254780256

254780256

50S ribosomal protein L22

GeneID in NCBI database:8209237Locus tag:CLIBASIA_00705
Protein GI in NCBI database:254780256Protein Accession:YP_003064669.1
Gene range:-(139887, 140282)Protein Length:131aa
Gene description:50S ribosomal protein L22
COG prediction:[J] Ribosomal protein L22
KEGG prediction:rplV; 50S ribosomal protein L22; K02890 large subunit ribosomal protein L22
SEED prediction:LSU ribosomal protein L22p (L17e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV
cccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHEEEEEEEEcccccccccccccccccccccccccEEEEEEEccccccccc
ccHHHHHHHHccccHEEEEEEEEEcccHHHHHHHHHHHcccEHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHEEEEEEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEEEcccccccc
msgkrsvskrrmgdNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANaennhdldvdRLIVSEAYVGKSVFMKRfhcrgrqrigrivrpfsRLTVIVREVSDEGKVV
msgkrsvskrrmgdneANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVanaennhdldvdrLIVSEAYVGKsvfmkrfhcrgrqrigrivrpfsrltvivrevsdegkvv
MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV
*******************IASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE********
***********MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV
MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV
MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV
MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target131 50S ribosomal protein L22 [Candidatus Liberibacter asia
315122813132 50S ribosomal protein L22 [Candidatus Liberibacter sola 1 1e-55
325293331129 50S ribosomal protein L22 [Agrobacterium sp. H13-3] Len 1 3e-45
15889237129 50S ribosomal protein L22 [Agrobacterium tumefaciens st 1 7e-45
23502105129 50S ribosomal protein L22 [Brucella suis 1330] Length = 1 2e-44
227821761129 50S ribosomal protein L22 [Sinorhizobium fredii NGR234] 1 3e-44
17987045129 50S ribosomal protein L22 [Brucella melitensis bv. 1 st 1 4e-44
153009291129 50S ribosomal protein L22 [Ochrobactrum anthropi ATCC 4 1 6e-44
239832117129 ribosomal protein L22 [Ochrobactrum intermedium LMG 330 1 8e-44
222148371129 50S ribosomal protein L22 [Agrobacterium vitis S4] Leng 1 9e-44
163868645129 50S ribosomal protein L22 [Bartonella tribocorum CIP 10 1 2e-43
>gi|315122813|ref|YP_004063302.1| 50S ribosomal protein L22 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 132 Back     alignment and organism information
 Score =  219 bits (557), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 1/132 (0%)

Query: 1   MSGKRSVSKRR-MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           M+ KR+V +RR +GDNEANAIASMLR+SPQKLNLVAAMIRGK+VSDALADLEFSRKRIA 
Sbjct: 1   MNEKRAVPRRRRVGDNEANAIASMLRISPQKLNLVAAMIRGKKVSDALADLEFSRKRIAV 60

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
           EV+KTL SA+ANAENNHDLD+DRL+VSEAYVGKSV MKRFHCR RQRIGRI +PFSRL+V
Sbjct: 61  EVKKTLRSAIANAENNHDLDIDRLVVSEAYVGKSVVMKRFHCRARQRIGRINKPFSRLSV 120

Query: 120 IVREVSDEGKVV 131
           IVREV DE KVV
Sbjct: 121 IVREVQDERKVV 132


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293331|ref|YP_004279195.1| 50S ribosomal protein L22 [Agrobacterium sp. H13-3] Length = 129 Back     alignment and organism information
>gi|15889237|ref|NP_354918.1| 50S ribosomal protein L22 [Agrobacterium tumefaciens str. C58] Length = 129 Back     alignment and organism information
>gi|23502105|ref|NP_698232.1| 50S ribosomal protein L22 [Brucella suis 1330] Length = 129 Back     alignment and organism information
>gi|227821761|ref|YP_002825731.1| 50S ribosomal protein L22 [Sinorhizobium fredii NGR234] Length = 129 Back     alignment and organism information
>gi|17987045|ref|NP_539679.1| 50S ribosomal protein L22 [Brucella melitensis bv. 1 str. 16M] Length = 129 Back     alignment and organism information
>gi|153009291|ref|YP_001370506.1| 50S ribosomal protein L22 [Ochrobactrum anthropi ATCC 49188] Length = 129 Back     alignment and organism information
>gi|239832117|ref|ZP_04680446.1| ribosomal protein L22 [Ochrobactrum intermedium LMG 3301] Length = 129 Back     alignment and organism information
>gi|222148371|ref|YP_002549328.1| 50S ribosomal protein L22 [Agrobacterium vitis S4] Length = 129 Back     alignment and organism information
>gi|163868645|ref|YP_001609854.1| 50S ribosomal protein L22 [Bartonella tribocorum CIP 105476] Length = 129 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target131 50S ribosomal protein L22 [Candidatus Liberibacter asia
PRK00565112 PRK00565, rplV, 50S ribosomal protein L22; Reviewed 1e-37
COG0091120 COG0091, RplV, Ribosomal protein L22 [Translation, ribo 4e-28
cd00336105 cd00336, Ribosomal_L22, Ribosomal protein L22/L17e 4e-23
TIGR01044103 TIGR01044, rplV_bact, ribosomal protein L22, bacterial 3e-18
KOG1711218 KOG1711, KOG1711, KOG1711, Mitochondrial/chloroplast ri 8e-16
CHL00034117 CHL00034, rpl22, ribosomal protein L22 7e-14
PRK12279 311 PRK12279, PRK12279, 50S ribosomal protein L22/unknown d 5e-09
PRK04223153 PRK04223, rpl22p, 50S ribosomal protein L22P; Reviewed 2e-05
TIGR01038150 TIGR01038, L22_arch, ribosomal protein L22(archaeal)/L1 2e-04
pfam00237105 pfam00237, Ribosomal_L22, Ribosomal protein L22p/L17e 5e-30
>gnl|CDD|179067 PRK00565, rplV, 50S ribosomal protein L22; Reviewed Back     alignment and domain information
>gnl|CDD|30440 COG0091, RplV, Ribosomal protein L22 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|48343 cd00336, Ribosomal_L22, Ribosomal protein L22/L17e Back     alignment and domain information
>gnl|CDD|130116 TIGR01044, rplV_bact, ribosomal protein L22, bacterial type Back     alignment and domain information
>gnl|CDD|36923 KOG1711, KOG1711, KOG1711, Mitochondrial/chloroplast ribosomal protein L22 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|176975 CHL00034, rpl22, ribosomal protein L22 Back     alignment and domain information
>gnl|CDD|138835 PRK12279, PRK12279, 50S ribosomal protein L22/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|179794 PRK04223, rpl22p, 50S ribosomal protein L22P; Reviewed Back     alignment and domain information
>gnl|CDD|130110 TIGR01038, L22_arch, ribosomal protein L22(archaeal)/L17(eukaryotic/archaeal) Back     alignment and domain information
>gnl|CDD|143988 pfam00237, Ribosomal_L22, Ribosomal protein L22p/L17e Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 131 50S ribosomal protein L22 [Candidatus Liberibacter asia
PRK12279 311 50S ribosomal protein L22/unknown domain fusion protein 100.0
CHL00034112 rpl22 ribosomal protein L22 100.0
PRK00565111 rplV 50S ribosomal protein L22; Reviewed 100.0
TIGR01044103 rplV_bact ribosomal protein L22; InterPro: IPR005727 Ri 100.0
COG0091120 RplV Ribosomal protein L22 [Translation, ribosomal stru 100.0
pfam00237105 Ribosomal_L22 Ribosomal protein L22p/L17e. This family 100.0
cd00336105 Ribosomal_L22 Ribosomal protein L22/L17e. L22 (L17 in e 100.0
PRK04223154 rpl22p 50S ribosomal protein L22P; Reviewed 100.0
TIGR01038151 L22_arch ribosomal protein L22; InterPro: IPR005721 Rib 99.97
KOG1711218 consensus 99.97
PTZ00178177 60S ribosomal protein L22/L17e; Provisional 99.94
KOG3353175 consensus 99.11
>PRK12279 50S ribosomal protein L22/unknown domain fusion protein; Provisional Back     alignment and domain information
>CHL00034 rpl22 ribosomal protein L22 Back     alignment and domain information
>PRK00565 rplV 50S ribosomal protein L22; Reviewed Back     alignment and domain information
>TIGR01044 rplV_bact ribosomal protein L22; InterPro: IPR005727 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0091 RplV Ribosomal protein L22 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00237 Ribosomal_L22 Ribosomal protein L22p/L17e Back     alignment and domain information
>cd00336 Ribosomal_L22 Ribosomal protein L22/L17e Back     alignment and domain information
>PRK04223 rpl22p 50S ribosomal protein L22P; Reviewed Back     alignment and domain information
>TIGR01038 L22_arch ribosomal protein L22; InterPro: IPR005721 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1711 consensus Back     alignment and domain information
>PTZ00178 60S ribosomal protein L22/L17e; Provisional Back     alignment and domain information
>KOG3353 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target131 50S ribosomal protein L22 [Candidatus Liberibacter asia
3mrz_S112 Recognition Of The Amber Stop Codon By Release Fact 6e-31
1giy_S113 Crystal Structure Of The Ribosome At 5.5 A Resoluti 1e-30
1bxe_A113 Ribosomal Protein L22 From Thermus Thermophilus Len 1e-30
1p85_Q110 Real Space Refined Coordinates Of The 50s Subunit F 2e-30
2gya_Q106 Structure Of The 50s Subunit Of A Pre-Translocation 1e-29
1jzx_L134 Structural Basis For The Interaction Of Antibiotics 1e-29
1pnu_Q130 Crystal Structure Of A Streptomycin Dependent Ribos 2e-29
1i4j_A110 Crystal Structure Of L22 Ribosomal Protein Mutant L 2e-27
3bbo_U199 Homology Model For The Spinach Chloroplast 50s Subu 6e-27
2ftc_M110 Structural Model For The Large Subunit Of The Mamma 1e-14
2zkr_r184 Structure Of A Mammalian Ribosomal 60s Subunit With 2e-11
3izr_V171 Localization Of The Large Subunit Ribosomal Protein 7e-11
3jyw_N150 Structure Of The 60s Proteins For Eukaryotic Riboso 2e-10
3izs_V170 Localization Of The Large Subunit Ribosomal Protein 3e-10
1s1i_N183 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 1e-09
2ww9_I184 Cryo-Em Structure Of The Active Yeast Ssh1 Complex 1e-09
1ffk_O154 Crystal Structure Of The Large Ribosomal Subunit Fr 5e-07
1s72_R155 Refined Crystal Structure Of The Haloarcula Marismo 6e-07
3g4s_R150 Co-Crystal Structure Of Tiamulin Bound To The Large 1e-06
1yj9_R152 Crystal Structure Of The Mutant 50s Ribosomal Subun 3e-06
>gi|300508647|pdb|3MRZ|S Chain S, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 112 Back     alignment and structure
 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 65/110 (59%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            EA AIA  +R+SP+K+ LV  +IRGK + +A   L ++ KR A  V K L SA ANA N
Sbjct: 1   MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVN 60

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           NHD+  DRL V  AYV +   +KR   R R R   I +  S +TVI+ E 
Sbjct: 61  NHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEK 110


gi|14278049|pdb|1GIY|S Chain S, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1giy, Contains The 50s Ribosome Subunit. The 30s Ribosome Subunit, Three Trna, And Mrna Molecules Are In The File 1gix Length = 113 Back     alignment and structure
>gi|6729761|pdb|1BXE|A Chain A, Ribosomal Protein L22 From Thermus Thermophilus Length = 113 Back     alignment and structure
gi|33357917|pdb|1P85|Q Chain Q, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 110 Back     alignment and structure
>gi|116667450|pdb|2GYA|Q Chain Q, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 106 Back     alignment and structure
gi|16975050|pdb|1JZX|L Chain L, Structural Basis For The Interaction Of Antibiotics With The Peptidyl Transferase Center In Eubacteria Length = 134 Back     alignment and structure
>gi|34811570|pdb|1PNU|Q Chain Q, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 130 Back     alignment and structure
>gi|24158670|pdb|1I4J|A Chain A, Crystal Structure Of L22 Ribosomal Protein Mutant Length = 110 Back     alignment and structure
>gi|189096143|pdb|3BBO|U Chain U, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 199 Back     alignment and structure
>gi|99032319|pdb|2FTC|M Chain M, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome Length = 110 Back     alignment and structure
gi|187609317|pdb|2ZKR|RR Chain r, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 184 Back     alignment and structure
>gi|315113261|pdb|3IZR|V Chain V, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 171 Back     alignment and structure
>gi|281500844|pdb|3JYW|N Chain N, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 150 Back     alignment and structure
>gi|315113319|pdb|3IZS|V Chain V, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 170 Back     alignment and structure
>gi|49258852|pdb|1S1I|N Chain N, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 183 Back     alignment and structure
gi|270346346|pdb|2WW9|I Chain I, Cryo-Em Structure Of The Active Yeast Ssh1 Complex Bound To The Yeast 80s Ribosome Length = 184 Back     alignment and structure
>gi|10120934|pdb|1FFK|O Chain O, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 154 Back     alignment and structure
gi|50513487|pdb|1S72|R Chain R, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 155 Back     alignment and structure
>gi|228312159|pdb|3G4S|R Chain R, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 150 Back     alignment and structure
>gi|66360933|pdb|1YJ9|R Chain R, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui Containing A Three Residue Deletion In L22 Length = 152 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target131 50S ribosomal protein L22 [Candidatus Liberibacter asia
3ofq_S110 50S ribosomal protein L22; protein biosynthesis, riboso 9e-31
1i4j_A110 50S ribosomal protein L22; mutant, erythromycin resista 3e-28
2zjr_P134 50S ribosomal protein L22; ribosome, large ribosomal su 1e-27
3i1n_S110 50S ribosomal protein L22; ribosome structure, protein- 4e-27
3bbo_U199 Ribosomal protein L22; large ribosomal subunit, spinach 6e-26
2ftc_M110 Mitochondrial ribosomal protein L22 isoform A; mitochon 1e-22
1vq8_R155 50S ribosomal protein L22P; ribosome 50S, protein-prote 3e-19
2wwb_I184 60S ribosomal protein L17-A; ribosome, protein EXIT tun 9e-19
2zkr_r184 60S ribosomal protein L17; protein-RNA complex, 60S rib 6e-18
>3ofq_S 50S ribosomal protein L22; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_Q 1p86_Q 1vs8_S 1vs6_S 2aw4_S 2awb_S 1vt2_S 2i2v_S 2j28_S 2i2t_S* 2qao_S* 2qba_S* 2qbc_S* 2qbe_S 2qbg_S 2qbi_S* 2qbk_S* 2qov_S 2qox_S 2qoz_S* ... Length = 110 Back     alignment and structure
 Score =  127 bits (321), Expect = 9e-31
 Identities = 46/108 (42%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A     R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N
Sbjct: 2   ETIAKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 62  DGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>1i4j_A 50S ribosomal protein L22; mutant, erythromycin resistance, RNA binding, RNA binding protein; 1.80A {Thermus thermophilus} SCOP: d.55.1.1 PDB: 1bxe_A 1giy_S 1ml5_s* 1vsa_Q 1vsp_Q 1yl3_S 2b66_W 2b9n_W 2b9p_W 2hgj_V 2hgq_V 2hgu_V 2j01_W 2j03_W 2jl6_W 2jl8_W 2v47_W 2v49_W 2wdi_W 2wdj_W ... Length = 110 Back     alignment and structure
>2zjr_P 50S ribosomal protein L22; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.55.1.1 PDB: 1j5a_L* 1jzy_L* 1jzz_L* 1k01_L* 1nkw_Q 1nwx_Q* 1nwy_Q* 1ond_Q* 1sm1_Q* 1xbp_Q* 2zjp_P* 2zjq_P 1jzx_L 3cf5_P* 3dll_P* 1pnu_Q 1pny_Q 1vor_T 1vou_T 1vow_T ... Length = 134 Back     alignment and structure
>3i1n_S 50S ribosomal protein L22; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_Q 1p86_Q 1vs8_S 2aw4_S 2awb_S 1vs6_S 2i2v_S 2j28_S 2i2t_S* 2qao_S* 2qba_S* 2qbc_S* 2qbe_S 2qbg_S 2qbi_S* 2qbk_S* 2qov_S 2qox_S 2qoz_S* 2qp1_S* ... Length = 110 Back     alignment and structure
>3bbo_U Ribosomal protein L22; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 199 Back     alignment and structure
>2ftc_M Mitochondrial ribosomal protein L22 isoform A; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_M Length = 110 Back     alignment and structure
>1vq8_R 50S ribosomal protein L22P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.55.1.1 PDB: 1vq4_R* 1vq5_R* 1vq6_R* 1vq7_R* 1s72_R* 1vq9_R* 1vqk_R* 1vql_R* 1vqm_R* 1vqn_R* 1vqo_R* 1vqp_R* 1yhq_R* 1yi2_R* 1yij_R* 1yit_R* 1yjn_R* 1yjw_R* 2otj_R* 2otl_R* ... Length = 155 Back     alignment and structure
>2wwb_I 60S ribosomal protein L17-A; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_I 2ww9_I 1s1i_N Length = 184 Back     alignment and structure
>2zkr_r 60S ribosomal protein L17; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 184 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target131 50S ribosomal protein L22 [Candidatus Liberibacter asia
2zjr_P134 50S ribosomal protein L22; ribosome, large ribosomal su 100.0
1i4j_A110 50S ribosomal protein L22; mutant, erythromycin resista 100.0
3bbo_U199 Ribosomal protein L22; large ribosomal subunit, spinach 100.0
2ftc_M110 Mitochondrial ribosomal protein L22 isoform A; mitochon 100.0
3ofq_S110 50S ribosomal protein L22; protein biosynthesis, riboso 100.0
1vq8_R155 50S ribosomal protein L22P; ribosome 50S, protein-prote 100.0
2zkr_r184 60S ribosomal protein L17; protein-RNA complex, 60S rib 100.0
2wwb_I184 60S ribosomal protein L17-A; ribosome, protein EXIT tun 100.0
>2zjr_P 50S ribosomal protein L22; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.55.1.1 PDB: 1j5a_L* 1jzy_L* 1jzz_L* 1k01_L* 1nkw_Q 1nwx_Q* 1nwy_Q* 1ond_Q* 1sm1_Q* 1xbp_Q* 2zjp_P* 2zjq_P 1jzx_L 3cf5_P* 3dll_P* 1pnu_Q 1pny_Q 1vor_T 1vou_T 1vow_T ... Back     alignment and structure
Probab=100.00  E-value=2.2e-42  Score=269.27  Aligned_cols=123  Identities=36%  Similarity=0.432  Sum_probs=114.6

Q ss_pred             HHHHHHHHHHHEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHEE
Q ss_conf             35767421011231121487508899999999847986999998886582024799999999999999840599823369
Q gi|254780256|r    5 RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI   84 (131)
Q Consensus         5 ~~~~~~~~~~~e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~L~   84 (131)
                      +...+....+++..|+++|+|+||+|+++|+++|||++|+||+.||+|+|+++|.+|+|+|.||++||++|+|+|+|+||
T Consensus        12 k~~~~~~~~~~~~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kkaA~~i~K~L~SA~aNA~~~~~~d~~~L~   91 (134)
T 2zjr_P           12 KQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEMLEDRLF   91 (134)
T ss_dssp             HHHHHHCCCCCTTEEEEEEESSCHHHHHHHHHHSTTSBHHHHHHHHHHCCCTTHHHHHHHHTTTHHHHTTTTCCCGGGEE
T ss_pred             HHHHHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHEE
T ss_conf             99888761203456745627448899999999986990999999980197879999999999999999985399889958


Q ss_pred             EEEEEECCCCEEEEEEECCCCCCCCEECCCCEEEEEEEECCCC
Q ss_conf             9999988981142010256666372017850089999851723
Q gi|254780256|r   85 VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE  127 (131)
Q Consensus        85 I~~~~v~~G~~~KR~~prarGRa~~i~k~~sHi~VvL~e~~~~  127 (131)
                      |+++|||+||++|||+||||||++++++|+|||+|+|+|..++
T Consensus        92 I~~~~v~~G~~~KR~~prArGRa~~i~k~~sHI~VvL~ek~~~  134 (134)
T 2zjr_P           92 VKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAEKGNK  134 (134)
T ss_dssp             EEEEEEEECCCEEEEEECSTTCEEEEEECCEEEEEEEEECCCC
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCC
T ss_conf             8999989997054769875888876137840489999746889



>1i4j_A 50S ribosomal protein L22; mutant, erythromycin resistance, RNA binding, RNA binding protein; 1.80A {Thermus thermophilus} SCOP: d.55.1.1 PDB: 1bxe_A 1giy_S 1ml5_s* 1vsa_Q 1vsp_Q 1yl3_S 2b66_W 2b9n_W 2b9p_W 2hgj_V 2hgq_V 2hgu_V 2j01_W 2j03_W 2jl6_W 2jl8_W 2v47_W 2v49_W 2wdi_W 2wdj_W ... Back     alignment and structure
>3bbo_U Ribosomal protein L22; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>2ftc_M Mitochondrial ribosomal protein L22 isoform A; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_M Back     alignment and structure
>3ofq_S 50S ribosomal protein L22; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_Q 1p86_Q 1vs8_S 1vs6_S 2aw4_S 2awb_S 1vt2_S 2i2v_S 2j28_S 2i2t_S* 2qao_S* 2qba_S* 2qbc_S* 2qbe_S 2qbg_S 2qbi_S* 2qbk_S* 2qov_S 2qox_S 2qoz_S* ... Back     alignment and structure
>1vq8_R 50S ribosomal protein L22P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.55.1.1 PDB: 1vq4_R* 1vq5_R* 1vq6_R* 1vq7_R* 1s72_R* 1vq9_R* 1vqk_R* 1vql_R* 1vqm_R* 1vqn_R* 1vqo_R* 1vqp_R* 1yhq_R* 1yi2_R* 1yij_R* 1yit_R* 1yjn_R* 1yjw_R* 2otj_R* 2otl_R* ... Back     alignment and structure
>2zkr_r 60S ribosomal protein L17; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2wwb_I 60S ribosomal protein L17-A; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_I 2ww9_I 1s1i_N Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 131 50S ribosomal protein L22 [Candidatus Liberibacter asia
d2zjrp1127 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus r 2e-27
d2gycq1106 d.55.1.1 (Q:5-110) Ribosomal protein L22 {Escherichia c 6e-26
d1i4ja_110 d.55.1.1 (A:) Ribosomal protein L22 {Thermus aquaticus, 2e-25
d1vqor1150 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Halo 4e-19
>d2zjrp1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]} Length = 127 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein L22
superfamily: Ribosomal protein L22
family: Ribosomal protein L22
domain: Ribosomal protein L22
species: Deinococcus radiodurans [TaxId: 1299]
 Score =  114 bits (288), Expect = 2e-27
 Identities = 45/124 (36%), Positives = 65/124 (52%)

Query: 4   KRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRK 63
           K+   ++        A+A  +R+SP+K+ LV  +IRGK V DA   L F  +  +  V K
Sbjct: 4   KKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAK 63

Query: 64  TLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L SA ANA +N ++  DRL V EAYV     +KR   R R     I +  S +T+IV E
Sbjct: 64  VLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAE 123

Query: 124 VSDE 127
             ++
Sbjct: 124 KGNK 127


>d2gycq1 d.55.1.1 (Q:5-110) Ribosomal protein L22 {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1i4ja_ d.55.1.1 (A:) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} Length = 110 Back     information, alignment and structure
>d1vqor1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 150 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target131 50S ribosomal protein L22 [Candidatus Liberibacter asia
d2zjrp1127 Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 100.0
d1i4ja_110 Ribosomal protein L22 {Thermus aquaticus, subsp. Thermu 100.0
d1vqor1150 Ribosomal protein L22 {Archaeon Haloarcula marismortui 100.0
d2gycq1106 Ribosomal protein L22 {Escherichia coli [TaxId: 562]} 100.0
>d2zjrp1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein L22
superfamily: Ribosomal protein L22
family: Ribosomal protein L22
domain: Ribosomal protein L22
species: Deinococcus radiodurans [TaxId: 1299]
Probab=100.00  E-value=3e-43  Score=272.97  Aligned_cols=124  Identities=36%  Similarity=0.437  Sum_probs=116.3

Q ss_pred             CHHHHHHHHHHHEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHE
Q ss_conf             03576742101123112148750889999999984798699999888658202479999999999999984059982336
Q gi|254780256|r    4 KRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL   83 (131)
Q Consensus         4 ~~~~~~~~~~~~e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~L   83 (131)
                      ++...+.....+++.|+++|+|+||+|+++|+++|||++|+||+.||+|+|+++|.+|.|+|+||++||++++|+|+|+|
T Consensus         4 kk~~~~~~~~~~~~~A~~k~ir~Sp~K~r~v~~~IrG~~v~eAl~~L~f~~kkaa~~v~k~l~sA~aNA~~~~~~d~~~L   83 (127)
T d2zjrp1           4 KKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEMLEDRL   83 (127)
T ss_dssp             HHHHHHHCCCCCTTEEEEEEESSCHHHHHHHHHHSTTSBHHHHHHHHHHCCCTTHHHHHHHHTTTHHHHTTTTCCCGGGE
T ss_pred             HHHHHHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             67788766110414330063615889999999998699199999998648715566199999999999986046761045


Q ss_pred             EEEEEEECCCCEEEEEEECCCCCCCCEECCCCEEEEEEEECCCC
Q ss_conf             99999988981142010256666372017850089999851723
Q gi|254780256|r   84 IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE  127 (131)
Q Consensus        84 ~I~~~~v~~G~~~KR~~prarGRa~~i~k~~sHi~VvL~e~~~~  127 (131)
                      ||+++|||+||++|||+||||||+++|++|+|||+|+|+|.+++
T Consensus        84 ~I~~~~v~~G~~~KR~~prArGRa~~i~k~~sHi~VvL~e~~~k  127 (127)
T d2zjrp1          84 FVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAEKGNK  127 (127)
T ss_dssp             EEEEEEEEECCCEEEEEECSTTCEEEEEECCEEEEEEEEECCCC
T ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCC
T ss_conf             99899989998255779874788876348863489999746889



>d1i4ja_ d.55.1.1 (A:) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} Back     information, alignment and structure
>d1vqor1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2gycq1 d.55.1.1 (Q:5-110) Ribosomal protein L22 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 131 50S ribosomal protein L22 [Candidatus Liberibacter
2zjr_P_22-134113 (P:22-134) 50S ribosomal protein L22; ribosome, la 1e-25
3i1n_S_110 (S:) 50S ribosomal protein L22; ribosome structure 8e-24
3bbo_U_199 (U:) Ribosomal protein L22; large ribosomal subuni 1e-23
1i4j_A_110 (A:) 50S ribosomal protein L22; mutant, erythromyc 3e-23
2ftc_M_110 (M:) Mitochondrial ribosomal protein L22 isoform A 2e-22
1vq8_R_155 (R:) 50S ribosomal protein L22P; ribosome 50S, pro 8e-22
2zkr_r_184 (r:) 60S ribosomal protein L17; protein-RNA comple 3e-19
2wwb_I_184 (I:) 60S ribosomal protein L17-A; ribosome, protei 3e-19
>2zjr_P (P:22-134) 50S ribosomal protein L22; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 113 Back     alignment and structure
 Score =  109 bits (275), Expect = 1e-25
 Identities = 44/112 (39%), Positives = 61/112 (54%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
              A+A  +R+SP+K+ LV  +IRGK V DA   L F  +  +  V K L SA ANA +N
Sbjct: 2   PGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
            ++  DRL V EAYV     +KR   R R     I +  S +T+IV E  ++
Sbjct: 62  DEMLEDRLFVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAEKGNK 113


>3i1n_S (S:) 50S ribosomal protein L22; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_Q 1p86_Q 1vs8_S 2aw4_S 2awb_S 1vs6_S 2i2v_S 2j28_S 2i2t_S* 2qao_S* 2qba_S* 2qbc_S* 2qbe_S 2qbg_S 2qbi_S* 2qbk_S* 2qov_S 2qox_S 2qoz_S* 2qp1_S* ...Length = 110 Back     alignment and structure
>3bbo_U (U:) Ribosomal protein L22; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 199 Back     alignment and structure
>1i4j_A (A:) 50S ribosomal protein L22; mutant, erythromycin resistance, RNA binding, RNA binding protein; 1.80A {Thermus thermophilus}Length = 110 Back     alignment and structure
>2ftc_M (M:) Mitochondrial ribosomal protein L22 isoform A; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_MLength = 110 Back     alignment and structure
>1vq8_R (R:) 50S ribosomal protein L22P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 155 Back     alignment and structure
>2zkr_r (r:) 60S ribosomal protein L17; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 184 Back     alignment and structure
>2wwb_I (I:) 60S ribosomal protein L17-A; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_I 2ww9_I 1s1i_NLength = 184 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target131 50S ribosomal protein L22 [Candidatus Liberibacter asia
2ftc_M_110 Mitochondrial ribosomal protein L22 isoform A; mit 100.0
2zjr_P_22-134113 50S ribosomal protein L22; ribosome, large ribosom 100.0
3i1n_S_110 50S ribosomal protein L22; ribosome structure, pro 100.0
1i4j_A_110 50S ribosomal protein L22; mutant, erythromycin re 100.0
2zkr_r_184 60S ribosomal protein L17; protein-RNA complex, 60 100.0
1vq8_R_155 50S ribosomal protein L22P; ribosome 50S, protein- 100.0
3bbo_U_199 Ribosomal protein L22; large ribosomal subunit, sp 100.0
2wwb_I_184 60S ribosomal protein L17-A; ribosome, protein EXI 100.0
>2ftc_M (M:) Mitochondrial ribosomal protein L22 isoform A; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_M Back     alignment and structure
Probab=100.00  E-value=2.3e-39  Score=252.37  Aligned_cols=107  Identities=27%  Similarity=0.421  Sum_probs=103.7

Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC-HHHEEEEEEEECCCCEEEEE
Q ss_conf             14875088999999998479869999988865820247999999999999998405998-23369999998898114201
Q gi|254780256|r   21 ASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLD-VDRLIVSEAYVGKSVFMKRF   99 (131)
Q Consensus        21 ~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld-~~~L~I~~~~v~~G~~~KR~   99 (131)
                      .+++++||+|+++|+|+|||++|++|++||+|+|+|+|..|.|+|+||++||++|+++| +|+|||+++|||+|+++|||
T Consensus         3 ~r~ir~SpkK~r~v~~~IrG~~v~~Al~~L~~~~kkaA~~i~k~L~sA~aNA~~~~~~~~~~~L~I~~~~v~~G~~~KR~   82 (110)
T 2ftc_M            3 RRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRI   82 (110)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCCCCC
T ss_conf             57372687999999999869909999999851760148999999999999999832877665669999998988722376


Q ss_pred             EECCCCCCCCEECCCCEEEEEEEECCCC
Q ss_conf             0256666372017850089999851723
Q gi|254780256|r  100 HCRGRQRIGRIVRPFSRLTVIVREVSDE  127 (131)
Q Consensus       100 ~prarGRa~~i~k~~sHi~VvL~e~~~~  127 (131)
                      +||||||+++|+||+|||||+|+|.+++
T Consensus        83 ~~rarGR~~~i~k~~sHItvvL~Eg~~p  110 (110)
T 2ftc_M           83 RYHGRGRFGIMEKVYCHYFVKLVEGPPP  110 (110)
T ss_pred             CCCCCCCCCCCCCCEEEEEEEEEECCCC
T ss_conf             8663789887568804499999628998



>2zjr_P (P:22-134) 50S ribosomal protein L22; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
>3i1n_S (S:) 50S ribosomal protein L22; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_Q 1p86_Q 1vs8_S 2aw4_S 2awb_S 1vs6_S 2i2v_S 2j28_S 2i2t_S* 2qao_S* 2qba_S* 2qbc_S* 2qbe_S 2qbg_S 2qbi_S* 2qbk_S* 2qov_S 2qox_S 2qoz_S* 2qp1_S* ... Back     alignment and structure
>1i4j_A (A:) 50S ribosomal protein L22; mutant, erythromycin resistance, RNA binding, RNA binding protein; 1.80A {Thermus thermophilus} Back     alignment and structure
>2zkr_r (r:) 60S ribosomal protein L17; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1vq8_R (R:) 50S ribosomal protein L22P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>3bbo_U (U:) Ribosomal protein L22; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2wwb_I (I:) 60S ribosomal protein L17-A; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_I 2ww9_I 1s1i_N Back     alignment and structure