254780251

254780251

50S ribosomal protein L14

GeneID in NCBI database:8209232Locus tag:CLIBASIA_00680
Protein GI in NCBI database:254780251Protein Accession:YP_003064664.1
Gene range:-(137773, 138141)Protein Length:122aa
Gene description:50S ribosomal protein L14
COG prediction:[J] Ribosomal protein L14
KEGG prediction:rplN; 50S ribosomal protein L14; K02874 large subunit ribosomal protein L14
SEED prediction:LSU ribosomal protein L14p (L23e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV
ccccccEEEEEEcccccEEEEEEEEccccccccccccEEEEEEEcccccccEEcccEEEEEEEEEccccccccccEEEEccccEEEEcccccEEEEEEEccHHHHHccccccEEEEEccccc
cEccccEEEEcEcccEEEEEEEEEccccccccEccccEEEEEEEEEccccccccccEEEEEEEEccccEEcccccEEcccccEEEEEcccccEccccEcccEccHHHHcccHHHHHHcccEc
miqmqtslsisdnsGARLVKCIKVlggskrkcasigDTVVVAVKEviprskvkkgsvqKAIIVRVSYgirrsdgsvvrfdkNAAVLIDNKkdllasrvfgpvprelriKGHLKILSLAAEVV
MIQMQTSlsisdnsgaRLVKCIKVlggskrkcasigdtvvvavkeviprskvkkgsvqkaiivrvsygirrsdgsvvrfdknaavlidnkkdllasrvfgpvprelrikghlkilslaaevv
MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV
****QTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV
**********SDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV
*I*MQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV
MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV
MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target122 50S ribosomal protein L14 [Candidatus Liberibacter asia
315122808122 50S ribosomal protein L14 [Candidatus Liberibacter sola 1 5e-54
163760809122 putative 50S ribosomal protein L14 [Hoeflea phototrophi 1 1e-43
222148376122 50S ribosomal protein L14 [Agrobacterium vitis S4] Leng 1 2e-43
116251550122 50S ribosomal protein L14 [Rhizobium leguminosarum bv. 1 2e-43
15965119122 50S ribosomal protein L14 [Sinorhizobium meliloti 1021] 1 2e-43
13470561122 50S ribosomal protein L14 [Mesorhizobium loti MAFF30309 1 2e-43
319408755139 50S ribosomal protein L14 [Bartonella schoenbuchensis R 1 2e-43
15889233122 50S ribosomal protein L14 [Agrobacterium tumefaciens st 1 3e-43
86357315122 50S ribosomal protein L14 [Rhizobium etli CFN 42] Lengt 1 3e-43
227821766122 50S ribosomal protein L14 [Sinorhizobium fredii NGR234] 1 3e-43
>gi|315122808|ref|YP_004063297.1| 50S ribosomal protein L14 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 122 Back     alignment and organism information
 Score =  214 bits (544), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 116/122 (95%)

Query: 1   MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKA 60
           MIQMQT+LS++DNSGAR V+CIKVLGGSKRKCASIGD ++VAVKEV+PRSK+KKGSVQKA
Sbjct: 1   MIQMQTNLSVADNSGARWVECIKVLGGSKRKCASIGDMIIVAVKEVVPRSKIKKGSVQKA 60

Query: 61  IIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAE 120
           +IVRVSYGIRRSDGSVVRFD NA VL+ +KKDLLA+RVFGPVPRELRIK HLKILSLAAE
Sbjct: 61  VIVRVSYGIRRSDGSVVRFDDNAVVLVSDKKDLLATRVFGPVPRELRIKSHLKILSLAAE 120

Query: 121 VV 122
           VV
Sbjct: 121 VV 122


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163760809|ref|ZP_02167888.1| putative 50S ribosomal protein L14 [Hoeflea phototrophica DFL-43] Length = 122 Back     alignment and organism information
>gi|222148376|ref|YP_002549333.1| 50S ribosomal protein L14 [Agrobacterium vitis S4] Length = 122 Back     alignment and organism information
>gi|116251550|ref|YP_767388.1| 50S ribosomal protein L14 [Rhizobium leguminosarum bv. viciae 3841] Length = 122 Back     alignment and organism information
>gi|15965119|ref|NP_385472.1| 50S ribosomal protein L14 [Sinorhizobium meliloti 1021] Length = 122 Back     alignment and organism information
>gi|13470561|ref|NP_102130.1| 50S ribosomal protein L14 [Mesorhizobium loti MAFF303099] Length = 122 Back     alignment and organism information
>gi|319408755|emb|CBI82412.1| 50S ribosomal protein L14 [Bartonella schoenbuchensis R1] Length = 139 Back     alignment and organism information
>gi|15889233|ref|NP_354914.1| 50S ribosomal protein L14 [Agrobacterium tumefaciens str. C58] Length = 122 Back     alignment and organism information
>gi|86357315|ref|YP_469207.1| 50S ribosomal protein L14 [Rhizobium etli CFN 42] Length = 122 Back     alignment and organism information
>gi|227821766|ref|YP_002825736.1| 50S ribosomal protein L14 [Sinorhizobium fredii NGR234] Length = 122 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target122 50S ribosomal protein L14 [Candidatus Liberibacter asia
PRK05483122 PRK05483, rplN, 50S ribosomal protein L14; Validated 2e-48
TIGR01067122 TIGR01067, rplN_bact, ribosomal protein L14, bacterial/ 1e-39
COG0093122 COG0093, RplN, Ribosomal protein L14 [Translation, ribo 4e-38
CHL00057122 CHL00057, rpl14, ribosomal protein L14 8e-38
KOG0901145 KOG0901, KOG0901, KOG0901, 60S ribosomal protein L14/L1 1e-20
PRK08571132 PRK08571, rpl14p, 50S ribosomal protein L14P; Reviewed 3e-14
TIGR03673131 TIGR03673, rpl14p_arch, 50S ribosomal protein L14P 1e-13
PTZ00054139 PTZ00054, PTZ00054, 60S ribosomal protein L23; Provisio 3e-09
KOG3441149 KOG3441, KOG3441, KOG3441, Mitochondrial ribosomal prot 1e-06
pfam00238122 pfam00238, Ribosomal_L14, Ribosomal protein L14p/L23e 2e-42
>gnl|CDD|180117 PRK05483, rplN, 50S ribosomal protein L14; Validated Back     alignment and domain information
>gnl|CDD|130139 TIGR01067, rplN_bact, ribosomal protein L14, bacterial/organelle Back     alignment and domain information
>gnl|CDD|30442 COG0093, RplN, Ribosomal protein L14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|176997 CHL00057, rpl14, ribosomal protein L14 Back     alignment and domain information
>gnl|CDD|36119 KOG0901, KOG0901, KOG0901, 60S ribosomal protein L14/L17/L23 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181478 PRK08571, rpl14p, 50S ribosomal protein L14P; Reviewed Back     alignment and domain information
>gnl|CDD|132712 TIGR03673, rpl14p_arch, 50S ribosomal protein L14P Back     alignment and domain information
>gnl|CDD|185418 PTZ00054, PTZ00054, 60S ribosomal protein L23; Provisional Back     alignment and domain information
>gnl|CDD|38651 KOG3441, KOG3441, KOG3441, Mitochondrial ribosomal protein L14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|143989 pfam00238, Ribosomal_L14, Ribosomal protein L14p/L23e Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 122 50S ribosomal protein L14 [Candidatus Liberibacter asia
TIGR01067128 rplN_bact ribosomal protein L14; InterPro: IPR005745 Ri 100.0
COG0093122 RplN Ribosomal protein L14 [Translation, ribosomal stru 100.0
PRK05483122 rplN 50S ribosomal protein L14; Validated 100.0
CHL00057122 rpl14 ribosomal protein L14 100.0
pfam00238122 Ribosomal_L14 Ribosomal protein L14p/L23e. 100.0
TIGR03673131 rpl14p_arch 50S ribosomal protein L14P. Part of the 50S 100.0
PRK08571132 rpl14p 50S ribosomal protein L14P; Reviewed 100.0
PTZ00054139 60S ribosomal protein L23; Provisional 100.0
KOG0901145 consensus 100.0
PTZ00320188 ribosomal protein L14; Provisional 99.8
KOG3441149 consensus 99.8
>TIGR01067 rplN_bact ribosomal protein L14; InterPro: IPR005745 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0093 RplN Ribosomal protein L14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05483 rplN 50S ribosomal protein L14; Validated Back     alignment and domain information
>CHL00057 rpl14 ribosomal protein L14 Back     alignment and domain information
>pfam00238 Ribosomal_L14 Ribosomal protein L14p/L23e Back     alignment and domain information
>TIGR03673 rpl14p_arch 50S ribosomal protein L14P Back     alignment and domain information
>PRK08571 rpl14p 50S ribosomal protein L14P; Reviewed Back     alignment and domain information
>PTZ00054 60S ribosomal protein L23; Provisional Back     alignment and domain information
>KOG0901 consensus Back     alignment and domain information
>PTZ00320 ribosomal protein L14; Provisional Back     alignment and domain information
>KOG3441 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target122 50S ribosomal protein L14 [Candidatus Liberibacter asia
2j01_O122 Structure Of The Thermus Thermophilus 70s Ribosome 3e-50
2hgj_N122 Crystal Structure Of The 70s Thermus Thermophilus R 3e-50
1c04_D122 Identification Of Known Protein And Rna Structures 4e-47
1p85_I123 Real Space Refined Coordinates Of The 50s Subunit F 8e-47
3ofq_K122 Crystal Structure Of The E. Coli Ribosome Bound To 3e-46
2wwq_K121 E.Coli 70s Ribosome Stalled During Translation Of T 9e-46
2gya_I122 Structure Of The 50s Subunit Of A Pre-Translocation 9e-46
2j28_K121 Model Of E. Coli Srp Bound To 70s Rncs Length = 121 4e-45
3bbo_M121 Homology Model For The Spinach Chloroplast 50s Subu 2e-44
1nkw_I134 Crystal Structure Of The Large Ribosomal Subunit Fr 1e-43
1pnu_I132 Crystal Structure Of A Streptomycin Dependent Ribos 5e-42
1ffk_H132 Crystal Structure Of The Large Ribosomal Subunit Fr 9e-27
1s72_K132 Refined Crystal Structure Of The Haloarcula Marismo 2e-26
2zkr_k140 Structure Of A Mammalian Ribosomal 60s Subunit With 1e-25
3izr_M140 Localization Of The Large Subunit Ribosomal Protein 5e-25
2x7n_C132 Mechanism Of Eif6s Anti-Association Activity Length 1e-23
1s1i_R137 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 1e-23
3jyw_R131 Structure Of The 60s Proteins For Eukaryotic Riboso 1e-23
gi|116668246|pdb|2J01|O Chain O, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 122 Back     alignment and structure
 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 69/122 (56%), Positives = 91/122 (74%)

Query: 1   MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKA 60
           MIQ QT L ++DN+GAR + CI+VL GS  K A++GD +V +VKE IPR  VK+G V KA
Sbjct: 1   MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKA 60

Query: 61  IIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAE 120
           ++VR    I+R DGS +RFD NAAV+I+N+ +   +RVFGPV RELR KG +KI+SLA E
Sbjct: 61  VVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPE 120

Query: 121 VV 122
           V+
Sbjct: 121 VL 122


gi|119389744|pdb|2HGJ|N Chain N, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgi. Length = 122 Back     alignment and structure
gi|6137594|pdb|1C04|D Chain D, Identification Of Known Protein And Rna Structures In A 5 A Map Of The Large Ribosomal Subunit From Haloarcula Marismortui Length = 122 Back     alignment and structure
gi|33357910|pdb|1P85|I Chain I, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 123 Back     alignment and structure
>gi|308388017|pdb|3OFQ|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To Erythromycin. This File Contains The 50s Subunit Of The Second 70s Ribosome. Length = 122 Back     alignment and structure
>gi|294662260|pdb|2WWQ|K Chain K, E.Coli 70s Ribosome Stalled During Translation Of Tnac Leader Peptide. This File Contains The 50s, The P-Site Trna And The Tnac Leader Peptide (Part 2 Of 2) Length = 121 Back     alignment and structure
>gi|116667443|pdb|2GYA|I Chain I, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 122 Back     alignment and structure
>gi|119390355|pdb|2J28|K Chain K, Model Of E. Coli Srp Bound To 70s Rncs Length = 121 Back     alignment and structure
gi|189096135|pdb|3BBO|M Chain M, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 121 Back     alignment and structure
gi|28948928|pdb|1NKW|I Chain I, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 134 Back     alignment and structure
>gi|34811562|pdb|1PNU|I Chain I, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 132 Back     alignment and structure
gi|10120927|pdb|1FFK|H Chain H, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 132 Back     alignment and structure
>gi|50513480|pdb|1S72|K Chain K, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 132 Back     alignment and structure
gi|187609309|pdb|2ZKR|KK Chain k, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 140 Back     alignment and structure
>gi|315113254|pdb|3IZR|M Chain M, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 140 Back     alignment and structure
>gi|292659544|pdb|2X7N|C Chain C, Mechanism Of Eif6s Anti-Association Activity Length = 132 Back     alignment and structure
gi|49258856|pdb|1S1I|R Chain R, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h. Length = 137 Back     alignment and structure
>gi|281500848|pdb|3JYW|R Chain R, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 131 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target122 50S ribosomal protein L14 [Candidatus Liberibacter asia
2j01_O122 50S ribosomal protein L14; ribosome, tRNA, paromomycin, 1e-38
1whi_A122 Ribosomal protein L14; rRNA-binding; 1.50A {Geobacillus 2e-37
3ofq_K122 50S ribosomal protein L14; protein biosynthesis, riboso 2e-37
3bbo_M121 Ribosomal protein L14; large ribosomal subunit, spinach 4e-36
3i1n_K123 50S ribosomal protein L14; ribosome structure, protein- 2e-34
1vq8_K132 50S ribosomal protein L14P; ribosome 50S, protein-prote 2e-31
2zkr_k140 60S ribosomal protein L23; protein-RNA complex, 60S rib 2e-28
>2j01_O 50S ribosomal protein L14; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: b.39.1.1 PDB: 2j03_O 2jl6_O 2jl8_O 2v47_O 2v49_O 2wdi_O 2wdj_O 2wdl_O 2wdn_O 2wh2_O 2wh4_O 3fin_O 3hux_O 3huz_O 3f1f_O 1vsp_I 2hgj_N 2hgq_N 2hgu_N 1vsa_I ... Length = 122 Back     alignment and structure
 Score =  152 bits (387), Expect = 1e-38
 Identities = 69/122 (56%), Positives = 91/122 (74%)

Query: 1   MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKA 60
           MIQ QT L ++DN+GAR + CI+VL GS  K A++GD +V +VKE IPR  VK+G V KA
Sbjct: 1   MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKA 60

Query: 61  IIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAE 120
           ++VR    I+R DGS +RFD NAAV+I+N+ +   +RVFGPV RELR KG +KI+SLA E
Sbjct: 61  VVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPE 120

Query: 121 VV 122
           V+
Sbjct: 121 VL 122


>1whi_A Ribosomal protein L14; rRNA-binding; 1.50A {Geobacillus stearothermophilus} SCOP: b.39.1.1 PDB: 1giy_N 1ml5_n* 1c04_D 1yl3_N 2b66_O 2b9n_O 2b9p_O 487d_M Length = 122 Back     alignment and structure
>3ofq_K 50S ribosomal protein L14; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 3ofr_K* 3i1n_K 1p85_I 1p86_I 1vs8_K 1vs6_K 2aw4_K 2awb_K 1vt2_K 2i2v_K 2i2t_K* 2qao_K* 2qba_K* 2qbc_K* 2qbe_K 2qbg_K 2qbi_K* 2qbk_K* 2qov_K 2qox_K ... Length = 122 Back     alignment and structure
>3bbo_M Ribosomal protein L14; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 121 Back     alignment and structure
>3i1n_K 50S ribosomal protein L14; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_I 1p86_I 1vs8_K 2aw4_K 2awb_K 1vs6_K 2i2v_K 2i2t_K* 2qao_K* 2qba_K* 2qbc_K* 2qbe_K 2qbg_K 2qbi_K* 2qbk_K* 2qov_K 2qox_K 2qoz_K* 2qp1_K* 2rdo_K ... Length = 123 Back     alignment and structure
>1vq8_K 50S ribosomal protein L14P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.39.1.1 PDB: 1vq4_K* 1vq5_K* 1vq6_K* 1vq7_K* 1s72_K* 1vq9_K* 1vqk_K* 1vql_K* 1vqm_K* 1vqn_K* 1vqo_K* 1vqp_K* 1yhq_K* 1yi2_K* 1yij_K* 1yit_K* 1yj9_K* 1yjn_K* 1yjw_K* 2otj_K* ... Length = 132 Back     alignment and structure
>2zkr_k 60S ribosomal protein L23; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_R Length = 140 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target122 50S ribosomal protein L14 [Candidatus Liberibacter asia
1whi_A122 Ribosomal protein L14; rRNA-binding; 1.50A {Geobacillus 100.0
2j01_O122 50S ribosomal protein L14; ribosome, tRNA, paromomycin, 100.0
3bbo_M121 Ribosomal protein L14; large ribosomal subunit, spinach 100.0
3ofq_K122 50S ribosomal protein L14; protein biosynthesis, riboso 100.0
1vq8_K132 50S ribosomal protein L14P; ribosome 50S, protein-prote 100.0
2zkr_k140 60S ribosomal protein L23; protein-RNA complex, 60S rib 100.0
>1whi_A Ribosomal protein L14; rRNA-binding; 1.50A {Geobacillus stearothermophilus} SCOP: b.39.1.1 PDB: 1giy_N 1ml5_n* 1c04_D 1yl3_N 2b66_O 2b9n_O 2b9p_O 487d_M Back     alignment and structure
Probab=100.00  E-value=0  Score=321.17  Aligned_cols=122  Identities=56%  Similarity=0.849  Sum_probs=120.6

Q ss_pred             CCCCCCEEEEEECCCCEEEEEEEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCEEEEEEEEECCCEECCCCCEEEEC
Q ss_conf             96778689999678942999999726887642573888999998205787214773789999971135176898888618
Q gi|254780251|r    1 MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFD   80 (122)
Q Consensus         1 MIq~~t~l~v~DNSGak~v~cI~v~~~~~~~~a~vGD~I~vsVk~~~p~~k~kkg~v~~avIVrtkk~~~R~dG~~i~F~   80 (122)
                      |||.+|+|+|+|||||++++||++++++++++|.+||+|++|||+++|+++++||++++|+|||||++++|+||++++||
T Consensus         1 MIq~~T~l~v~DNSGak~v~cI~v~~~~~~~~a~vGD~I~vsVk~~~~~~~vkkg~v~~avIVrtkk~~~R~dG~~i~F~   80 (122)
T 1whi_A            1 MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPGGVVKKGQVVKAVVVRTKRGVRRPDGSYIRFD   80 (122)
T ss_dssp             CBCTTCEEEECBSSSEEEEEEEEECSSTTCCCBCTTCEEEEEEEEECTTSSSCTTCEEEEEEEECSSCEECTTSCEECCS
T ss_pred             CCCCCCEEEEEECCCCCEEEEEEEECCCCCCCCCCCCEEEEEEEECCCCCCEECCCEEEEEEEEEECCEECCCCCEEECC
T ss_conf             97656679986789997899999968888333546989999996046798136463500899975021085999989828


Q ss_pred             CEEEEEECCCCCEECCEEECCHHHHHHCCCCEEEEEECCCCC
Q ss_conf             805999989997602266331006664179808875243129
Q gi|254780251|r   81 KNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV  122 (122)
Q Consensus        81 ~Na~VLin~~~~p~GtRI~Gpv~~elr~~~~~Ki~slA~~vi  122 (122)
                      ||||||+|++++|+||||+||+|+|||+++|+||+||||+||
T Consensus        81 ~Na~VLi~~~~~p~GtrI~Gpv~~elr~~~~~Ki~slA~~ii  122 (122)
T 1whi_A           81 ENACVIIRDDKSPRGTRIFGPVARELRDKDFMKIISLAPEVI  122 (122)
T ss_dssp             SCEEEEECTTSCBSSSCBCSCBCTHHHHTTCHHHHHHCSCBC
T ss_pred             CCEEEEECCCCCEEEEEEECCCCHHHHHCCCCHHEECCCHHC
T ss_conf             987999979999905279615229886468942203541019



>2j01_O 50S ribosomal protein L14; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: b.39.1.1 PDB: 2j03_O 2jl6_O 2jl8_O 2v47_O 2v49_O 2wdi_O 2wdj_O 2wdl_O 2wdn_O 2wh2_O 2wh4_O 2wrj_O 2wrl_O 2wro_O 2wrr_O 2x9s_O 2x9u_O 2xg0_O 2xg2_O 3fin_O ... Back     alignment and structure
>3bbo_M Ribosomal protein L14; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3ofq_K 50S ribosomal protein L14; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 3ofr_K* 3i1n_K 1p85_I 1p86_I 1vs8_K 1vs6_K 2aw4_K 2awb_K 1vt2_K 2i2v_K 2i2t_K* 2qao_K* 2qba_K* 2qbc_K* 2qbe_K 2qbg_K 2qbi_K* 2qbk_K* 2qov_K 2qox_K ... Back     alignment and structure
>1vq8_K 50S ribosomal protein L14P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.39.1.1 PDB: 1vq4_K* 1vq5_K* 1vq6_K* 1vq7_K* 1s72_K* 1vq9_K* 1vqk_K* 1vql_K* 1vqm_K* 1vqn_K* 1vqo_K* 1vqp_K* 1yhq_K* 1yi2_K* 1yij_K* 1yit_K* 1yj9_K* 1yjn_K* 1yjw_K* 2otj_K* ... Back     alignment and structure
>2zkr_k 60S ribosomal protein L23; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_R 2x7n_C 3jyw_R Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 122 50S ribosomal protein L14 [Candidatus Liberibacter asia
d2j01o1122 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus therm 7e-39
d1whia_122 b.39.1.1 (A:) Ribosomal protein L14 {Bacillus stearothe 2e-36
d2gyci1121 b.39.1.1 (I:2-122) Ribosomal protein L14 {Escherichia c 2e-33
d1vqok1132 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Halo 3e-31
>d2j01o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]} Length = 122 Back     information, alignment and structure

class: All beta proteins
fold: Ribosomal protein L14
superfamily: Ribosomal protein L14
family: Ribosomal protein L14
domain: Ribosomal protein L14
species: Thermus thermophilus [TaxId: 274]
 Score =  152 bits (386), Expect = 7e-39
 Identities = 69/122 (56%), Positives = 91/122 (74%)

Query: 1   MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKA 60
           MIQ QT L ++DN+GAR + CI+VL GS  K A++GD +V +VKE IPR  VK+G V KA
Sbjct: 1   MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKA 60

Query: 61  IIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAE 120
           ++VR    I+R DGS +RFD NAAV+I+N+ +   +RVFGPV RELR KG +KI+SLA E
Sbjct: 61  VVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPE 120

Query: 121 VV 122
           V+
Sbjct: 121 VL 122


>d1whia_ b.39.1.1 (A:) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]} Length = 122 Back     information, alignment and structure
>d2gyci1 b.39.1.1 (I:2-122) Ribosomal protein L14 {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1vqok1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 132 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target122 50S ribosomal protein L14 [Candidatus Liberibacter asia
d1whia_122 Ribosomal protein L14 {Bacillus stearothermophilus [Tax 100.0
d2j01o1122 Ribosomal protein L14 {Thermus thermophilus [TaxId: 274 100.0
d2gyci1121 Ribosomal protein L14 {Escherichia coli [TaxId: 562]} 100.0
d1vqok1132 Ribosomal protein L14 {Archaeon Haloarcula marismortui 100.0
>d1whia_ b.39.1.1 (A:) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: All beta proteins
fold: Ribosomal protein L14
superfamily: Ribosomal protein L14
family: Ribosomal protein L14
domain: Ribosomal protein L14
species: Bacillus stearothermophilus [TaxId: 1422]
Probab=100.00  E-value=0  Score=324.94  Aligned_cols=122  Identities=56%  Similarity=0.849  Sum_probs=120.6

Q ss_pred             CCCCCCEEEEEECCCCEEEEEEEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCEEEEEEEEECCCEECCCCCEEEEC
Q ss_conf             96778689999678942999999726887642573888999998205787214773789999971135176898888618
Q gi|254780251|r    1 MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFD   80 (122)
Q Consensus         1 MIq~~t~l~v~DNSGak~v~cI~v~~~~~~~~a~vGD~I~vsVk~~~p~~k~kkg~v~~avIVrtkk~~~R~dG~~i~F~   80 (122)
                      |||.+|+|+|+|||||+.++||++++++++++|++||+|++|||+++|+++++||++++|+||||||+++|+||++++||
T Consensus         1 MIq~~t~l~v~DNSGak~v~cI~v~~~~~~~~a~vGD~I~vsVk~~~~~~~vkkg~v~~AvIVrtkk~~~R~dG~~i~F~   80 (122)
T d1whia_           1 MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPGGVVKKGQVVKAVVVRTKRGVRRPDGSYIRFD   80 (122)
T ss_dssp             CBCTTCEEEECBSSSEEEEEEEEECSSTTCCCBCTTCEEEEEEEEECTTSSSCTTCEEEEEEEECSSCEECTTSCEECCS
T ss_pred             CCCCCCEEEEEECCCCCEEEEEEEECCCCCCCCCCCCEEEEEEEECCCCCEEECCCCEEEEEEEEEEEEECCCCCEEEEC
T ss_conf             97657679874689987899999978878511332879999992301377067265102589988631431688668858


Q ss_pred             CEEEEEECCCCCEECCEEECCHHHHHHCCCCEEEEEECCCCC
Q ss_conf             805999989997602266331006664179808875243129
Q gi|254780251|r   81 KNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV  122 (122)
Q Consensus        81 ~Na~VLin~~~~p~GtRI~Gpv~~elr~~~~~Ki~slA~~vi  122 (122)
                      ||||||+|++++|+|||||||+|+|||+++|+||+||||+||
T Consensus        81 ~Na~VLl~~~~~P~GTrI~Gpv~~elr~~~~~Ki~sLA~~vi  122 (122)
T d1whia_          81 ENACVIIRDDKSPRGTRIFGPVARELRDKDFMKIISLAPEVI  122 (122)
T ss_dssp             SCEEEEECTTSCBSSSCBCSCBCTHHHHTTCHHHHHHCSCBC
T ss_pred             CCEEEEECCCCCEEEEEEECCCHHHHHHCCCCHHHCCCCHHC
T ss_conf             987999979999912369504019986468825650420029



>d2j01o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gyci1 b.39.1.1 (I:2-122) Ribosomal protein L14 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqok1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 122 50S ribosomal protein L14 [Candidatus Liberibacter
1whi_A_122 (A:) Ribosomal protein L14; rRNA-binding; 1.50A {G 3e-35
3bbo_M_121 (M:) Ribosomal protein L14; large ribosomal subuni 9e-34
2j01_O_1-9999 (O:1-99) 50S ribosomal protein L14; ribosome, tRNA 4e-29
3i1n_K_1-9999 (K:1-99) 50S ribosomal protein L14; ribosome struc 2e-27
1vq8_K_1-106106 (K:1-106) 50S ribosomal protein L14P; ribosome 50S 7e-21
2zkr_k_1-114114 (k:1-114) 60S ribosomal protein L23; protein-RNA c 4e-20
>1whi_A (A:) Ribosomal protein L14; rRNA-binding; 1.50A {Geobacillus stearothermophilus}Length = 122 Back     alignment and structure
 Score =  141 bits (357), Expect = 3e-35
 Identities = 68/122 (55%), Positives = 87/122 (71%)

Query: 1   MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKA 60
           MIQ ++ L ++DNSGAR V  IKVLGGS R+ A+IGD VV  VK+  P   VKKG V KA
Sbjct: 1   MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPGGVVKKGQVVKA 60

Query: 61  IIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAE 120
           ++VR   G+RR DGS +RFD+NA V+I + K    +R+FGPV RELR K  +KI+SLA E
Sbjct: 61  VVVRTKRGVRRPDGSYIRFDENACVIIRDDKSPRGTRIFGPVARELRDKDFMKIISLAPE 120

Query: 121 VV 122
           V+
Sbjct: 121 VI 122


>3bbo_M (M:) Ribosomal protein L14; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 121 Back     alignment and structure
>2j01_O (O:1-99) 50S ribosomal protein L14; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 99 Back     alignment and structure
>3i1n_K (K:1-99) 50S ribosomal protein L14; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_I 1p86_I 1vs8_K 2aw4_K 2awb_K 1vs6_K 2i2v_K 2i2t_K* 2qao_K* 2qba_K* 2qbc_K* 2qbe_K 2qbg_K 2qbi_K* 2qbk_K* 2qov_K 2qox_K 2qoz_K* 2qp1_K* 2rdo_K ...Length = 99 Back     alignment and structure
>1vq8_K (K:1-106) 50S ribosomal protein L14P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 106 Back     alignment and structure
>2zkr_k (k:1-114) 60S ribosomal protein L23; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_RLength = 114 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target122 50S ribosomal protein L14 [Candidatus Liberibacter asia
1whi_A_122 Ribosomal protein L14; rRNA-binding; 1.50A {Geobac 100.0
3bbo_M_121 Ribosomal protein L14; large ribosomal subunit, sp 100.0
2j01_O_1-9999 50S ribosomal protein L14; ribosome, tRNA, paromom 100.0
3i1n_K_1-9999 50S ribosomal protein L14; ribosome structure, pro 100.0
2zkr_k_1-114114 60S ribosomal protein L23; protein-RNA complex, 60 100.0
1vq8_K_1-106106 50S ribosomal protein L14P; ribosome 50S, protein- 100.0
>1whi_A (A:) Ribosomal protein L14; rRNA-binding; 1.50A {Geobacillus stearothermophilus} Back     alignment and structure
Probab=100.00  E-value=0  Score=317.34  Aligned_cols=122  Identities=56%  Similarity=0.849  Sum_probs=120.8

Q ss_pred             CCCCCCEEEEEECCCCEEEEEEEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCEEEEEEEEECCCEECCCCCEEEEC
Q ss_conf             96778689999678942999999726887642573888999998205787214773789999971135176898888618
Q gi|254780251|r    1 MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFD   80 (122)
Q Consensus         1 MIq~~t~l~v~DNSGak~v~cI~v~~~~~~~~a~vGD~I~vsVk~~~p~~k~kkg~v~~avIVrtkk~~~R~dG~~i~F~   80 (122)
                      |||.+|+|+|+|||||+.++||++|+++++++|.+||+|++|||++.|+++++||++++|+|||||++++|.||++++||
T Consensus         1 MIq~~T~l~v~DNSGak~v~cI~v~~~~~~~~a~vGD~I~vsVKk~~~~~kvkkg~v~~avIVrtkk~~~r~dg~~i~F~   80 (122)
T 1whi_A            1 MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPGGVVKKGQVVKAVVVRTKRGVRRPDGSYIRFD   80 (122)
T ss_dssp             CBCTTCEEEECBSSSEEEEEEEEECSSTTCCCBCTTCEEEEEEEEECTTSSSCTTCEEEEEEEECSSCEECTTSCEECCS
T ss_pred             CCCCCCEEEEEECCCCCEEEEEEEECCCCCCCCCCCCEEEEEEEECCCCCCEECCCEEEEEEEEEEEEEECCCCCEEEEC
T ss_conf             97656679882789976899999979778401242759999997315787237474778999997100775898899828


Q ss_pred             CEEEEEECCCCCEECCEEECCHHHHHHCCCCEEEEEECCCCC
Q ss_conf             805999989997602266331006664179808875243129
Q gi|254780251|r   81 KNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAEVV  122 (122)
Q Consensus        81 ~Na~VLin~~~~p~GtRI~Gpv~~elr~~~~~Ki~slA~~vi  122 (122)
                      |||+||+|++++|+||||+||+|+|||+++|+||+|||+++|
T Consensus        81 ~Na~VLin~~~~p~GTrI~Gpv~~elr~~~~~Ki~sla~~iv  122 (122)
T 1whi_A           81 ENACVIIRDDKSPRGTRIFGPVARELRDKDFMKIISLAPEVI  122 (122)
T ss_dssp             SCEEEEECTTSCBSSSCBCSCBCTHHHHTTCHHHHHHCSCBC
T ss_pred             CCEEEEECCCCCEEEEEEEECCHHHHHHCCCCHHHCCCCHHC
T ss_conf             827999969999902279604239986458942303530019



>3bbo_M (M:) Ribosomal protein L14; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2j01_O (O:1-99) 50S ribosomal protein L14; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>3i1n_K (K:1-99) 50S ribosomal protein L14; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_I 1p86_I 1vs8_K 2aw4_K 2awb_K 1vs6_K 2i2v_K 2i2t_K* 2qao_K* 2qba_K* 2qbc_K* 2qbe_K 2qbg_K 2qbi_K* 2qbk_K* 2qov_K 2qox_K 2qoz_K* 2qp1_K* 2rdo_K ... Back     alignment and structure
>2zkr_k (k:1-114) 60S ribosomal protein L23; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_R Back     alignment and structure
>1vq8_K (K:1-106) 50S ribosomal protein L14P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure