254780259

254780259

50S ribosomal protein L23

GeneID in NCBI database:8209240Locus tag:CLIBASIA_00720
Protein GI in NCBI database:254780259Protein Accession:YP_003064672.1
Gene range:-(141442, 141774)Protein Length:110aa
Gene description:50S ribosomal protein L23
COG prediction:[J] Ribosomal protein L23
KEGG prediction:rplW; 50S ribosomal protein L23; K02892 large subunit ribosomal protein L23
SEED prediction:LSU ribosomal protein L23p (L23Ae)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAGV
cccHHHHHHHHcccccHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEEEccccEEEEEcccccccccccccccccccccEEEEEEEcccccEEEEEccc
cccHHHHHHEEcccccHHHHHHHcccEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEEcccEEEccccccccHHHHHcccccccccccEEEEEEEcccccEEEEccc
minirfydtiispviaekstllaGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGysidisagv
minirfydTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEAlfsvkvvsvntlirkgkvkrlsrisaarsrvrssrdmyvsrkdvkrafvtlakgysidisagv
MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLsrisaarsrvrssrDMYVSRKDVKRAFVTLAKGYSIDISAGV
****RFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRS*RDMYVSRKDVKRAFVTLAKGYSIDISAGV
MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRL****************YVSRKDVKRAFVTLAKGYSIDISAGV
MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAGV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAGV
MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAGV
MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAGV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target110 50S ribosomal protein L23 [Candidatus Liberibacter asia
315122816110 50S ribosomal protein L23 [Candidatus Liberibacter sola 1 2e-45
16376080197 putative 50S ribosomal protein L23 [Hoeflea phototrophi 1 4e-25
22782175897 50S ribosomal protein L23 [Sinorhizobium fredii NGR234] 1 5e-25
1596511197 50S ribosomal protein L23 [Sinorhizobium meliloti 1021] 1 7e-25
32529333497 50S ribosomal protein L23 [Agrobacterium sp. H13-3] Len 1 2e-24
1588924097 50S ribosomal protein L23 [Agrobacterium tumefaciens st 1 3e-24
8635730797 50S ribosomal protein L23 [Rhizobium etli CFN 42] Lengt 1 6e-24
22208567797 50S ribosomal protein L23 [Agrobacterium radiobacter K8 1 7e-24
1347055397 50S ribosomal protein L23 [Mesorhizobium loti MAFF30309 1 8e-24
16384349797 50S ribosomal protein L23 [Brucella suis ATCC 23445] Le 1 1e-23
>gi|315122816|ref|YP_004063305.1| 50S ribosomal protein L23 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 110 Back     alignment and organism information
 Score =  184 bits (468), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/110 (82%), Positives = 103/110 (93%)

Query: 1   MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLI 60
           M NIRFYDTIISPVIAEKSTLL+ QN+VVFNVKKDSSKS+IK AVE+LF+VKVVSVNTLI
Sbjct: 1   MTNIRFYDTIISPVIAEKSTLLSEQNKVVFNVKKDSSKSDIKHAVESLFNVKVVSVNTLI 60

Query: 61  RKGKVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAGV 110
           RKGK KRL+RIS AR+R RSSRD+YVSRKD+KRAFVTLAKG+SID+S G+
Sbjct: 61  RKGKTKRLNRISTARNRARSSRDLYVSRKDIKRAFVTLAKGHSIDVSVGI 110


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163760801|ref|ZP_02167880.1| putative 50S ribosomal protein L23 [Hoeflea phototrophica DFL-43] Length = 97 Back     alignment and organism information
>gi|227821758|ref|YP_002825728.1| 50S ribosomal protein L23 [Sinorhizobium fredii NGR234] Length = 97 Back     alignment and organism information
>gi|15965111|ref|NP_385464.1| 50S ribosomal protein L23 [Sinorhizobium meliloti 1021] Length = 97 Back     alignment and organism information
>gi|325293334|ref|YP_004279198.1| 50S ribosomal protein L23 [Agrobacterium sp. H13-3] Length = 97 Back     alignment and organism information
>gi|15889240|ref|NP_354921.1| 50S ribosomal protein L23 [Agrobacterium tumefaciens str. C58] Length = 97 Back     alignment and organism information
>gi|86357307|ref|YP_469199.1| 50S ribosomal protein L23 [Rhizobium etli CFN 42] Length = 97 Back     alignment and organism information
>gi|222085677|ref|YP_002544207.1| 50S ribosomal protein L23 [Agrobacterium radiobacter K84] Length = 97 Back     alignment and organism information
>gi|13470553|ref|NP_102122.1| 50S ribosomal protein L23 [Mesorhizobium loti MAFF303099] Length = 97 Back     alignment and organism information
>gi|163843497|ref|YP_001627901.1| 50S ribosomal protein L23 [Brucella suis ATCC 23445] Length = 97 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target110 50S ribosomal protein L23 [Candidatus Liberibacter asia
PRK0573892 PRK05738, rplW, 50S ribosomal protein L23; Reviewed 2e-24
CHL0003093 CHL00030, rpl23, ribosomal protein L23 9e-16
pfam0027690 pfam00276, Ribosomal_L23, Ribosomal protein L23 6e-13
PRK12280158 PRK12280, rplW, 50S ribosomal protein L23; Reviewed 3e-12
COG008994 COG0089, RplW, Ribosomal protein L23 [Translation, ribo 4e-17
PRK1454884 PRK14548, PRK14548, 50S ribosomal protein L23P; Provisi 1e-10
TIGR0363677 TIGR03636, L23_arch, archaeal ribosomal protein L23 2e-08
PTZ00191145 PTZ00191, PTZ00191, 60S ribosomal protein L23a; Provisi 1e-06
KOG1751157 KOG1751, KOG1751, KOG1751, 60s ribosomal protein L23 [T 0.002
>gnl|CDD|180228 PRK05738, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|176971 CHL00030, rpl23, ribosomal protein L23 Back     alignment and domain information
>gnl|CDD|144021 pfam00276, Ribosomal_L23, Ribosomal protein L23 Back     alignment and domain information
>gnl|CDD|183398 PRK12280, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|30438 COG0089, RplW, Ribosomal protein L23 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|184736 PRK14548, PRK14548, 50S ribosomal protein L23P; Provisional Back     alignment and domain information
>gnl|CDD|132675 TIGR03636, L23_arch, archaeal ribosomal protein L23 Back     alignment and domain information
>gnl|CDD|185507 PTZ00191, PTZ00191, 60S ribosomal protein L23a; Provisional Back     alignment and domain information
>gnl|CDD|36962 KOG1751, KOG1751, KOG1751, 60s ribosomal protein L23 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 110 50S ribosomal protein L23 [Candidatus Liberibacter asia
PRK12280160 rplW 50S ribosomal protein L23; Reviewed 100.0
CHL0003092 rpl23 ribosomal protein L23 100.0
pfam0027690 Ribosomal_L23 Ribosomal protein L23. 100.0
PRK0573891 rplW 50S ribosomal protein L23; Reviewed 99.98
COG008994 RplW Ribosomal protein L23 [Translation, ribosomal stru 99.97
PTZ00191150 60S ribosomal protein L23a; Provisional 99.87
TIGR0363677 L23_arch archaeal ribosomal protein L23. This model des 99.86
KOG1751157 consensus 99.67
KOG4089165 consensus 97.99
>PRK12280 rplW 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>CHL00030 rpl23 ribosomal protein L23 Back     alignment and domain information
>pfam00276 Ribosomal_L23 Ribosomal protein L23 Back     alignment and domain information
>PRK05738 rplW 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>COG0089 RplW Ribosomal protein L23 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00191 60S ribosomal protein L23a; Provisional Back     alignment and domain information
>TIGR03636 L23_arch archaeal ribosomal protein L23 Back     alignment and domain information
>KOG1751 consensus Back     alignment and domain information
>KOG4089 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target110 50S ribosomal protein L23 [Candidatus Liberibacter asia
1nkw_R95 Crystal Structure Of The Large Ribosomal Subunit Fr 3e-22
1nwx_R94 Complex Of The Large Ribosomal Subunit From Deinoco 7e-22
1pnu_R93 Crystal Structure Of A Streptomycin Dependent Ribos 9e-22
3fin_X93 T. Thermophilus 70s Ribosome In Complex With Mrna, 6e-20
3pyo_T92 Crystal Structure Of A Complex Containing Domain 3 1e-19
1n88_A96 Nmr Structure Of The Ribosomal Protein L23 From The 3e-19
1p85_R100 Real Space Refined Coordinates Of The 50s Subunit F 3e-19
2j28_T99 Model Of E. Coli Srp Bound To 70s Rncs Length = 99 4e-19
2gya_R92 Structure Of The 50s Subunit Of A Pre-Translocation 2e-18
3fik_T93 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 2e-16
2zkr_s156 Structure Of A Mammalian Ribosomal 60s Subunit With 1e-11
1ffk_P84 Crystal Structure Of The Large Ribosomal Subunit Fr 5e-09
1s72_S85 Refined Crystal Structure Of The Haloarcula Marismo 6e-09
3g4s_S81 Co-Crystal Structure Of Tiamulin Bound To The Large 7e-09
2ww9_K142 Cryo-Em Structure Of The Active Yeast Ssh1 Complex 2e-08
3bbo_V198 Homology Model For The Spinach Chloroplast 50s Subu 5e-08
1s1i_T83 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 3e-07
3jyw_T80 Structure Of The 60s Proteins For Eukaryotic Riboso 4e-07
2go5_4152 Structure Of Signal Recognition Particle Receptor ( 0.002
3izr_X152 Localization Of The Large Subunit Ribosomal Protein 0.003
gi|28948937|pdb|1NKW|R Chain R, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 95 Back     alignment and structure
 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 13/106 (12%)

Query: 4   IRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKG 63
           +  YD + +PVI+EK+     +    F V   ++K+EIK A++  F V+V+ ++T+   G
Sbjct: 1   MSHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPG 60

Query: 64  KVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAG 109
           K KR+ R                 R D K+A V LA+G SI+  AG
Sbjct: 61  KRKRVGRFIG-------------QRNDRKKAIVRLAEGQSIEALAG 93


>gi|29726805|pdb|1NWX|R Chain R, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 Length = 94 Back     alignment and structure
>gi|34811571|pdb|1PNU|R Chain R, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 93 Back     alignment and structure
>gi|224510799|pdb|3FIN|X Chain X, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 93 Back     alignment and structure
>gi|322812591|pdb|3PYO|T Chain T, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 92 Back     alignment and structure
gi|33357420|pdb|1N88|A Chain A, Nmr Structure Of The Ribosomal Protein L23 From Thermus Thermophilus. Length = 96 Back     alignment and structure
gi|33357918|pdb|1P85|R Chain R, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 100 Back     alignment and structure
>gi|119390364|pdb|2J28|T Chain T, Model Of E. Coli Srp Bound To 70s Rncs Length = 99 Back     alignment and structure
>gi|116667451|pdb|2GYA|R Chain R, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 92 Back     alignment and structure
>gi|224510749|pdb|3FIK|T Chain T, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 50s Subunit. Length = 93 Back     alignment and structure
gi|187609318|pdb|2ZKR|SS Chain s, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 156 Back     alignment and structure
>gi|10120935|pdb|1FFK|P Chain P, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 84 Back     alignment and structure
gi|50513488|pdb|1S72|S Chain S, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 85 Back     alignment and structure
>gi|228312160|pdb|3G4S|S Chain S, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 81 Back     alignment and structure
gi|270346348|pdb|2WW9|K Chain K, Cryo-Em Structure Of The Active Yeast Ssh1 Complex Bound To The Yeast 80s Ribosome Length = 142 Back     alignment and structure
gi|189096144|pdb|3BBO|V Chain V, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 198 Back     alignment and structure
>gi|49258858|pdb|1S1I|T Chain T, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 83 Back     alignment and structure
>gi|281500850|pdb|3JYW|T Chain T, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 80 Back     alignment and structure
>gi|110590379|pdb|2GO5|4 Chain 4, Structure Of Signal Recognition Particle Receptor (Sr) In Complex With Signal Recognition Particle (Srp) And Ribosome Nascent Chain Complex Length = 152 Back     alignment and structure
>gi|315113262|pdb|3IZR|X Chain X, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 152 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target110 50S ribosomal protein L23 [Candidatus Liberibacter asia
2zjr_Q95 50S ribosomal protein L23; ribosome, large ribosomal su 3e-21
3fin_X93 50S ribosomal protein L23; ribonucleoprotein, metal-bin 1e-20
3i1n_T100 50S ribosomal protein L23; ribosome structure, protein- 2e-20
3ofq_T93 50S ribosomal protein L23; protein biosynthesis, riboso 2e-20
3bbo_V198 Ribosomal protein L23; large ribosomal subunit, spinach 7e-17
2wwb_K142 60S ribosomal protein L25; ribosome, protein EXIT tunne 3e-13
2zkr_s156 60S ribosomal protein L23A; protein-RNA complex, 60S ri 1e-11
2go5_4152 Ribosomal protein L23; SR, SRP, ribosome, translation/R 4e-11
1vq8_S85 50S ribosomal protein L23P; ribosome 50S, protein-prote 3e-13
>2zjr_Q 50S ribosomal protein L23; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.12.1.1 PDB: 1sm1_R* 2aar_R 2d3o_R 2zjp_Q* 2zjq_Q 1nkw_R 3cf5_Q* 3dll_Q* 1nwy_R* 1nwx_R* 1xbp_R* 1pnu_R 1pny_R 1vor_U 1vou_U 1vow_U 1voy_U 1vp0_U Length = 95 Back     alignment and structure
 Score = 95.5 bits (238), Expect = 3e-21
 Identities = 35/103 (33%), Positives = 54/103 (52%), Gaps = 13/103 (12%)

Query: 7   YDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVK 66
           YD + +PVI+EK+     +    F V   ++K+EIK A++  F V+V+ ++T+   GK K
Sbjct: 4   YDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRK 63

Query: 67  RLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAG 109
           R+ R                 R D K+A V LA+G SI+  AG
Sbjct: 64  RVGRF-------------IGQRNDRKKAIVRLAEGQSIEALAG 93


>3fin_X 50S ribosomal protein L23; ribonucleoprotein, metal-binding, RNA- binding, rRNA-binding, zinc, tRNA-binding, repressor; 6.40A {Thermus thermophilus} PDB: 1n88_A 1vsa_R 1vsp_R 2hgj_W 2hgq_W 2hgu_W 2j01_X 2j03_X 2jl6_X 2jl8_X 2v47_X 2v49_X 2wdi_X 2wdj_X 2wdl_X 2wdn_X 2wh2_X 2wh4_X 3d5b_X 3d5d_X ... Length = 93 Back     alignment and structure
>3i1n_T 50S ribosomal protein L23; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_R 1p86_R 1vs8_T 2aw4_T 2awb_T 1vs6_T 2i2v_T 2i2t_T* 2qao_T* 2qba_T* 2qbc_T* 2qbe_T 2qbg_T 2qbi_T* 2qbk_T* 2qov_T 2qox_T 2qoz_T* 2qp1_T* 2rdo_T ... Length = 100 Back     alignment and structure
>3ofq_T 50S ribosomal protein L23; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 3fik_T 2wwq_T 3ofr_T* 2j28_T 3e1b_M 3e1d_M 3iy9_T 3i1n_T 1p85_R 1p86_R 1vs8_T 1vs6_T 2aw4_T 2awb_T 1vt2_T 2i2v_T 2i2t_T* 2qao_T* 2qba_T* 2qbc_T* ... Length = 93 Back     alignment and structure
>3bbo_V Ribosomal protein L23; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 198 Back     alignment and structure
>2wwb_K 60S ribosomal protein L25; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_K 2ww9_K 1s1i_T Length = 142 Back     alignment and structure
>2zkr_s 60S ribosomal protein L23A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 156 Back     alignment and structure
>2go5_4 Ribosomal protein L23; SR, SRP, ribosome, translation/RNA complex; 7.40A {Triticum SP} PDB: 2j37_4 Length = 152 Back     alignment and structure
>1vq8_S 50S ribosomal protein L23P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.12.1.1 PDB: 1vq4_S* 1vq5_S* 1vq6_S* 1vq7_S* 1s72_S* 1vq9_S* 1vqk_S* 1vql_S* 1vqm_S* 1vqn_S* 1vqo_S* 1vqp_S* 1yhq_S* 1yi2_S* 1yij_S* 1yit_S* 1yj9_S* 1yjn_S* 1yjw_S* 2otj_S* ... Length = 85 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target110 50S ribosomal protein L23 [Candidatus Liberibacter asia
2zjr_Q95 50S ribosomal protein L23; ribosome, large ribosomal su 100.0
3fin_X93 50S ribosomal protein L23; ribonucleoprotein, metal-bin 99.98
3ofq_T93 50S ribosomal protein L23; protein biosynthesis, riboso 99.96
2wwb_K142 60S ribosomal protein L25; ribosome, protein EXIT tunne 99.94
2zkr_s156 60S ribosomal protein L23A; protein-RNA complex, 60S ri 99.94
2go5_4152 Ribosomal protein L23; SR, SRP, ribosome, translation/R 99.93
3bbo_V198 Ribosomal protein L23; large ribosomal subunit, spinach 99.93
1vq8_S85 50S ribosomal protein L23P; ribosome 50S, protein-prote 99.91
>2zjr_Q 50S ribosomal protein L23; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.12.1.1 PDB: 1sm1_R* 2aar_R 2d3o_R 2zjp_Q* 2zjq_Q 1nkw_R 3cf5_Q* 3dll_Q* 1nwy_R* 1nwx_R* 1xbp_R* 1pnu_R 1pny_R 1vor_U 1vou_U 1vow_U 1voy_U 1vp0_U Back     alignment and structure
Probab=100.00  E-value=6.7e-36  Score=226.69  Aligned_cols=93  Identities=38%  Similarity=0.557  Sum_probs=87.9

Q ss_pred             CHHHHHHHHCCCCHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEEEECCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             25786760032079988886489099998887898899999999968743378998518963331122466443223454
Q gi|254780259|r    4 IRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRD   83 (110)
Q Consensus         4 ~~~~~vi~~P~~TEKs~~~~e~n~y~F~V~~~atK~eIK~ave~~f~V~V~~Vnt~~~~gK~Kr~~r~~g~k~~~~~~r~   83 (110)
                      |++||+|++|++||||+.+.|+|+|+|.|+++|||.|||+|||++|+|+|.+|||+|.+||.||++++            
T Consensus         1 m~~ydvi~~P~vTEKs~~~~e~n~y~F~V~~~a~K~eIK~ave~~f~VkV~~Vnt~~~~gK~kr~~~~------------   68 (95)
T 2zjr_Q            1 MSHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRF------------   68 (95)
T ss_dssp             -CCSSSCCEECCTHHHHHHHTTTCCEEEECSSCTHHHHHHHHHHHHCCCCSEEEECCBCCCCCSSSSC------------
T ss_pred             CCCCCEEEECCCCHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEECCCEEEECCC------------
T ss_conf             98434886040288787667699899997798999999999999839964899889847953677883------------


Q ss_pred             CCCCCCCCEEEEEECCCCCEECCCCC
Q ss_conf             44345881389999589973133248
Q gi|254780259|r   84 MYVSRKDVKRAFVTLAKGYSIDISAG  109 (110)
Q Consensus        84 ~~~k~~~~KKAiVtL~~G~~I~~~~g  109 (110)
                       .|++++||||||||++|++||||+|
T Consensus        69 -~g~~~~~KKAiVtL~~g~~I~~~~g   93 (95)
T 2zjr_Q           69 -IGQRNDRKKAIVRLAEGQSIEALAG   93 (95)
T ss_dssp             -CCCCCCBEEEEEECCSSCCCSSTTT
T ss_pred             -CCCCCCCEEEEEECCCCCEEEECCC
T ss_conf             -4134898999999789696300267



>3fin_X 50S ribosomal protein L23; ribonucleoprotein, metal-binding, RNA- binding, rRNA-binding, zinc, tRNA-binding, repressor; 6.40A {Thermus thermophilus} PDB: 1n88_A 1vsa_R 1vsp_R 2hgj_W 2hgq_W 2hgu_W 2j01_X 2j03_X 2jl6_X 2jl8_X 2v47_X 2v49_X 2wdi_X 2wdj_X 2wdl_X 2wdn_X 2wh2_X 2wh4_X 2wrj_X 2wrl_X ... Back     alignment and structure
>3ofq_T 50S ribosomal protein L23; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 3fik_T 2wwq_T 3ofr_T* 2j28_T 3e1b_M 3e1d_M 3iy9_T 3i1n_T 1p85_R 1p86_R 1vs8_T 1vs6_T 2aw4_T 2awb_T 1vt2_T 2i2v_T 2i2t_T* 2qao_T* 2qba_T* 2qbc_T* ... Back     alignment and structure
>2wwb_K 60S ribosomal protein L25; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_K 2ww9_K 1s1i_T Back     alignment and structure
>2zkr_s 60S ribosomal protein L23A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2go5_4 Ribosomal protein L23; SR, SRP, ribosome, translation/RNA complex; 7.40A {Triticum SP} PDB: 2j37_4 Back     alignment and structure
>3bbo_V Ribosomal protein L23; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>1vq8_S 50S ribosomal protein L23P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.12.1.1 PDB: 1vq4_S* 1vq5_S* 1vq6_S* 1vq7_S* 1s72_S* 1vq9_S* 1vqk_S* 1vql_S* 1vqm_S* 1vqn_S* 1vqo_S* 1vqp_S* 1yhq_S* 1yi2_S* 1yij_S* 1yit_S* 1yj9_S* 1yjn_S* 1yjw_S* 2otj_S* ... Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 110 50S ribosomal protein L23 [Candidatus Liberibacter asia
d2j01x193 d.12.1.1 (X:3-95) Ribosomal protein L23 {Thermus thermo 4e-21
d2zjrq193 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus ra 7e-21
d2qamt193 d.12.1.1 (T:1-93) Ribosomal protein L23 {Escherichia co 2e-19
d1vqos181 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloa 3e-13
>d2j01x1 d.12.1.1 (X:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} Length = 93 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal proteins S24e, L23 and L15e
superfamily: Ribosomal proteins S24e, L23 and L15e
family: L23p
domain: Ribosomal protein L23
species: Thermus thermophilus [TaxId: 274]
 Score = 93.6 bits (233), Expect = 4e-21
 Identities = 40/104 (38%), Positives = 56/104 (53%), Gaps = 13/104 (12%)

Query: 7   YDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVK 66
           YD I++PV++EK+     + +  F V   ++K+EIK+AVE  F VKVV VNTL  +GK K
Sbjct: 3   YDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKK 62

Query: 67  RLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAGV 110
           RL R                 R D K+A V +A G  I+   G+
Sbjct: 63  RLGRY-------------LGKRPDRKKAIVQVAPGQKIEALEGL 93


>d2zjrq1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]} Length = 93 Back     information, alignment and structure
>d2qamt1 d.12.1.1 (T:1-93) Ribosomal protein L23 {Escherichia coli [TaxId: 562]} Length = 93 Back     information, alignment and structure
>d1vqos1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 81 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target110 50S ribosomal protein L23 [Candidatus Liberibacter asia
d2zjrq193 Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 100.0
d2j01x193 Ribosomal protein L23 {Thermus thermophilus [TaxId: 274 99.98
d2qamt193 Ribosomal protein L23 {Escherichia coli [TaxId: 562]} 99.97
d1vqos181 Ribosomal protein L23 {Archaeon Haloarcula marismortui 99.92
>d2zjrq1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal proteins S24e, L23 and L15e
superfamily: Ribosomal proteins S24e, L23 and L15e
family: L23p
domain: Ribosomal protein L23
species: Deinococcus radiodurans [TaxId: 1299]
Probab=100.00  E-value=3.3e-35  Score=221.34  Aligned_cols=92  Identities=38%  Similarity=0.554  Sum_probs=86.5

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEEEECCCCEEEECCCCCCCCCCCCCCCC
Q ss_conf             57867600320799888864890999988878988999999999687433789985189633311224664432234544
Q gi|254780259|r    5 RFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRDM   84 (110)
Q Consensus         5 ~~~~vi~~P~~TEKs~~~~e~n~y~F~V~~~atK~eIK~ave~~f~V~V~~Vnt~~~~gK~Kr~~r~~g~k~~~~~~r~~   84 (110)
                      .|||+|++|++||||+.+.|+|+|+|.|+++|||+|||+|||++|+|+|.+|||+|.+||.||++++             
T Consensus         1 ~~ydvi~~P~iTEKs~~~~e~n~y~F~V~~~atK~~Ik~ave~lf~VkV~~Vnt~~~~gK~kr~~~~-------------   67 (93)
T d2zjrq1           1 SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRF-------------   67 (93)
T ss_dssp             CCSSSCCEECCTHHHHHHHTTTCCEEEECSSCTHHHHHHHHHHHHCCCCSEEEECCBCCCCCSSSSC-------------
T ss_pred             CCCCEEEECCCCHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEEEECCCCEEECCC-------------
T ss_conf             9633886032088787777799799998087898999999999819875899989817972377994-------------


Q ss_pred             CCCCCCCEEEEEECCCCCEECCCCC
Q ss_conf             4345881389999589973133248
Q gi|254780259|r   85 YVSRKDVKRAFVTLAKGYSIDISAG  109 (110)
Q Consensus        85 ~~k~~~~KKAiVtL~~G~~I~~~~g  109 (110)
                      .|++++||||||||++|++||||+|
T Consensus        68 ~g~~~~~KKAiVtL~~g~~I~~~~g   92 (93)
T d2zjrq1          68 IGQRNDRKKAIVRLAEGQSIEALAG   92 (93)
T ss_dssp             CCCCCCBEEEEEECCSSCCCSSTTT
T ss_pred             CEECCCCEEEEEECCCCCCCCCCCC
T ss_conf             3403897899999689694031489



>d2j01x1 d.12.1.1 (X:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qamt1 d.12.1.1 (T:1-93) Ribosomal protein L23 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqos1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 110 50S ribosomal protein L23 [Candidatus Liberibacter
3fin_X_93 (X:) 50S ribosomal protein L23; ribonucleoprotein, 7e-22
2zjr_Q_95 (Q:) 50S ribosomal protein L23; ribosome, large ri 1e-21
3i1n_T_100 (T:) 50S ribosomal protein L23; ribosome structure 5e-21
1vq8_S_85 (S:) 50S ribosomal protein L23P; ribosome 50S, pro 4e-14
2go5_4_152 (4:) Ribosomal protein L23; SR, SRP, ribosome, tra 7e-14
2zkr_s_156 (s:) 60S ribosomal protein L23A; protein-RNA compl 2e-12
3bbo_V_198 (V:) Ribosomal protein L23; large ribosomal subuni 2e-11
2wwb_K_142 (K:) 60S ribosomal protein L25; ribosome, protein 4e-11
>3fin_X (X:) 50S ribosomal protein L23; ribonucleoprotein, metal-binding, RNA- binding, rRNA-binding, zinc, tRNA-binding, repressor; 6.40A {Thermus thermophilus} PDB: 1n88_A 1vsa_R 1vsp_R 2hgj_W 2hgq_W 2hgu_W 2j01_X 2j03_X 2jl6_X 2jl8_X 2v47_X 2v49_X 2wdi_X 2wdj_X 2wdl_X 2wdn_X 2wh2_X 2wh4_X 3d5b_X 3d5d_X ...Length = 93 Back     alignment and structure
 Score = 97.0 bits (242), Expect = 7e-22
 Identities = 40/104 (38%), Positives = 56/104 (53%), Gaps = 13/104 (12%)

Query: 7   YDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVK 66
           YD I++PV++EK+     + +  F V   ++K+EIK+AVE  F VKVV VNTL  +GK K
Sbjct: 3   YDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKK 62

Query: 67  RLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSIDISAGV 110
           RL R                 R D K+A V +A G  I+   G+
Sbjct: 63  RLGRY-------------LGKRPDRKKAIVQVAPGQKIEALEGL 93


>2zjr_Q (Q:) 50S ribosomal protein L23; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 95 Back     alignment and structure
>3i1n_T (T:) 50S ribosomal protein L23; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_R 1p86_R 1vs8_T 2aw4_T 2awb_T 1vs6_T 2i2v_T 2i2t_T* 2qao_T* 2qba_T* 2qbc_T* 2qbe_T 2qbg_T 2qbi_T* 2qbk_T* 2qov_T 2qox_T 2qoz_T* 2qp1_T* 2rdo_T ...Length = 100 Back     alignment and structure
>1vq8_S (S:) 50S ribosomal protein L23P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 85 Back     alignment and structure
>2go5_4 (4:) Ribosomal protein L23; SR, SRP, ribosome, translation/RNA complex; 7.40A {Triticum SP} PDB: 2j37_4Length = 152 Back     alignment and structure
>2zkr_s (s:) 60S ribosomal protein L23A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 156 Back     alignment and structure
>3bbo_V (V:) Ribosomal protein L23; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 198 Back     alignment and structure
>2wwb_K (K:) 60S ribosomal protein L25; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_K 2ww9_K 1s1i_TLength = 142 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target110 50S ribosomal protein L23 [Candidatus Liberibacter asia
2zjr_Q_95 50S ribosomal protein L23; ribosome, large ribosom 100.0
3i1n_T_100 50S ribosomal protein L23; ribosome structure, pro 100.0
3fin_X_93 50S ribosomal protein L23; ribonucleoprotein, meta 99.97
2wwb_K_142 60S ribosomal protein L25; ribosome, protein EXIT 99.95
2zkr_s_156 60S ribosomal protein L23A; protein-RNA complex, 6 99.94
1vq8_S_85 50S ribosomal protein L23P; ribosome 50S, protein- 99.93
3bbo_V_198 Ribosomal protein L23; large ribosomal subunit, sp 99.92
2go5_4_152 Ribosomal protein L23; SR, SRP, ribosome, translat 99.92
>2zjr_Q (Q:) 50S ribosomal protein L23; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
Probab=100.00  E-value=1.3e-34  Score=220.24  Aligned_cols=93  Identities=38%  Similarity=0.553  Sum_probs=88.5

Q ss_pred             CHHHHHHHHCCCCHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEEEECCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             25786760032079988886489099998887898899999999968743378998518963331122466443223454
Q gi|254780259|r    4 IRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRD   83 (110)
Q Consensus         4 ~~~~~vi~~P~~TEKs~~~~e~n~y~F~V~~~atK~eIK~ave~~f~V~V~~Vnt~~~~gK~Kr~~r~~g~k~~~~~~r~   83 (110)
                      |++||+|++|++||||+.+.|+|+|+|.|+++|||+|||+|||.+|+|+|.+|||+|++||.||++++.           
T Consensus         1 m~~~~vI~~p~iTEKs~~l~e~n~~~F~V~~~anK~eIK~ave~~f~VkV~~VnT~~~~gK~kR~~~~~-----------   69 (95)
T 2zjr_Q            1 MSHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFI-----------   69 (95)
T ss_dssp             -CCSSSCCEECCTHHHHHHHTTTCCEEEECSSCTHHHHHHHHHHHHCCCCSEEEECCBCCCCCSSSSCC-----------
T ss_pred             CCCCCEEEECCCCHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEEEECCCEEEECCCC-----------
T ss_conf             970018750410887887776997999981888989999999998399637998898279615768844-----------


Q ss_pred             CCCCCCCCEEEEEECCCCCEECCCCC
Q ss_conf             44345881389999589973133248
Q gi|254780259|r   84 MYVSRKDVKRAFVTLAKGYSIDISAG  109 (110)
Q Consensus        84 ~~~k~~~~KKAiVtL~~G~~I~~~~g  109 (110)
                        |++++||||||||++|++||||+|
T Consensus        70 --g~~~~~KKA~VtL~~g~~i~~~~~   93 (95)
T 2zjr_Q           70 --GQRNDRKKAIVRLAEGQSIEALAG   93 (95)
T ss_dssp             --CCCCCBEEEEEECCSSCCCSSTTT
T ss_pred             --CCCCCCEEEEEECCCCCEECCCCC
T ss_conf             --013897999999589796401378



>3i1n_T (T:) 50S ribosomal protein L23; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_R 1p86_R 1vs8_T 2aw4_T 2awb_T 1vs6_T 2i2v_T 2i2t_T* 2qao_T* 2qba_T* 2qbc_T* 2qbe_T 2qbg_T 2qbi_T* 2qbk_T* 2qov_T 2qox_T 2qoz_T* 2qp1_T* 2rdo_T ... Back     alignment and structure
>3fin_X (X:) 50S ribosomal protein L23; ribonucleoprotein, metal-binding, RNA- binding, rRNA-binding, zinc, tRNA-binding, repressor; 6.40A {Thermus thermophilus} PDB: 1n88_A 1vsa_R 1vsp_R 2hgj_W 2hgq_W 2hgu_W 2j01_X 2j03_X 2jl6_X 2jl8_X 2v47_X 2v49_X 2wdi_X 2wdj_X 2wdl_X 2wdn_X 2wh2_X 2wh4_X 3d5b_X 3d5d_X ... Back     alignment and structure
>2wwb_K (K:) 60S ribosomal protein L25; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_K 2ww9_K 1s1i_T Back     alignment and structure
>2zkr_s (s:) 60S ribosomal protein L23A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1vq8_S (S:) 50S ribosomal protein L23P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>3bbo_V (V:) Ribosomal protein L23; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2go5_4 (4:) Ribosomal protein L23; SR, SRP, ribosome, translation/RNA complex; 7.40A {Triticum SP} PDB: 2j37_4 Back     alignment and structure