV   76 (100)
T ss_dssp             CCCEEEEEECCCCBTTEEEEEEEEEEEETTTEEEEEEEEEEEEECTTCCCCTTCEEEEEEEEEEETTEEEEEEEEE
T ss_pred             CCEEEEEEEEECCCCCCEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEEE
T ss_conf             9818999999747997399999999954656789874079999998888999999999988678883579999998



>d2gy9q1 b.40.4.5 (Q:5-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ripa_ b.40.4.5 (A:) Ribosomal protein S17 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 79 30S ribosomal protein S17 [Candidatus Liberibacter
2vqe_Q_105 (Q:) 30S ribosomal protein S17; tRNA-binding, rRNA 1e-18
3i1m_Q_84 (Q:) 30S ribosomal protein S17; ribosome structure 6e-17
1qd7_I_89 (I:) S17 ribosomal protein; 30S ribosomal subunit, 6e-17
3bbn_Q_142 (Q:) Ribosomal protein S17; small ribosomal subuni 8e-16
2zkq_q_158 (q:) 40S ribosomal protein S11E; protein-RNA compl 1e-15
>2vqe_Q (Q:) 30S ribosomal protein S17; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 105 Back     alignment and structure
 Score = 86.0 bits (213), Expect = 1e-18
 Identities = 44/75 (58%), Positives = 56/75 (74%)

Query: 1  MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE 60
          MPK+VL G+VVSDK +KT+ VLVER+F HP + K I+RSK+Y  HD   KYK+GD V I 
Sbjct: 1  MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEII 60

Query: 61 ESAPISKKKSWLVID 75
          ES PISK+K + V+ 
Sbjct: 61 ESRPISKRKRFRVLR 75


>3i1m_Q (Q:) 30S ribosomal protein S17; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_Q* 3e1a_J 3e1c_J 1vs5_Q 3i1o_Q 3i1q_Q 3i1s_Q 3i1z_Q 3i21_Q 2qal_Q* 1p6g_Q 1p87_Q 2aw7_Q 2avy_Q 2i2u_Q 2i2p_Q* 2qan_Q* 2qb9_Q* 2qbb_Q* 2qbd_Q ...Length = 84 Back     alignment and structure
>1qd7_I (I:) S17 ribosomal protein; 30S ribosomal subunit, low resolution model, ribosome; 5.50A {Thermus thermophilus}Length = 89 Back     alignment and structure
>3bbn_Q (Q:) Ribosomal protein S17; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana}Length = 142 Back     alignment and structure
>2zkq_q (q:) 40S ribosomal protein S11E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1h_QLength = 158 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target79 30S ribosomal protein S17 [Candidatus Liberibacter asia
2vqe_Q_105 30S ribosomal protein S17; tRNA-binding, rRNA-bind 99.97
1qd7_I_89 S17 ribosomal protein; 30S ribosomal subunit, low 99.97
2zkq_q_158 40S ribosomal protein S11E; protein-RNA complex, 4 99.97
3bbn_Q_142 Ribosomal protein S17; small ribosomal subunit, sp 99.96
3i1m_Q_84 30S ribosomal protein S17; ribosome structure, pro 99.96
>2vqe_Q (Q:) 30S ribosomal protein S17; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
Probab=99.97  E-value=9.7e-32  Score=194.64  Aligned_cols=78  Identities=56%  Similarity=0.882  Sum_probs=76.4

Q ss_pred             CCCEEEEEEEEEECCCCEEEEEEEEEEECCCCCEEECCCEEEEECCCCCCCCCCCEEEEEECCCCCCCEEEEEEEEEE
Q ss_conf             973479999996089861999997188786413087351038986886604068789999637754320399997640
Q gi|254780252|r    1 MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSEG   78 (79)
Q Consensus         1 m~~k~l~G~Vvs~km~KTv~V~v~r~~~~~ky~K~~~~~kk~~vHD~~~~~~~GD~V~i~e~rPiSK~K~~~vve~~~   78 (79)
                      ||+|+|.|+|+|++|+||++|++++++|||+|+|+++++++|+||||+|+|++||+|+|.|||||||+|+|+|+++..
T Consensus         1 M~~k~l~G~Vvs~km~KTv~V~v~r~~~~~ky~k~~~~~kky~aHD~~~~~~~GD~V~I~e~rPlSk~k~~~v~~i~~   78 (105)
T 2vqe_Q            1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVE   78 (105)
T ss_dssp             -CCCEEEEEEEEEEETTEEEEEEEEEEECTTTCCEEEEEEEEEEECTTCCCCTTCEEEEEEEEEEETTEEEEEEEEEE
T ss_pred             CCCEEEEEEEEECCCCCCEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEEEE
T ss_conf             996089999995679974899999999648767899860799999989889999999999877788917799999985



>1qd7_I (I:) S17 ribosomal protein; 30S ribosomal subunit, low resolution model, ribosome; 5.50A {Thermus thermophilus} Back     alignment and structure
>2zkq_q (q:) 40S ribosomal protein S11E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1h_Q Back     alignment and structure
>3bbn_Q (Q:) Ribosomal protein S17; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure
>3i1m_Q (Q:) 30S ribosomal protein S17; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_Q* 3e1a_J 3e1c_J 1vs5_Q 3i1o_Q 3i1q_Q 3i1s_Q 3i1z_Q 3i21_Q 2qal_Q* 1p6g_Q 1p87_Q 2aw7_Q 2avy_Q 2i2u_Q 2i2p_Q* 2qan_Q* 2qb9_Q* 2qbb_Q* 2qbd_Q ... Back     alignment and structure