254780258

254780258

50S ribosomal protein L2

GeneID in NCBI database:8209239Locus tag:CLIBASIA_00715
Protein GI in NCBI database:254780258Protein Accession:YP_003064671.1
Gene range:-(140577, 141413)Protein Length:278aa
Gene description:50S ribosomal protein L2
COG prediction:[J] Ribosomal protein L2
KEGG prediction:rplB; 50S ribosomal protein L2; K02886 large subunit ribosomal protein L2
SEED prediction:LSU ribosomal protein L2p (L8e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSNKSTDVFIARSRHKNKK
cccEEccccccccEEEEEEccccEEccccHHHHHHHHHHccccccccEEEEEEEccccEEEEEEEEEEcccccccEEEEEEEEccccccEEEEEEEccccEEEEEEccccccccEEEEccccccccccccccccccccccEEEEEEEcccccEEEEEEcccEEEEEEEcccEEEEEcccccEEEEccccEEEEEEcccccccccHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccccccccEEEEEccccccc
cccEEccccccccccEEEEEHHHHccccccHHHHcccccccccccccEEEEEEccccccEEEEEEEcccccccccEEEEEEEEcccccccEEEEEEccccEEEEEcccccEcccEEEEcccccccccccEEEccccccccEEEcEcccccccccEcccccccEEEEEcccccEEEEcccccEEEEccccEEEEccEccccHHHcccccHHHHccccccccccHHHccHHHccccccccccccccccccccccccccccccccccccEEEEEEcccccc
malknfnpdtsgrrQLVMvdrnslhsgkpiksltrglcskggrnntgrvtmrfrggghknryrlvdfkrgeygleGVVKrleydpnrTAFIALISYsngslayilapqrlsvgdkvissdsavdvkpgnamplrfipvgsivhnvemkpgkggqisrsagSYARLVERDRSRALLRLSSGEMRFVHSSCMAsigavsnqdhsnvnhakagraRWLGMRShvrgvamnpvdhphgggegktsggrnpcspwgkltkgkrtrsnkstDVFIARSRHKNKK
malknfnpdtsgrrqLVMVdrnslhsgkpiksltrglcskggrnntgrvtmrfrggghknryrlvdfkrgeYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSavdvkpgnamPLRFIPVGSIVHNVemkpgkggqisrsagsyarlVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMnpvdhphgggegktsggrnpcspwgkltkgkrtrsnkstdvfiarsrhknkk
MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDrsrallrlssGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSNKSTDVFIARSRHKNKK
*A*KNFNPDTSGRRQLVMVDRNSLHSGKPI****************GRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGG**********CSPWGKLTKG***************SR*****
********DTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHG**********NPCSPWGK***********STDVFIA********
*ALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSNKSTDVFIARSR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSNKSTDVFIARSRHKNKK
MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSNKSTDVFIARSRHKNKK
MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSNKSTDVFIARSRHKNKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
315122815278 50S ribosomal protein L2 [Candidatus Liberibacter solan 1 1e-130
222148369278 50S ribosomal protein L2 [Agrobacterium vitis S4] Lengt 1 1e-114
227821759278 50S ribosomal protein L2 [Sinorhizobium fredii NGR234] 1 1e-114
15889239278 50S ribosomal protein L2 [Agrobacterium tumefaciens str 1 1e-114
15965112278 50S ribosomal protein L2 [Sinorhizobium meliloti 1021] 1 1e-114
325293333278 50S ribosomal protein L2 [Agrobacterium sp. H13-3] Leng 1 1e-114
222085678278 ribosomal protein L2 [Agrobacterium radiobacter K84] Le 1 1e-112
218680088278 50S ribosomal protein L2 [Rhizobium etli CIAT 894] Leng 1 1e-109
116251543278 50S ribosomal protein L2 [Rhizobium leguminosarum bv. v 1 1e-109
241204168278 50S ribosomal protein L2 [Rhizobium leguminosarum bv. t 1 1e-109
>gi|315122815|ref|YP_004063304.1| 50S ribosomal protein L2 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 278 Back     alignment and organism information
 Score =  467 bits (1201), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/278 (83%), Positives = 257/278 (92%)

Query: 1   MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKN 60
           MALK+FNPDTS RRQL++V+R+SL+ GKP+KSLT+GLCSKGGRNNTGR+TMRFRGGG KN
Sbjct: 1   MALKSFNPDTSSRRQLIIVNRDSLYKGKPLKSLTKGLCSKGGRNNTGRITMRFRGGGCKN 60

Query: 61  RYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSD 120
           RYR++DFKR +Y +EGVV+RLEYDPNRTAFIALI+Y     +YILAPQRLSVGDKVISS+
Sbjct: 61  RYRIIDFKRSDYDVEGVVQRLEYDPNRTAFIALIAYPKEKFSYILAPQRLSVGDKVISSN 120

Query: 121 SAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSG 180
            AVD+KPGNAMPLRFIPVG+IVHNVEMKP KGGQISRSAGSYAR+VERDRSR LLRLSSG
Sbjct: 121 GAVDIKPGNAMPLRFIPVGTIVHNVEMKPQKGGQISRSAGSYARVVERDRSRVLLRLSSG 180

Query: 181 EMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKT 240
           EMRFV SSCMASIGAVSNQD  N+NHAKAGR+RWL +R HVRGVAMNPVDHP GGGEGKT
Sbjct: 181 EMRFVQSSCMASIGAVSNQDQININHAKAGRSRWLKIRPHVRGVAMNPVDHPLGGGEGKT 240

Query: 241 SGGRNPCSPWGKLTKGKRTRSNKSTDVFIARSRHKNKK 278
           SGGRNPCSPWGK TKGKRTRSNKST+VFIA SRHKNKK
Sbjct: 241 SGGRNPCSPWGKPTKGKRTRSNKSTNVFIASSRHKNKK 278


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148369|ref|YP_002549326.1| 50S ribosomal protein L2 [Agrobacterium vitis S4] Length = 278 Back     alignment and organism information
>gi|227821759|ref|YP_002825729.1| 50S ribosomal protein L2 [Sinorhizobium fredii NGR234] Length = 278 Back     alignment and organism information
>gi|15889239|ref|NP_354920.1| 50S ribosomal protein L2 [Agrobacterium tumefaciens str. C58] Length = 278 Back     alignment and organism information
>gi|15965112|ref|NP_385465.1| 50S ribosomal protein L2 [Sinorhizobium meliloti 1021] Length = 278 Back     alignment and organism information
>gi|325293333|ref|YP_004279197.1| 50S ribosomal protein L2 [Agrobacterium sp. H13-3] Length = 278 Back     alignment and organism information
>gi|222085678|ref|YP_002544208.1| ribosomal protein L2 [Agrobacterium radiobacter K84] Length = 278 Back     alignment and organism information
>gi|218680088|ref|ZP_03527985.1| 50S ribosomal protein L2 [Rhizobium etli CIAT 894] Length = 278 Back     alignment and organism information
>gi|116251543|ref|YP_767381.1| 50S ribosomal protein L2 [Rhizobium leguminosarum bv. viciae 3841] Length = 278 Back     alignment and organism information
>gi|241204168|ref|YP_002975264.1| 50S ribosomal protein L2 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 278 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
PRK09374276 PRK09374, rplB, 50S ribosomal protein L2; Validated 1e-136
TIGR01171273 TIGR01171, rplB_bact, ribosomal protein L2, bacterial/o 1e-110
CHL00052273 CHL00052, rpl2, ribosomal protein L2 5e-87
PTZ00031317 PTZ00031, PTZ00031, ribosomal protein L2; Provisional 4e-72
KOG0438312 KOG0438, KOG0438, KOG0438, Mitochondrial/chloroplast ri 5e-51
COG0090275 COG0090, RplB, Ribosomal protein L2 [Translation, ribos 8e-99
pfam03947130 pfam03947, Ribosomal_L2_C, Ribosomal Proteins L2, C-ter 2e-53
PRK09612238 PRK09612, rpl2p, 50S ribosomal protein L2P; Validated 3e-38
PTZ00180260 PTZ00180, PTZ00180, 60S ribosomal protein L8; Provision 3e-21
KOG2309248 KOG2309, KOG2309, KOG2309, 60s ribosomal protein L2/L8 8e-21
pfam0018177 pfam00181, Ribosomal_L2, Ribosomal Proteins L2, RNA bin 6e-28
>gnl|CDD|181807 PRK09374, rplB, 50S ribosomal protein L2; Validated Back     alignment and domain information
>gnl|CDD|162234 TIGR01171, rplB_bact, ribosomal protein L2, bacterial/organellar Back     alignment and domain information
>gnl|CDD|176993 CHL00052, rpl2, ribosomal protein L2 Back     alignment and domain information
>gnl|CDD|173329 PTZ00031, PTZ00031, ribosomal protein L2; Provisional Back     alignment and domain information
>gnl|CDD|35659 KOG0438, KOG0438, KOG0438, Mitochondrial/chloroplast ribosomal protein L2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30439 COG0090, RplB, Ribosomal protein L2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|146530 pfam03947, Ribosomal_L2_C, Ribosomal Proteins L2, C-terminal domain Back     alignment and domain information
>gnl|CDD|181989 PRK09612, rpl2p, 50S ribosomal protein L2P; Validated Back     alignment and domain information
>gnl|CDD|173464 PTZ00180, PTZ00180, 60S ribosomal protein L8; Provisional Back     alignment and domain information
>gnl|CDD|37520 KOG2309, KOG2309, KOG2309, 60s ribosomal protein L2/L8 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|109247 pfam00181, Ribosomal_L2, Ribosomal Proteins L2, RNA binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
TIGR01171279 rplB_bact ribosomal protein L2; InterPro: IPR005880 Rib 100.0
PRK09374276 rplB 50S ribosomal protein L2; Validated 100.0
CHL00052274 rpl2 ribosomal protein L2 100.0
PTZ00031330 ribosomal protein L2; Provisional 100.0
COG0090275 RplB Ribosomal protein L2 [Translation, ribosomal struc 100.0
KOG0438312 consensus 100.0
PRK09612240 rpl2p 50S ribosomal protein L2P; Validated 100.0
PTZ00180260 60S ribosomal protein L2; Provisional 100.0
KOG2309248 consensus 100.0
pfam03947130 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain 100.0
pfam0018177 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain. 99.97
KOG0438312 consensus 96.37
>TIGR01171 rplB_bact ribosomal protein L2; InterPro: IPR005880 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK09374 rplB 50S ribosomal protein L2; Validated Back     alignment and domain information
>CHL00052 rpl2 ribosomal protein L2 Back     alignment and domain information
>PTZ00031 ribosomal protein L2; Provisional Back     alignment and domain information
>COG0090 RplB Ribosomal protein L2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0438 consensus Back     alignment and domain information
>PRK09612 rpl2p 50S ribosomal protein L2P; Validated Back     alignment and domain information
>PTZ00180 60S ribosomal protein L2; Provisional Back     alignment and domain information
>KOG2309 consensus Back     alignment and domain information
>pfam03947 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain Back     alignment and domain information
>pfam00181 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain Back     alignment and domain information
>KOG0438 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
2j01_D276 Structure Of The Thermus Thermophilus 70s Ribosome 5e-94
3mrz_C275 Recognition Of The Amber Stop Codon By Release Fact 7e-93
3fin_D272 T. Thermophilus 70s Ribosome In Complex With Mrna, 6e-92
3pyo_C271 Crystal Structure Of A Complex Containing Domain 3 7e-92
2aw4_C273 Crystal Structure Of The Bacterial Ribosome From Es 3e-91
3e1b_N270 Structure Of The 50s Subunit Of E. Coli Ribosome In 1e-90
1p85_A272 Real Space Refined Coordinates Of The 50s Subunit F 4e-90
3fik_C271 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 6e-90
2j28_C267 Model Of E. Coli Srp Bound To 70s Rncs Length = 267 2e-88
1nkw_A275 Crystal Structure Of The Large Ribosomal Subunit Fr 5e-83
1nwx_A274 Complex Of The Large Ribosomal Subunit From Deinoco 7e-82
1pnu_A270 Crystal Structure Of A Streptomycin Dependent Ribos 3e-80
3bbo_E269 Homology Model For The Spinach Chloroplast 50s Subu 3e-71
2gya_A227 Structure Of The 50s Subunit Of A Pre-Translocation 1e-72
1ffk_A239 Crystal Structure Of The Large Ribosomal Subunit Fr 4e-34
2otl_A239 Girodazole Bound To The Large Subunit Of Haloarcula 9e-34
1s72_A240 Refined Crystal Structure Of The Haloarcula Marismo 9e-34
3g4s_A237 Co-Crystal Structure Of Tiamulin Bound To The Large 1e-33
1s1i_B253 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 3e-24
3izs_B254 Localization Of The Large Subunit Ribosomal Protein 3e-24
3jyw_B243 Structure Of The 60s Proteins For Eukaryotic Riboso 4e-24
3izr_B261 Localization Of The Large Subunit Ribosomal Protein 1e-22
2zkr_a257 Structure Of A Mammalian Ribosomal 60s Subunit With 7e-22
2b66_D173 50s Ribosomal Subunit From A Crystal Structure Of R 3e-44
1ml5_d178 Crystal Structure Of The Ribosome At 5.5 A Resoluti 1e-42
2ftc_B136 Structural Model For The Large Subunit Of The Mamma 9e-18
1rl2_A137 Ribosomal Protein L2 Rna-Binding Domain From Bacill 4e-31
487d_I135 Seven Ribosomal Proteins Fitted To A Cryo-Electron 4e-30
gi|116668235|pdb|2J01|D Chain D, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 276 Back     alignment and structure
 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 143/277 (51%), Positives = 188/277 (67%), Gaps = 3/277 (1%)

Query: 1   MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKN 60
           MA+K F P T  RR + + D + +   +P KSL + L   GGRNN GR+T+RFRGGGHK 
Sbjct: 1   MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFRGGGHKR 60

Query: 61  RYRLVDFKRGEYG-LEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISS 119
            YR++DFKR +   +   V  +EYDPNR+A IAL+ Y +G   YI+AP  L VG +V++ 
Sbjct: 61  LYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRYIIAPDGLQVGQQVVAG 120

Query: 120 DSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSS 179
             A  ++ GNA+PLRFIPVG++VH VE++P KG +++R+AG+ A++  R+    +LRL S
Sbjct: 121 PDA-PIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPS 179

Query: 180 GEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGK 239
           GE+R VH  C A++GAV N DH N+   KAGR+RWLG R HVRG AMNPVDHPHGGGEG+
Sbjct: 180 GELRKVHGECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGR 239

Query: 240 TSGGRNPCSPWGKLTKGKRTRS-NKSTDVFIARSRHK 275
              GR P SPWG  TKG +TR   K +  FI   R K
Sbjct: 240 APRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK 276


>gi|300508631|pdb|3MRZ|C Chain C, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 275 Back     alignment and structure
>gi|224510782|pdb|3FIN|D Chain D, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 272 Back     alignment and structure
>gi|322812574|pdb|3PYO|C Chain C, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 271 Back     alignment and structure
gi|83754064|pdb|2AW4|C Chain C, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 273 Back     alignment and structure
>gi|256032386|pdb|3E1B|N Chain N, Structure Of The 50s Subunit Of E. Coli Ribosome In Pre- Accommodation State Length = 270 Back     alignment and structure
>gi|33357902|pdb|1P85|A Chain A, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 272 Back     alignment and structure
>gi|224510755|pdb|3FIK|C Chain C, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 50s Subunit. Length = 271 Back     alignment and structure
>gi|119390347|pdb|2J28|C Chain C, Model Of E. Coli Srp Bound To 70s Rncs Length = 267 Back     alignment and structure
gi|28948920|pdb|1NKW|A Chain A, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 275 Back     alignment and structure
>gi|29726788|pdb|1NWX|A Chain A, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 Length = 274 Back     alignment and structure
>gi|34811554|pdb|1PNU|A Chain A, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 270 Back     alignment and structure
>gi|189096127|pdb|3BBO|E Chain E, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 269 Back     alignment and structure
>gi|116667435|pdb|2GYA|A Chain A, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 227 Back     alignment and structure
>gi|10120920|pdb|1FFK|A Chain A, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 239 Back     alignment and structure
>gi|145580204|pdb|2OTL|A Chain A, Girodazole Bound To The Large Subunit Of Haloarcula Marismortui Length = 239 Back     alignment and structure
gi|50513470|pdb|1S72|A Chain A, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 240 Back     alignment and structure
>gi|228312142|pdb|3G4S|A Chain A, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 237 Back     alignment and structure
>gi|49258840|pdb|1S1I|B Chain B, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h. Length = 253 Back     alignment and structure
>gi|315113302|pdb|3IZS|B Chain B, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 254 Back     alignment and structure
>gi|281500832|pdb|3JYW|B Chain B, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 243 Back     alignment and structure
>gi|315113250|pdb|3IZR|B Chain B, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 261 Back     alignment and structure
gi|187609299|pdb|2ZKR|AA Chain a, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 257 Back     alignment and structure
>gi|88192260|pdb|2B66|D Chain D, 50s Ribosomal Subunit From A Crystal Structure Of Release Factor Rf1, Trnas And Mrna Bound To The Ribosome. This File Contains The 50s Subunit From A Crystal Structure Of Release Factor Rf1, Trnas And Mrna Bound To The Ribosome And Is Described In Remark 400 Length = 173 Back     alignment and structure
>gi|28373723|pdb|1ML5|DD Chain d, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 Length = 178 Back     alignment and structure
>gi|99032308|pdb|2FTC|B Chain B, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome Length = 136 Back     alignment and structure
>gi|4699556|pdb|1RL2|A Chain A, Ribosomal Protein L2 Rna-Binding Domain From Bacillus Stearothermophilus Length = 137 Back     alignment and structure
>gi|7767185|pdb|487D|I Chain I, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution Length = 135 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
3ofq_C271 50S ribosomal protein L2; protein biosynthesis, ribosom 5e-86
3i1n_C273 50S ribosomal protein L2; ribosome structure, protein-R 2e-74
2j01_D276 50S ribosomal protein L2; ribosome, tRNA, paromomycin, 5e-72
3bbo_E269 Ribosomal protein L2; large ribosomal subunit, spinach 3e-62
2zkr_a257 60S ribosomal protein L8; protein-RNA complex, 60S ribo 2e-52
1giy_D178 50S ribosomal protein L2; ribosome assembly, protein sy 2e-59
1vq8_A240 50S ribosomal protein L2P; ribosome 50S, protein-protei 2e-51
2ftc_B136 Mitochondrial ribosomal protein L2; mitochondrial ribos 2e-35
1rl2_A137 Protein (ribosomal protein L2); RNA-binding domain, pep 3e-34
>3ofq_C 50S ribosomal protein L2; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 3fik_C 2wwq_C 3ofr_C* 3i1n_C 1vs8_C 1vs6_C 2aw4_C 2awb_C 2vhm_C 2vhn_C 3bbx_C 3df2_C 3df4_C 1vt2_C 3i1p_C 3i1r_C 3i1t_C 3i20_C 3i22_C 3kcr_6 ... Length = 271 Back     alignment and structure
 Score =  312 bits (801), Expect = 5e-86
 Identities = 153/272 (56%), Positives = 187/272 (68%), Gaps = 2/272 (0%)

Query: 2   ALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNR 61
           A+    P + GRR +V V    LH GKP   L       GGRNN GR+T R  GGGHK  
Sbjct: 1   AVVKCKPTSPGRRHVVKVVNPELHKGKPFAPLLEKNSKSGGRNNNGRITTRHIGGGHKQA 60

Query: 62  YRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDS 121
           YR+VDFKR + G+  VV+RLEYDPNR+A IAL+ Y +G   YILAP+ L  GD++ S   
Sbjct: 61  YRIVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYILAPKGLKAGDQIQSGVD 120

Query: 122 AVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGE 181
           A  +KPGN +P+R IPVGS VHNVEMKPGKGGQ++RSAG+Y ++V RD +   LRL SGE
Sbjct: 121 A-AIKPGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGTYVQIVARDGAYVTLRLRSGE 179

Query: 182 MRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTS 241
           MR V + C A++G V N +H      KAG ARW G+R  VRG AMNPVDHPHGGGEG+ +
Sbjct: 180 MRKVEADCRATLGEVGNAEHMLRVLGKAGAARWRGVRPTVRGTAMNPVDHPHGGGEGR-N 238

Query: 242 GGRNPCSPWGKLTKGKRTRSNKSTDVFIARSR 273
            G++P +PWG  TKGK+TRSNK TD FI R R
Sbjct: 239 FGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRR 270


>3i1n_C 50S ribosomal protein L2; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_C 2aw4_C 2awb_C 2vhm_C 2vhn_C 3bbx_C 3df2_C 3df4_C 1vs6_C 3i1p_C 3i1r_C 3i1t_C 3i20_C 3i22_C 2qam_C* 1p85_A 1p86_A 2i2v_C 2i2t_C* 2qao_C* ... Length = 273 Back     alignment and structure
>2j01_D 50S ribosomal protein L2; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: b.34.5.3 b.40.4.5 PDB: 1vsp_B 2hgj_D 2hgq_D 2hgu_D 1vsa_B 2j03_D 2jl6_D 2jl8_D 2v47_D 2v49_D 2wdi_D 2wdj_D 2wdl_D 2wdn_D 2wh2_D 2wh4_D 3d5b_D 3d5d_D 3f1f_D 3f1h_D ... Length = 276 Back     alignment and structure
>3bbo_E Ribosomal protein L2; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 269 Back     alignment and structure
>2zkr_a 60S ribosomal protein L8; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_B Length = 257 Back     alignment and structure
>1vq8_A 50S ribosomal protein L2P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.3 b.40.4.5 PDB: 1vq4_A* 1vq5_A* 1vq6_A* 1vq7_A* 1s72_A* 1vq9_A* 1vqk_A* 1vql_A* 1vqm_A* 1vqn_A* 1vqo_A* 1vqp_A* 1yhq_A* 1yi2_A* 1yij_A* 1yit_A* 1yj9_A* 1yjn_A* 1yjw_A* 2otj_A* ... Length = 240 Back     alignment and structure
>2ftc_B Mitochondrial ribosomal protein L2; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_B Length = 136 Back     alignment and structure
>1rl2_A Protein (ribosomal protein L2); RNA-binding domain, peptidyltransferease center, X-RAY diffraction; 2.30A {Geobacillus stearothermophilus} SCOP: b.34.5.3 b.40.4.5 PDB: 1c04_A 487d_I Length = 137 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
2j01_D276 50S ribosomal protein L2; ribosome, tRNA, paromomycin, 100.0
3ofq_C271 50S ribosomal protein L2; protein biosynthesis, ribosom 100.0
3bbo_E269 Ribosomal protein L2; large ribosomal subunit, spinach 100.0
2zkr_a257 60S ribosomal protein L8; protein-RNA complex, 60S ribo 100.0
1vq8_A240 50S ribosomal protein L2P; ribosome 50S, protein-protei 100.0
1giy_D178 50S ribosomal protein L2; ribosome assembly, protein sy 100.0
2ftc_B136 Mitochondrial ribosomal protein L2; mitochondrial ribos 100.0
1rl2_A137 Protein (ribosomal protein L2); RNA-binding domain, pep 100.0
>2j01_D 50S ribosomal protein L2; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: b.34.5.3 b.40.4.5 PDB: 1vsp_B 2hgj_D 2hgq_D 2hgu_D 1vsa_B 2j03_D 2jl6_D 2jl8_D 2v47_D 2v49_D 2wdi_D 2wdj_D 2wdl_D 2wdn_D 2wh2_D 2wh4_D 2wrj_D 2wrl_D 2wro_D 2wrr_D ... Back     alignment and structure
Probab=100.00  E-value=0  Score=808.52  Aligned_cols=274  Identities=53%  Similarity=0.933  Sum_probs=267.4

Q ss_pred             CCCEECCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCEEEEEEEEEC-CCCCCEEEE
Q ss_conf             9750115888410510870457641688722211155436775889848788647875102687988633-777604788
Q gi|254780258|r    1 MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNNTGRVTMRFRGGGHKNRYRLVDFKRG-EYGLEGVVK   79 (278)
Q Consensus         1 M~~k~~kP~Tp~~R~~~~~~~~~l~k~~p~K~L~~~~~~~~GRNn~GrITvrhRGGGhKr~yR~IDf~r~-~~~~~~~V~   79 (278)
                      |+||+|||+|||+||++++++++||+++|+|+|++++++++||||+||||+|||||||||+||+|||+|. +.+++++|+
T Consensus         1 M~~k~~kp~tp~~R~~~~~~~~~l~k~~P~k~l~~~~~k~~GRNn~GrITvrhrGGGhKr~yR~IDf~r~~~~~~~~~V~   80 (276)
T 2j01_D            1 MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVA   80 (276)
T ss_dssp             -CCBCCCCSSTTTTTCCBCCCTTSTTCCSCCSSSSCBCCCCCSBSSSSBSSTTBCCCCCCCBCCCCCCCGGGTTCCEEEE
T ss_pred             CCCCCCCCCCCCCCCEEECCCCCEECCCCCHHHCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEECCCCCCCCCCEEE
T ss_conf             98442379598678658525787386985465435366668858782088873579767347998814313578652378


Q ss_pred             EEEECCCCEEEEEEEECCCCCEEEEECCCCCCCCCEEEECCCCCCCCCCCCHHHHHCCCCCEEEEEEEECCCCEEEEEEC
Q ss_conf             76415885258898414776346751645661045788366676757574110443574637762333036882588634
Q gi|254780258|r   80 RLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSA  159 (278)
Q Consensus        80 ~IeYDPnRsa~IALv~~~~g~~~YIlAp~gl~vGd~I~s~~~~~~i~~Gn~lpL~~IP~Gt~I~NIE~~pG~Ggkl~RsA  159 (278)
                      +|||||||||+||||.|+||+++|||||++|++||.|+++..+ ++++||++||.+||+||+|||||+.||+||||||||
T Consensus        81 ~IeyDPnRsa~IALv~~~~g~~~YIlAp~gl~~Gd~I~~~~~~-~~~~Gn~lpL~~iP~Gt~I~NIE~~pg~Ggkl~RsA  159 (276)
T 2j01_D           81 AIEYDPNRSARIALLHYVDGEKRYIIAPDGLQVGQQVVAGPDA-PIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAA  159 (276)
T ss_dssp             ECCCCTTCSSCEEEEEETTSCEEEEECCTTCCTTCEECBSSSS-CSSTTCEEEGGGSCTTCEEESEESSTTSCEEESCSS
T ss_pred             EEEECCCCCCEEEEEEECCCCEEEEECCHHCCCCCEECCCCCC-CCCCCCCCCHHHCCCCCEEEEEEECCCCCEEEEEEC
T ss_conf             9997689874079999369928987477422247431047767-775477147735889878421553389950699746


Q ss_pred             CCEEEEEEECCCEEEEEECCCCEEEECCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             65189967508889999489758998567809998512553323001313441005779970123326874788888888
Q gi|254780258|r  160 GSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGK  239 (278)
Q Consensus       160 Gt~a~Ii~k~~~~~~ikLPSGe~r~i~~~c~AtIG~vsN~~~~~~~~gKAG~~Rwlg~RP~VRGvAMNpvDHPhGGGeGk  239 (278)
                      ||||+|+++++++++|||||||+++|+++|+||||+|||.+|++++++|||++||||+||+||||||||||||||||||+
T Consensus       160 Gt~A~Ii~k~~~~~~vkLPSge~r~i~~~c~AtiG~vsn~~~~~~~~gKAG~~r~lg~RP~VRGvAMNpvdHPhGGG~gk  239 (276)
T 2j01_D          160 GTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGR  239 (276)
T ss_dssp             SCCEEECCCBTTEEEEECTTSCEEEEETTSEEEESCCSCGGGGGCCCCSHHHHTTTTBCCCCCSSSSCTTTCSSCCSSSS
T ss_pred             CCEEEEEEECCCEEEEEECCCCEEEECCCCEEEEEECCCCCHHCCCCCCCCHHHCCCCCCCCCEECCCCCCCCCCCCCCC
T ss_conf             98499999739868999558666975687889998826832000300476554548999977730238887998998989


Q ss_pred             CCCCCCCCCCCCEECCCCCCCCC-CCCCEEEEEECCC
Q ss_conf             88888788788734377254888-8886149962346
Q gi|254780258|r  240 TSGGRNPCSPWGKLTKGKRTRSN-KSTDVFIARSRHK  275 (278)
Q Consensus       240 t~~gr~~~spwG~~~kg~kTr~~-k~~~~~i~~~r~~  275 (278)
                      +++|++|+||||++|+|++||++ |.+|+||+++|++
T Consensus       240 ~~~gr~p~spwG~~~kg~ktrk~~k~~~~~i~~~rkk  276 (276)
T 2j01_D          240 APRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK  276 (276)
T ss_dssp             CCCSSSCBCTTCCBCSSCCCSCTTSSCCSSEEC----
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCC
T ss_conf             8987669798887589866788888877678863579



>3ofq_C 50S ribosomal protein L2; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 3fik_C 2wwq_C 3ofr_C* 3i1n_C 1vs8_C 1vs6_C 2aw4_C 2awb_C 2vhm_C 2vhn_C 3bbx_C 3df2_C 3df4_C 1vt2_C 3i1p_C 3i1r_C 3i1t_C 3i20_C 3i22_C 3kcr_6 ... Back     alignment and structure
>3bbo_E Ribosomal protein L2; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2zkr_a 60S ribosomal protein L8; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_B 3jyw_B Back     alignment and structure
>1vq8_A 50S ribosomal protein L2P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.3 b.40.4.5 PDB: 1vq4_A* 1vq5_A* 1vq6_A* 1vq7_A* 1s72_A* 1vq9_A* 1vqk_A* 1vql_A* 1vqm_A* 1vqn_A* 1vqo_A* 1vqp_A* 1yhq_A* 1yi2_A* 1yij_A* 1yit_A* 1yj9_A* 1yjn_A* 1yjw_A* 2otj_A* ... Back     alignment and structure
>2ftc_B Mitochondrial ribosomal protein L2; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_B Back     alignment and structure
>1rl2_A Protein (ribosomal protein L2); RNA-binding domain, peptidyltransferease center, X-RAY diffraction; 2.30A {Geobacillus stearothermophilus} SCOP: b.34.5.3 b.40.4.5 PDB: 1c04_A 487d_I Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
d2j01d1147 b.34.5.3 (D:127-273) C-terminal domain of ribosomal pro 1e-44
d2qamc1145 b.34.5.3 (C:125-269) C-terminal domain of ribosomal pro 2e-43
d1vqoa1147 b.34.5.3 (A:91-237) C-terminal domain of ribosomal prot 5e-38
d2j01d2125 b.40.4.5 (D:2-126) N-terminal domain of ribosomal prote 1e-33
d2zjra295 b.40.4.5 (A:33-127) N-terminal domain of ribosomal prot 6e-26
d1vqoa290 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protei 4e-19
d2qamc264 b.40.4.5 (C:61-124) N-terminal domain of ribosomal prot 2e-18
d1rl2a266 b.40.4.5 (A:60-125) N-terminal domain of ribosomal prot 3e-18
d1rl2a170 b.34.5.3 (A:126-195) C-terminal domain of ribosomal pro 6e-20
>d2j01d1 b.34.5.3 (D:127-273) C-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]} Length = 147 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: C-terminal domain of ribosomal protein L2
domain: C-terminal domain of ribosomal protein L2
species: Thermus thermophilus [TaxId: 274]
 Score =  173 bits (441), Expect = 1e-44
 Identities = 83/145 (57%), Positives = 105/145 (72%), Gaps = 1/145 (0%)

Query: 128 GNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHS 187
           GNA+PLRFIPVG++VH VE++P KG +++R+AG+ A++  R+    +LRL SGE+R VH 
Sbjct: 2   GNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHG 61

Query: 188 SCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPC 247
            C A++GAV N DH N+   KAGR+RWLG R HVRG AMNPVDHPHGGGEG+   GR P 
Sbjct: 62  ECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPA 121

Query: 248 SPWGKLTKGKRTRS-NKSTDVFIAR 271
           SPWG  TKG +TR   K +  FI  
Sbjct: 122 SPWGWQTKGLKTRKRRKPSSRFIIA 146


>d2qamc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]} Length = 145 Back     information, alignment and structure
>d1vqoa1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 147 Back     information, alignment and structure
>d2j01d2 b.40.4.5 (D:2-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]} Length = 125 Back     information, alignment and structure
>d2zjra2 b.40.4.5 (A:33-127) N-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]} Length = 95 Back     information, alignment and structure
>d1vqoa2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 90 Back     information, alignment and structure
>d2qamc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]} Length = 64 Back     information, alignment and structure
>d1rl2a2 b.40.4.5 (A:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]} Length = 66 Back     information, alignment and structure
>d1rl2a1 b.34.5.3 (A:126-195) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]} Length = 70 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
d2j01d1147 C-terminal domain of ribosomal protein L2 {Thermus ther 100.0
d2qamc1145 C-terminal domain of ribosomal protein L2 {Escherichia 100.0
d1vqoa1147 C-terminal domain of ribosomal protein L2 {Archaeon Hal 100.0
d2j01d2125 N-terminal domain of ribosomal protein L2 {Thermus ther 100.0
d2zjra295 N-terminal domain of ribosomal protein L2 {Deinococcus 100.0
d1vqoa290 N-terminal domain of ribosomal protein L2 {Archaeon Hal 99.89
d1rl2a170 C-terminal domain of ribosomal protein L2 {Bacillus ste 99.94
d1rl2a266 N-terminal domain of ribosomal protein L2 {Bacillus ste 99.88
d2qamc264 N-terminal domain of ribosomal protein L2 {Escherichia 99.85
>d2j01d1 b.34.5.3 (D:127-273) C-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: C-terminal domain of ribosomal protein L2
domain: C-terminal domain of ribosomal protein L2
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=450.73  Aligned_cols=146  Identities=57%  Similarity=1.023  Sum_probs=143.2

Q ss_pred             CCCCHHHHHCCCCCEEEEEEEECCCCEEEEEECCCEEEEEEECCCEEEEEECCCCEEEECCCCEEEEEEECCCCCCCCCC
Q ss_conf             57411044357463776233303688258863465189967508889999489758998567809998512553323001
Q gi|254780258|r  127 PGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNH  206 (278)
Q Consensus       127 ~Gn~lpL~~IP~Gt~I~NIE~~pG~Ggkl~RsAGt~a~Ii~k~~~~~~ikLPSGe~r~i~~~c~AtIG~vsN~~~~~~~~  206 (278)
                      +||+|||.+||+||+|||||+.||+|||||||||+||+|+++|+++++|||||||+++|+++|+||||+|||.+|.++++
T Consensus         1 iGN~lPL~~IP~Gt~I~NIE~~PG~Ggkl~RsAGt~A~Ii~k~~~~~~vkLPSGe~r~i~~~c~AtiG~vsn~~~~~~~~   80 (147)
T d2j01d1           1 VGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVL   80 (147)
T ss_dssp             TTCEEEGGGSCTTCEEESEESSTTSCEEESCSSSCCEEECCCBTTEEEEECTTSCEEEEETTSEEEESCCSCGGGGGCCC
T ss_pred             CCCCCCHHHCCCCCEEEEEEECCCCCCEEEEECCCEEEEEEECCCEEEEEECCCCEEEECCCCEEEEEEECCHHHHHHHH
T ss_conf             96520372588998789887448998428872263478998638869999557745994066528986743524533222


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCC-CCCCCEEEEEE
Q ss_conf             3134410057799701233268747888888888888878878873437725488-88886149962
Q gi|254780258|r  207 AKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRS-NKSTDVFIARS  272 (278)
Q Consensus       207 gKAG~~Rwlg~RP~VRGvAMNpvDHPhGGGeGkt~~gr~~~spwG~~~kg~kTr~-~k~~~~~i~~~  272 (278)
                      +|||++||||+||+||||||||||||||||||++++|++|+||||++|||++||+ +|++|+|||+|
T Consensus        81 gKAG~~r~~g~rP~VRGvaMNpvdHPhGGG~g~~~~g~~~~spwG~~~kg~ktRk~~k~~~~~i~~r  147 (147)
T d2j01d1          81 GKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFIIAR  147 (147)
T ss_dssp             CSHHHHTTTTBCCCCCSSSSCTTTCSSCCSSSSCCCSSSCBCTTCCBCSSCCCSCTTSSCCSSEEC-
T ss_pred             HHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEC
T ss_conf             1467777566765343263247508899988886999799798763178866888988778768859



>d2qamc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqoa1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2j01d2 b.40.4.5 (D:2-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2zjra2 b.40.4.5 (A:33-127) N-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1vqoa2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1rl2a1 b.34.5.3 (A:126-195) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rl2a2 b.40.4.5 (A:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qamc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 278 50S ribosomal protein L2 [Candidatus Liberibacter
2j01_D_49-276228 (D:49-276) 50S ribosomal protein L2; ribosome, tRN 7e-60
1rl2_A_137 (A:) Protein (ribosomal protein L2); RNA-binding d 3e-42
3bbo_E_62-198137 (E:62-198) Ribosomal protein L2; large ribosomal s 6e-42
1vq8_A_1-168168 (A:1-168) 50S ribosomal protein L2P; ribosome 50S, 1e-40
2zkr_a_1-177177 (a:1-177) 60S ribosomal protein L8; protein-RNA co 1e-39
3i1n_C_70-200_260-273145 (C:70-200,C:260-273) 50S ribosomal protein L2; rib 4e-39
2ftc_B_28-136109 (B:28-136) Mitochondrial ribosomal protein L2; mit 7e-32
1giy_D_57-14084 (D:57-140) 50S ribosomal protein L2; ribosome asse 7e-26
1giy_D_1-5656 (D:1-56) 50S ribosomal protein L2; ribosome assemb 3e-18
3i1n_C_1-69_201-23099 (C:1-69,C:201-230) 50S ribosomal protein L2; ribos 2e-17
3i1n_C_1-69_201-23099 (C:1-69,C:201-230) 50S ribosomal protein L2; ribos 6e-08
>2j01_D (D:49-276) 50S ribosomal protein L2; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 228 Back     alignment and structure
 Score =  224 bits (573), Expect = 7e-60
 Identities = 123/229 (53%), Positives = 161/229 (70%), Gaps = 3/229 (1%)

Query: 49  VTMRFRGGGHKNRYRLVDFKRGE-YGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAP 107
           +T+RFRGGGHK  YR++DFKR +  G+   V  +EYDPNR+A IAL+ Y +G   YI+AP
Sbjct: 1   ITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRYIIAP 60

Query: 108 QRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVE 167
             L VG +V++   A  ++ GNA+PLRFIPVG++VH VE++P KG +++R+AG+ A++  
Sbjct: 61  DGLQVGQQVVAGPDA-PIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQG 119

Query: 168 RDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVRGVAMN 227
           R+    +LRL SGE+R VH  C A++GAV N DH N+   KAGR+RWLG R HVRG AMN
Sbjct: 120 REGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMN 179

Query: 228 PVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRS-NKSTDVFIARSRHK 275
           PVDHPHGGGEG+   GR P SPWG  TKG +TR   K +  FI   R K
Sbjct: 180 PVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK 228


>1rl2_A (A:) Protein (ribosomal protein L2); RNA-binding domain, peptidyltransferease center, X-RAY diffraction; 2.30A {Geobacillus stearothermophilus}Length = 137 Back     alignment and structure
>3bbo_E (E:62-198) Ribosomal protein L2; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 137 Back     alignment and structure
>1vq8_A (A:1-168) 50S ribosomal protein L2P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 168 Back     alignment and structure
>2zkr_a (a:1-177) 60S ribosomal protein L8; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_BLength = 177 Back     alignment and structure
>3i1n_C (C:70-200,C:260-273) 50S ribosomal protein L2; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_C 2aw4_C 2awb_C 2vhm_C 2vhn_C 3bbx_C 3df2_C 3df4_C 1vs6_C 3i1p_C 3i1r_C 3i1t_C 3i20_C 3i22_C 2qam_C* 1p85_A 1p86_A 2i2v_C 2i2t_C* 2qao_C* ...Length = 145 Back     alignment and structure
>2ftc_B (B:28-136) Mitochondrial ribosomal protein L2; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_BLength = 109 Back     alignment and structure
>1giy_D (D:57-140) 50S ribosomal protein L2; ribosome assembly, protein synthesis, LIFE; 5.50A {Thermus thermophilus}Length = 84 Back     alignment and structure
>1giy_D (D:1-56) 50S ribosomal protein L2; ribosome assembly, protein synthesis, LIFE; 5.50A {Thermus thermophilus}Length = 56 Back     alignment and structure
>3i1n_C (C:1-69,C:201-230) 50S ribosomal protein L2; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_C 2aw4_C 2awb_C 2vhm_C 2vhn_C 3bbx_C 3df2_C 3df4_C 1vs6_C 3i1p_C 3i1r_C 3i1t_C 3i20_C 3i22_C 2qam_C* 1p85_A 1p86_A 2i2v_C 2i2t_C* 2qao_C* ...Length = 99 Back     alignment and structure
>3i1n_C (C:1-69,C:201-230) 50S ribosomal protein L2; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_C 2aw4_C 2awb_C 2vhm_C 2vhn_C 3bbx_C 3df2_C 3df4_C 1vs6_C 3i1p_C 3i1r_C 3i1t_C 3i20_C 3i22_C 2qam_C* 1p85_A 1p86_A 2i2v_C 2i2t_C* 2qao_C* ...Length = 99 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target278 50S ribosomal protein L2 [Candidatus Liberibacter asiat
2j01_D_49-276228 50S ribosomal protein L2; ribosome, tRNA, paromomy 100.0
1vq8_A_1-168168 50S ribosomal protein L2P; ribosome 50S, protein-p 100.0
2zkr_a_1-177177 60S ribosomal protein L8; protein-RNA complex, 60S 100.0
1rl2_A_137 Protein (ribosomal protein L2); RNA-binding domain 100.0
3i1n_C_70-200_260-273145 50S ribosomal protein L2; ribosome structure, prot 100.0
3bbo_E_62-198137 Ribosomal protein L2; large ribosomal subunit, spi 100.0
2ftc_B_28-136109 Mitochondrial ribosomal protein L2; mitochondrial 100.0
1giy_D_57-14084 50S ribosomal protein L2; ribosome assembly, prote 99.97
3i1n_C_1-69_201-23099 50S ribosomal protein L2; ribosome structure, prot 100.0
1giy_D_1-5656 50S ribosomal protein L2; ribosome assembly, prote 99.8
>2j01_D (D:49-276) 50S ribosomal protein L2; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=0  Score=653.48  Aligned_cols=226  Identities=54%  Similarity=0.986  Sum_probs=219.6

Q ss_pred             EEEEEECCCCCCEEEEEEEEEC-CCCCCEEEEEEEECCCCEEEEEEEECCCCCEEEEECCCCCCCCCEEEECCCCCCCCC
Q ss_conf             8788647875102687988633-777604788764158852588984147763467516456610457883666767575
Q gi|254780258|r   49 VTMRFRGGGHKNRYRLVDFKRG-EYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYILAPQRLSVGDKVISSDSAVDVKP  127 (278)
Q Consensus        49 ITvrhRGGGhKr~yR~IDf~r~-~~~~~~~V~~IeYDPnRsa~IALv~~~~g~~~YIlAp~gl~vGd~I~s~~~~~~i~~  127 (278)
                      ||+|||||||||+||+|||+|. +.+++++|++|||||||||+||||.|+|++++|||||++|++||.|.++..+ ++.+
T Consensus         1 It~rhrggg~kr~yr~Id~~r~~~~~~~~~V~~I~ydp~Rsa~IAlv~~~~g~~~yIla~~g~~~Gd~I~~~~~~-~~~~   79 (228)
T 2j01_D            1 ITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRYIIAPDGLQVGQQVVAGPDA-PIQV   79 (228)
T ss_dssp             BSSTTBCCCCCCCBCCCCCCCGGGTTCCEEEEECCCCTTCSSCEEEEEETTSCEEEEECCTTCCTTCEECBSSSS-CSST
T ss_pred             EEEEECCCCCEEEEEEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCCCEEEEEECCHHCCCCCEEECCCCC-CCCC
T ss_conf             879982698236778862000335687657899986266313579998079979999677110037245036756-6544


Q ss_pred             CCCHHHHHCCCCCEEEEEEEECCCCEEEEEECCCEEEEEEECCCEEEEEECCCCEEEECCCCEEEEEEECCCCCCCCCCC
Q ss_conf             74110443574637762333036882588634651899675088899994897589985678099985125533230013
Q gi|254780258|r  128 GNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHA  207 (278)
Q Consensus       128 Gn~lpL~~IP~Gt~I~NIE~~pG~Ggkl~RsAGt~a~Ii~k~~~~~~ikLPSGe~r~i~~~c~AtIG~vsN~~~~~~~~g  207 (278)
                      ||++||.+||+||+|||||+.||+||||||||||||+|++|++++++|||||||+++|+++|+||||+|||.+|.+++++
T Consensus        80 Gn~~pL~~iP~Gt~I~NIE~~pg~gg~~~RsAGt~a~ii~k~~~~~~ikLPSG~~k~i~~~c~AtiG~vsn~~~~~~~~g  159 (228)
T 2j01_D           80 GNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVLG  159 (228)
T ss_dssp             TCEEEGGGSCTTCEEESEESSTTSCEEESCSSSCCEEECCCBTTEEEEECTTSCEEEEETTSEEEESCCSCGGGGGCCCC
T ss_pred             CCCCCEEECCCCEEEEEEEECCCCCCEEEECCCCEEEEEEECCCEEEEEECCCCEEEEECCCCEEEEEECCHHHHCHHHC
T ss_conf             64111010567508764520137784464215631789986287589996587558722337468888646112110110


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCC-CCCCEEEEEECCC
Q ss_conf             1344100577997012332687478888888888888788788734377254888-8886149962346
Q gi|254780258|r  208 KAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSN-KSTDVFIARSRHK  275 (278)
Q Consensus       208 KAG~~Rwlg~RP~VRGvAMNpvDHPhGGGeGkt~~gr~~~spwG~~~kg~kTr~~-k~~~~~i~~~r~~  275 (278)
                      |||++||||+||+||||||||||||||||||+++++++|+||||++++|++||+. |.+|++|+++|++
T Consensus       160 KAG~~r~~g~rP~VRGvAMNpvDHPhGGG~g~~~g~~~~vspwG~~~k~~~tr~~~r~~~~~i~~~r~~  228 (228)
T 2j01_D          160 KAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK  228 (228)
T ss_dssp             SHHHHTTTTBCCCCCSSSSCTTTCSSCCSSSSCCCSSSCBCTTCCBCSSCCCSCTTSSCCSSEEC----
T ss_pred             CHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCC
T ss_conf             046765467455466223588768989989897998679798887689865788998777568863679



>1vq8_A (A:1-168) 50S ribosomal protein L2P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>2zkr_a (a:1-177) 60S ribosomal protein L8; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_B Back     alignment and structure
>1rl2_A (A:) Protein (ribosomal protein L2); RNA-binding domain, peptidyltransferease center, X-RAY diffraction; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>3i1n_C (C:70-200,C:260-273) 50S ribosomal protein L2; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_C 2aw4_C 2awb_C 2vhm_C 2vhn_C 3bbx_C 3df2_C 3df4_C 1vs6_C 3i1p_C 3i1r_C 3i1t_C 3i20_C 3i22_C 2qam_C* 1p85_A 1p86_A 2i2v_C 2i2t_C* 2qao_C* ... Back     alignment and structure
>3bbo_E (E:62-198) Ribosomal protein L2; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2ftc_B (B:28-136) Mitochondrial ribosomal protein L2; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_B Back     alignment and structure
>1giy_D (D:57-140) 50S ribosomal protein L2; ribosome assembly, protein synthesis, LIFE; 5.50A {Thermus thermophilus} Back     alignment and structure
>3i1n_C (C:1-69,C:201-230) 50S ribosomal protein L2; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_C 2aw4_C 2awb_C 2vhm_C 2vhn_C 3bbx_C 3df2_C 3df4_C 1vs6_C 3i1p_C 3i1r_C 3i1t_C 3i20_C 3i22_C 2qam_C* 1p85_A 1p86_A 2i2v_C 2i2t_C* 2qao_C* ... Back     alignment and structure
>1giy_D (D:1-56) 50S ribosomal protein L2; ribosome assembly, protein synthesis, LIFE; 5.50A {Thermus thermophilus} Back     alignment and structure