254780257

254780257

SSU ribosomal protein S19P

GeneID in NCBI database:8209238Locus tag:CLIBASIA_00710
Protein GI in NCBI database:254780257Protein Accession:YP_003064670.1
Gene range:-(140286, 140564)Protein Length:92aa
Gene description:SSU ribosomal protein S19P
COG prediction:[J] Ribosomal protein S19
KEGG prediction:rpsS; SSU ribosomal protein S19P; K02965 small subunit ribosomal protein S19
SEED prediction:SSU ribosomal protein S19p (S15e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK
ccccccccccccHHHHHHHHHHccccccccEEEEEcccEEcccccccEEEEEcccEEEEEEEcHHHHHHHHHcccccccccccccccccccc
cccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccccEEEEccccccEEEEEcHHccccccccccccccccccccccHHccc
marsvrkgpfvTKSLLKKVSQArdsggrgvvrvwcrncdimpqfigltfgvyngrkhvpvsvseemvgfklgdfaptrhcpghgsdkkakrk
marsvrkgpfvtksllkkvsqardsggrgvVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLgdfaptrhcpghgsdkkakrk
MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK
*ARSVRKGPFVTKSLLK**************RVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC************
********PFVTKSLLKK*********RGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC************
*****RKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCPGHG********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK
MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK
MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
31512281492 SSU ribosomal protein S19P [Candidatus Liberibacter sol 1 2e-38
9449848091 ribosomal protein S19 [Sphingomonas sp. SKA58] Length = 1 7e-30
11063402692 SSU ribosomal protein S19P [Mesorhizobium sp. BNC1] Len 1 1e-29
29401061792 ribosomal protein S19 [Sphingobium japonicum UT26S] Len 1 3e-29
32988913392 ribosomal protein S19 [Brevundimonas diminuta ATCC 1156 1 9e-29
1596511392 30S ribosomal protein S19 [Sinorhizobium meliloti 1021] 1 1e-28
25441977992 ribosomal protein S19 [Brevundimonas sp. BAL3] Length = 1 1e-28
14855990592 30S ribosomal protein S19 [Brucella ovis ATCC 25840] Le 1 1e-28
30731436392 ribosomal protein S19 [Sinorhizobium meliloti BL225C] L 1 2e-28
31989909592 30S ribosomal protein S19 [Bartonella clarridgeiae 73] 1 2e-28
>gi|315122814|ref|YP_004063303.1| SSU ribosomal protein S19P [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 92 Back     alignment and organism information
 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 85/92 (92%)

Query: 1  MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60
          MARS+ KGPFVTK LLKKVS+ARDSG R V+++WCRNCDIMPQFIGLTFGV+NGRKH+PV
Sbjct: 1  MARSIWKGPFVTKYLLKKVSKARDSGSRDVIKIWCRNCDIMPQFIGLTFGVHNGRKHIPV 60

Query: 61 SVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK 92
          +VSEEMVGFK GDF+PTR+ PGHGSDKK +R+
Sbjct: 61 TVSEEMVGFKFGDFSPTRYSPGHGSDKKVRRR 92


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|94498480|ref|ZP_01305036.1| ribosomal protein S19 [Sphingomonas sp. SKA58] Length = 91 Back     alignment and organism information
>gi|110634026|ref|YP_674234.1| SSU ribosomal protein S19P [Mesorhizobium sp. BNC1] Length = 92 Back     alignment and organism information
>gi|294010617|ref|YP_003544077.1| ribosomal protein S19 [Sphingobium japonicum UT26S] Length = 92 Back     alignment and organism information
>gi|329889133|ref|ZP_08267476.1| ribosomal protein S19 [Brevundimonas diminuta ATCC 11568] Length = 92 Back     alignment and organism information
>gi|15965113|ref|NP_385466.1| 30S ribosomal protein S19 [Sinorhizobium meliloti 1021] Length = 92 Back     alignment and organism information
>gi|254419779|ref|ZP_05033503.1| ribosomal protein S19 [Brevundimonas sp. BAL3] Length = 92 Back     alignment and organism information
>gi|148559905|ref|YP_001259149.1| 30S ribosomal protein S19 [Brucella ovis ATCC 25840] Length = 92 Back     alignment and organism information
>gi|307314363|ref|ZP_07593969.1| ribosomal protein S19 [Sinorhizobium meliloti BL225C] Length = 92 Back     alignment and organism information
>gi|319899095|ref|YP_004159188.1| 30S ribosomal protein S19 [Bartonella clarridgeiae 73] Length = 92 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
PRK0035792 PRK00357, rpsS, 30S ribosomal protein S19; Reviewed 2e-35
TIGR0105092 TIGR01050, rpsS_bact, ribosomal protein S19, bacterial/ 1e-27
CHL0005092 CHL00050, rps19, ribosomal protein S19 1e-25
pfam0020379 pfam00203, Ribosomal_S19, Ribosomal protein S19 2e-22
KOG089993 KOG0899, KOG0899, KOG0899, Mitochondrial/chloroplast ri 3e-19
PRK04038134 PRK04038, rps19p, 30S ribosomal protein S19P; Provision 2e-15
TIGR01025135 TIGR01025, rpsS_arch, ribosomal protein S19(archaeal)/S 3e-13
PTZ00096143 PTZ00096, PTZ00096, 40S ribosomal protein S15; Provisio 5e-10
KOG0898152 KOG0898, KOG0898, KOG0898, 40S ribosomal protein S15 [T 1e-08
PLN0314792 PLN03147, PLN03147, ribosomal protein S19; Provisional 6e-07
COG018593 COG0185, RpsS, Ribosomal protein S19 [Translation, ribo 5e-29
>gnl|CDD|178985 PRK00357, rpsS, 30S ribosomal protein S19; Reviewed Back     alignment and domain information
>gnl|CDD|130122 TIGR01050, rpsS_bact, ribosomal protein S19, bacterial/organelle Back     alignment and domain information
>gnl|CDD|176991 CHL00050, rps19, ribosomal protein S19 Back     alignment and domain information
>gnl|CDD|143960 pfam00203, Ribosomal_S19, Ribosomal protein S19 Back     alignment and domain information
>gnl|CDD|36117 KOG0899, KOG0899, KOG0899, Mitochondrial/chloroplast ribosomal protein S19 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179723 PRK04038, rps19p, 30S ribosomal protein S19P; Provisional Back     alignment and domain information
>gnl|CDD|130097 TIGR01025, rpsS_arch, ribosomal protein S19(archaeal)/S15(eukaryotic) Back     alignment and domain information
>gnl|CDD|185442 PTZ00096, PTZ00096, 40S ribosomal protein S15; Provisional Back     alignment and domain information
>gnl|CDD|36116 KOG0898, KOG0898, KOG0898, 40S ribosomal protein S15 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178692 PLN03147, PLN03147, ribosomal protein S19; Provisional Back     alignment and domain information
>gnl|CDD|30534 COG0185, RpsS, Ribosomal protein S19 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
TIGR0105092 rpsS_bact ribosomal protein S19; InterPro: IPR005732 Ri 100.0
PRK0035792 rpsS 30S ribosomal protein S19; Reviewed 100.0
COG018593 RpsS Ribosomal protein S19 [Translation, ribosomal stru 100.0
CHL0005092 rps19 ribosomal protein S19 100.0
pfam0020379 Ribosomal_S19 Ribosomal protein S19. 100.0
KOG089993 consensus 100.0
PTZ00096144 40S ribosomal protein S15; Provisional 99.97
PRK04038134 rps19p 30S ribosomal protein S19P; Provisional 99.97
TIGR01025136 rpsS_arch ribosomal protein S19; InterPro: IPR005713 Ri 99.97
KOG0898152 consensus 99.94
>TIGR01050 rpsS_bact ribosomal protein S19; InterPro: IPR005732 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00357 rpsS 30S ribosomal protein S19; Reviewed Back     alignment and domain information
>COG0185 RpsS Ribosomal protein S19 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00050 rps19 ribosomal protein S19 Back     alignment and domain information
>pfam00203 Ribosomal_S19 Ribosomal protein S19 Back     alignment and domain information
>KOG0899 consensus Back     alignment and domain information
>PTZ00096 40S ribosomal protein S15; Provisional Back     alignment and domain information
>PRK04038 rps19p 30S ribosomal protein S19P; Provisional Back     alignment and domain information
>TIGR01025 rpsS_arch ribosomal protein S19; InterPro: IPR005713 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0898 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
2gy9_S87 Structure Of The 30s Subunit Of A Pre-Translocation 1e-31
1vs5_S92 Crystal Structure Of The Bacterial Ribosome From Es 2e-30
1fka_S93 Structure Of Functionally Activated Small Ribosomal 2e-30
1p6g_S91 Real Space Refined Coordinates Of The 30s Subunit F 1e-29
1qkf_A92 Solution Structure Of The Ribosomal Protein S19 Fro 1e-29
3bbn_S92 Homology Model For The Spinach Chloroplast 30s Subu 1e-28
3fih_S79 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 6e-28
1pns_S80 Crystal Structure Of A Streptomycin Dependent Ribos 1e-27
3fic_S79 T. Thermophilus 70s Ribosome In Complex With Mrna, 6e-27
3mr8_S78 Recognition Of The Amber Stop Codon By Release Fact 2e-26
3iz6_R154 Localization Of The Small Subunit Ribosomal Protein 4e-18
2zkq_s145 Structure Of A Mammalian Ribosomal 40s Subunit With 1e-17
3izb_R142 Localization Of The Small Subunit Ribosomal Protein 2e-15
1s1h_S80 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 3e-14
2xzm_S144 Crystal Structure Of The Eukaryotic 40s Ribosomal S 1e-10
3jyv_S71 Structure Of The 40s Rrna And Proteins And PE TRNA 1e-09
>gi|116667428|pdb|2GY9|S Chain S, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 87 Back     alignment and structure
 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 62/87 (71%)

Query: 2  ARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVS 61
           RS++KGPF+   LLKKV +A +SG +  +R W R   I P  IGLT  V+NGR+HVPV 
Sbjct: 1  PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVF 60

Query: 62 VSEEMVGFKLGDFAPTRHCPGHGSDKK 88
          V++EMVG KLG+FAPTR   GH +DKK
Sbjct: 61 VTDEMVGHKLGEFAPTRTYRGHAADKK 87


gi|116666566|pdb|1VS5|S Chain S, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 92 Back     alignment and structure
gi|10120582|pdb|1FKA|S Chain S, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution Length = 93 Back     alignment and structure
>gi|33357896|pdb|1P6G|S Chain S, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 91 Back     alignment and structure
>gi|5822309|pdb|1QKF|A Chain A, Solution Structure Of The Ribosomal Protein S19 From Thermus Thermophilus Length = 92 Back     alignment and structure
gi|188036220|pdb|3BBN|S Chain S, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. Length = 92 Back     alignment and structure
>gi|224510720|pdb|3FIH|S Chain S, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 79 Back     alignment and structure
>gi|34811547|pdb|1PNS|S Chain S, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 80 Back     alignment and structure
>gi|224510703|pdb|3FIC|S Chain S, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 79 Back     alignment and structure
>gi|300508623|pdb|3MR8|S Chain S, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mr8 Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 3ms1. Molecule B In The Same Asymmetric Unit Is Deposited As 3mrz (50s) And 3ms0 (30s). Length = 78 Back     alignment and structure
gi|313103643|pdb|3IZ6|R Chain R, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 154 Back     alignment and structure
gi|187609270|pdb|2ZKQ|SS Chain s, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 145 Back     alignment and structure
gi|313103681|pdb|3IZB|R Chain R, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 142 Back     alignment and structure
>gi|49258836|pdb|1S1H|S Chain S, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 80 Back     alignment and structure
gi|319443374|pdb|2XZM|S Chain S, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 144 Back     alignment and structure
>gi|281500822|pdb|3JYV|S Chain S, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 71 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
3a1p_B93 30S ribosomal protein S19; RIMM N-terminal domain, PRC- 3e-31
2vqe_S93 30S ribosomal protein S19; tRNA-binding, rRNA-binding, 9e-31
3i1m_S92 30S ribosomal protein S19; ribosome structure, protein- 3e-30
3bbn_S92 Ribosomal protein S19; small ribosomal subunit, spinach 5e-29
3ofo_S79 30S ribosomal protein S19; protein biosynthesis, riboso 3e-26
2zkq_s145 40S ribosomal protein S15E; protein-RNA complex, 40S ri 2e-19
1s1h_S80 40S ribosomal protein S15; 80S ribosome, 40S ribosomal 2e-18
3jyv_S71 40S ribosomal protein S15; eukaryotic ribosome, RACK1 p 2e-16
>3a1p_B 30S ribosomal protein S19; RIMM N-terminal domain, PRC-barrel domain, beta barrels, ribosome, 30S ribosomal subunit, ribosome biogenesis; 2.30A {Thermus thermophilus} PDB: 1fka_S 1gix_V* 1hnw_S* 1hnx_S* 1hnz_S* 1hr0_S 1ibk_S* 1ibl_S* 1ibm_S 1jgo_V* 1jgp_V* 1jgq_V* 1ml5_V* 1xmo_S* 1xmq_S* 1xnq_S* 1xnr_S* 1yl4_V 2b64_S* 2b9m_S* ... Length = 93 Back     alignment and structure
 Score =  128 bits (323), Expect = 3e-31
 Identities = 44/92 (47%), Positives = 62/92 (67%)

Query: 1  MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60
          M RS++KG FV   LL+KV +    G + +++ W R   I+P+ +G T  VYNG++HVPV
Sbjct: 1  MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPV 60

Query: 61 SVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK 92
           ++E MVG KLG+FAPTR   GHG + KA +K
Sbjct: 61 YITENMVGHKLGEFAPTRTYRGHGKEAKATKK 92


>2vqe_S 30S ribosomal protein S19; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: i.1.1.1 PDB: 1fka_S 1gix_V* 1hnw_S* 1hnx_S* 1hnz_S* 1hr0_S 1ibk_S* 1ibl_S* 1ibm_S 1jgo_V* 1jgp_V* 1jgq_V* 1ml5_V* 1xmo_S* 1xmq_S* 1xnq_S* 1xnr_S* 1yl4_V 2b64_S* 2b9m_S* ... Length = 93 Back     alignment and structure
>3i1m_S 30S ribosomal protein S19; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_S* 3e1a_L 3e1c_L 1vs5_S 3i1o_S 3i1q_S 3i1s_S 3i1z_S 3i21_S 2qal_S* 1p6g_S 1p87_S 2aw7_S 2avy_S 2i2u_S 2i2p_S* 2qan_S* 2qb9_S* 2qbb_S* 2qbd_S ... Length = 92 Back     alignment and structure
>3bbn_S Ribosomal protein S19; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 92 Back     alignment and structure
>3ofo_S 30S ribosomal protein S19; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_S* 2wwl_S 3ofp_S 2gy9_S 2gyb_S Length = 79 Back     alignment and structure
>2zkq_s 40S ribosomal protein S15E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 145 Back     alignment and structure
>1s1h_S 40S ribosomal protein S15; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} SCOP: i.1.1.1 Length = 80 Back     alignment and structure
>3jyv_S 40S ribosomal protein S15; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} Length = 71 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
3bbn_S92 Ribosomal protein S19; small ribosomal subunit, spinach 100.0
3i1m_S92 30S ribosomal protein S19; ribosome structure, protein- 100.0
3a1p_B93 30S ribosomal protein S19; RIMM N-terminal domain, PRC- 100.0
3ofo_S79 30S ribosomal protein S19; protein biosynthesis, riboso 100.0
2zkq_s145 40S ribosomal protein S15E; protein-RNA complex, 40S ri 99.97
1s1h_S80 40S ribosomal protein S15; 80S ribosome, 40S ribosomal 99.97
3jyv_S71 40S ribosomal protein S15; eukaryotic ribosome, RACK1 p 99.9
>3bbn_S Ribosomal protein S19; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
Probab=100.00  E-value=1.9e-43  Score=268.50  Aligned_cols=92  Identities=38%  Similarity=0.809  Sum_probs=88.3

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             97787767562589999999862168983598750374781022264899970862689998525110101253364363
Q gi|254780257|r    1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC   80 (92)
Q Consensus         1 MsRS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~   80 (92)
                      ||||+|||||++++|+++++++++.+.+++|+||||+|+|+|+|||++|+||||++|++|+|+|||||||||||||||++
T Consensus         1 MsRS~~Kgpfv~~~Llkki~~~~~~~~~~~IkT~sR~s~IlP~~VG~~~~VyNGk~fv~v~It~eMVGhklGEFa~TRk~   80 (92)
T 3bbn_S            1 MTRSLKKNPFVANHLLRKIEKLNKKAEKEIIVTWSRASTIIPTMIGHTIAIHNGREHLPIYITDRMVGHKLGEFAPTLNF   80 (92)
T ss_dssp             CCCSCSSCCCCCHHHHHHHHTTTTTTCCCCEEECCCSCCCCTTCTTCCEEEECSSCEEEECCCSSCSSCCSTTTSCSSCC
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCEECHHHCCCEEEEECCCEEEEEEECCCCCCEEEEEECCCCCC
T ss_conf             98655548150689999999876126997668866788887335254898755862677996568223465610257256


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             576666531259
Q gi|254780257|r   81 PGHGSDKKAKRK   92 (92)
Q Consensus        81 ~~H~~~kk~k~k   92 (92)
                      ++|++++++.++
T Consensus        81 ~~H~~~~kk~~r   92 (92)
T 3bbn_S           81 RGHAKNDNKSRR   92 (92)
T ss_dssp             SSSCCCCCCCCC
T ss_pred             CCCCCCCCCCCC
T ss_conf             564789865679



>3i1m_S 30S ribosomal protein S19; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_S* 3e1a_L 3e1c_L 1vs5_S 3i1o_S 3i1q_S 3i1s_S 3i1z_S 3i21_S 3kc4_S 2qal_S* 1p6g_S 1p87_S 2aw7_S 2avy_S 2i2u_S 2i2p_S* 2qan_S* 2qb9_S* 2qbb_S* ... Back     alignment and structure
>3a1p_B 30S ribosomal protein S19; RIMM N-terminal domain, PRC-barrel domain, beta barrels, ribosome, 30S ribosomal subunit, ribosome biogenesis; 2.30A {Thermus thermophilus} PDB: 1fka_S 1gix_V* 1hnw_S* 1hnx_S* 1hnz_S* 1hr0_S 1ibk_S* 1ibl_S* 1ibm_S 1jgo_V* 1jgp_V* 1jgq_V* 1ml5_V* 1xmo_S* 1xmq_S* 1xnq_S* 1xnr_S* 1yl4_V 2b64_S* 2b9m_S* ... Back     alignment and structure
>3ofo_S 30S ribosomal protein S19; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_S* 2wwl_S 3ofp_S 2gy9_S 2gyb_S Back     alignment and structure
>2zkq_s 40S ribosomal protein S15E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1s1h_S 40S ribosomal protein S15; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} SCOP: i.1.1.1 Back     alignment and structure
>3jyv_S 40S ribosomal protein S15; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
d2uubs180 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermo 4e-26
d2gy9s179 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia co 2e-25
>d2uubs1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} Length = 80 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S19
superfamily: Ribosomal protein S19
family: Ribosomal protein S19
domain: Ribosomal protein S19
species: Thermus thermophilus [TaxId: 274]
 Score =  110 bits (276), Expect = 4e-26
 Identities = 37/76 (48%), Positives = 53/76 (69%)

Query: 3  RSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSV 62
          RS++KG FV   LL+KV +    G + +++ W R   I+P+ +G T  VYNG++HVPV +
Sbjct: 2  RSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYI 61

Query: 63 SEEMVGFKLGDFAPTR 78
          +E MVG KLG+FAPTR
Sbjct: 62 TENMVGHKLGEFAPTR 77


>d2gy9s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} Length = 79 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
d2uubs180 Ribosomal protein S19 {Thermus thermophilus [TaxId: 274 100.0
d2gy9s179 Ribosomal protein S19 {Escherichia coli [TaxId: 562]} 100.0
>d2uubs1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S19
superfamily: Ribosomal protein S19
family: Ribosomal protein S19
domain: Ribosomal protein S19
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=4.7e-38  Score=236.28  Aligned_cols=80  Identities=46%  Similarity=0.892  Sum_probs=77.7

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             77877675625899999998621689835987503747810222648999708626899985251101012533643635
Q gi|254780257|r    2 ARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCP   81 (92)
Q Consensus         2 sRS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~~   81 (92)
                      .||+|||||++++|++++.+++..+.+++|+||||+|+|+|+|||++|+|||||+|++|+|+||||||||||||+||+|.
T Consensus         1 ~RS~~Kgpfv~~~Llkki~~~~~~~~k~~IkT~sR~s~IlP~~VG~~~~VyNGk~fv~v~It~eMVGhklGEFa~TR~fr   80 (80)
T d2uubs1           1 PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYR   80 (80)
T ss_dssp             CCCCCSSCCCCHHHHHHHHTTTSSCCCSEEEECCSSSBCCGGGTTCEEEEECSSCEEEEECCGGGTTSBSGGGSCCCCCC
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCEECHHHCCEEEEEEECCEEEEEEECCCCCCCEEECCCCCCCCC
T ss_conf             98765584703899999999770388875768516668066781649999738736768844471350000455513279



>d2gy9s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 92 SSU ribosomal protein S19P [Candidatus Liberibacte
3i1m_S_92 (S:) 30S ribosomal protein S19; ribosome structure 3e-28
2zkq_s_145 (s:) 40S ribosomal protein S15E; protein-RNA compl 4e-24
1s1h_S_80 (S:) 40S ribosomal protein S15; 80S ribosome, 40S 5e-21
3bbn_S_26-9267 (S:26-92) Ribosomal protein S19; small ribosomal s 4e-20
2vqe_S_27-9367 (S:27-93) 30S ribosomal protein S19; tRNA-binding, 5e-20
3jyv_S_71 (S:) 40S ribosomal protein S15; eukaryotic ribosom 7e-19
>3i1m_S (S:) 30S ribosomal protein S19; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_S* 3e1a_L 3e1c_L 1vs5_S 3i1o_S 3i1q_S 3i1s_S 3i1z_S 3i21_S 2qal_S* 1p6g_S 1p87_S 2aw7_S 2avy_S 2i2u_S 2i2p_S* 2qan_S* 2qb9_S* 2qbb_S* 2qbd_S ...Length = 92 Back     alignment and structure
 Score =  118 bits (297), Expect = 3e-28
 Identities = 53/92 (57%), Positives = 67/92 (72%)

Query: 1  MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60
          M RS++KGPF+   LLKKV +A +SG +  +R W R   I P  IGLT  V+NGR+HVPV
Sbjct: 1  MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPV 60

Query: 61 SVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK 92
           V++EMVG KLG+FAPTR   GH +DKKAK+K
Sbjct: 61 FVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK 92


>2zkq_s (s:) 40S ribosomal protein S15E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 145 Back     alignment and structure
>1s1h_S (S:) 40S ribosomal protein S15; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae}Length = 80 Back     alignment and structure
>3bbn_S (S:26-92) Ribosomal protein S19; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 67 Back     alignment and structure
>2vqe_S (S:27-93) 30S ribosomal protein S19; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 67 Back     alignment and structure
>3jyv_S (S:) 40S ribosomal protein S15; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus}Length = 71 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target92 SSU ribosomal protein S19P [Candidatus Liberibacter asi
3i1m_S_92 30S ribosomal protein S19; ribosome structure, pro 100.0
2zkq_s_145 40S ribosomal protein S15E; protein-RNA complex, 4 100.0
1s1h_S_80 40S ribosomal protein S15; 80S ribosome, 40S ribos 100.0
3bbn_S_26-9267 Ribosomal protein S19; small ribosomal subunit, sp 99.96
3jyv_S_71 40S ribosomal protein S15; eukaryotic ribosome, RA 99.96
2vqe_S_27-9367 30S ribosomal protein S19; tRNA-binding, rRNA-bind 99.96
>3i1m_S (S:) 30S ribosomal protein S19; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_S* 3e1a_L 3e1c_L 1vs5_S 3i1o_S 3i1q_S 3i1s_S 3i1z_S 3i21_S 2qal_S* 1p6g_S 1p87_S 2aw7_S 2avy_S 2i2u_S 2i2p_S* 2qan_S* 2qb9_S* 2qbb_S* 2qbd_S ... Back     alignment and structure
Probab=100.00  E-value=6.9e-42  Score=260.47  Aligned_cols=92  Identities=58%  Similarity=0.974  Sum_probs=89.1

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             97787767562589999999862168983598750374781022264899970862689998525110101253364363
Q gi|254780257|r    1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC   80 (92)
Q Consensus         1 MsRS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~   80 (92)
                      |+||+|||||++.+|+++++++++.+.+++|+||||+|+|+|+|||++|+|||||+|++|+|+||||||||||||+||++
T Consensus         1 M~RS~~Kgp~v~~~ll~k~~k~~~~~~~~~ikT~sR~s~IlP~~VG~ti~VyNGk~fv~v~It~~MVGhklGEFa~Trk~   80 (92)
T 3i1m_S            1 MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTY   80 (92)
T ss_dssp             --CCCCSSCCCCHHHHHHHHHHHHTCCCSCCEECCTTCBCCGGGSSCCCEEECSSSEEECCCCTTCCSSBGGGSSCCCCC
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHCCEEEEECCCCEEEEEECCCCCCEEEECCCCCCCC
T ss_conf             99766658574689999999977137898678850431037987424898865973477886757325022034562366


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             576666531259
Q gi|254780257|r   81 PGHGSDKKAKRK   92 (92)
Q Consensus        81 ~~H~~~kk~k~k   92 (92)
                      +.|+++++++++
T Consensus        81 ~~h~~~~~~a~r   92 (92)
T 3i1m_S           81 RGHAADKKAKKK   92 (92)
T ss_dssp             C-----------
T ss_pred             CCCCCCCCCCCC
T ss_conf             566887644579



>2zkq_s (s:) 40S ribosomal protein S15E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1s1h_S (S:) 40S ribosomal protein S15; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bbn_S (S:26-92) Ribosomal protein S19; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3jyv_S (S:) 40S ribosomal protein S15; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>2vqe_S (S:27-93) 30S ribosomal protein S19; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure