254780267

254780267

acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

GeneID in NCBI database:8209248Locus tag:CLIBASIA_00760
Protein GI in NCBI database:254780267Protein Accession:YP_003064680.1
Gene range:+(148507, 149022)Protein Length:171aa
Gene description:acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
COG prediction:[I] Biotin carboxyl carrier protein
KEGG prediction:accB; acetyl-CoA carboxylase biotin carboxyl carrier protein subunit (EC:6.4.1.2); K02160 acetyl-CoA carboxylase biotin carboxyl carrier protein
SEED prediction:Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Pathway involved in KEGG:Pyruvate metabolism [PATH:las00620]
Propanoate metabolism [PATH:las00640]
Fatty acid biosynthesis [PATH:las00061]
Tetracycline biosynthesis
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MTDKKQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEKTGDNK
cccccccccHHHHHHHHHHHHHccccEEEEEcccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEccccEEEEEccccccccEEccccEEccccEEEEEEccccccEEEcccccEEEEEEcccccEEccccEEEEEEcccccc
cccHHHcccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccEEccccEEEEEEEccEEEEEEccccEEEEEEccccccEEccccEEEEEccccccc
MTDKKQKINLTLIRNLANIlnetnlteveidndgmrirllrspqkdtvtnyysednknnhslvgfppsstidntppesdlipllspdnyhtvtspmvgtaylasspgsdpfvnkgnlvvEGQTLLIIEAMKTMNhivapcsgkvqdinvkdgqsveyGDALLVLEKTGDNK
MTDKKQKINLTLIRNlanilnetnlteveidndgmrirllrspqkDTVTnyysednknnhslVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQsveygdallvlektgdnk
MTDKKQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEKTGDNK
******K***TLIRNLANILNETNLTEVEIDNDGMRIRLLRSP***********************************************TVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLV*EKT****
MTDKKQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEKTGDNK
****KQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSP********************************************NYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEKT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDKKQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEKTGDNK
MTDKKQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEKTGDNK
MTDKKQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEKTGDNK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target171 acetyl-CoA carboxylase biotin carboxyl carrier protein
254781052 436 dihydrolipoamide succinyltransferase [Candidatus L 0.027
>gi|254781052|ref|YP_003065465.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 436 Back     alignment
 Score = 29.6 bits (65), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 115 GNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDAL 161
           G  V  G+ L+ +E  K    + +P SGK+ +++V  G +V YG  L
Sbjct: 45  GESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFL 91

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target171 acetyl-CoA carboxylase biotin carboxyl carrier protein
315122825165 acetyl-CoA carboxylase biotin carboxyl carrier protein 1 2e-65
150396175158 acetyl-CoA carboxylase biotin carboxyl carrier protein 1 5e-31
49475571163 acetyl-CoA carboxylase biotin carboxyl carrier protein 1 1e-30
163868282165 acetyl-CoA carboxylase biotin carboxyl carrier protein 1 2e-30
15965073158 acetyl-CoA carboxylase biotin carboxyl carrier protein 1 4e-30
222085640155 acetyl-CoA carboxylase, biotin carboxyl carrier protein 1 2e-29
110634067155 biotin carboxyl carrier protein [Mesorhizobium sp. BNC1 1 2e-29
49474254163 acetyl-CoA carboxylase biotin carboxyl carrier protein 1 3e-29
121602597160 acetyl-CoA carboxylase biotin carboxyl carrier protein 1 4e-29
325292690161 acetyl-CoA carboxylase biotin carboxyl carrier protein 1 7e-29
>gi|315122825|ref|YP_004063314.1| acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 165 Back     alignment and organism information
 Score =  251 bits (641), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/170 (73%), Positives = 145/170 (85%), Gaps = 5/170 (2%)

Query: 1   MTDKKQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNH 60
           MTDKKQKINLTL+RNLANILNETNLTEVE+D+DGMRIRLLRSPQK+T+TNYYSE+NK+ H
Sbjct: 1   MTDKKQKINLTLVRNLANILNETNLTEVEVDSDGMRIRLLRSPQKNTITNYYSEENKDTH 60

Query: 61  SLVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVE 120
            L+  P  ST      ES+ +    PDN + VTSPMVGTAYLASSP SDPFV K ++V++
Sbjct: 61  PLIEIPTHST-----SESEALSPPKPDNSYIVTSPMVGTAYLASSPESDPFVEKESVVLK 115

Query: 121 GQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEKTGDN 170
           GQTLLIIEAMKTMNHIVAPCSGK+Q+INVK+GQ VEYG+ LLVLEKT +N
Sbjct: 116 GQTLLIIEAMKTMNHIVAPCSGKIQNINVKNGQLVEYGETLLVLEKTEEN 165


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396175|ref|YP_001326642.1| acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Sinorhizobium medicae WSM419] Length = 158 Back     alignment and organism information
>gi|49475571|ref|YP_033612.1| acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Bartonella henselae str. Houston-1] Length = 163 Back     alignment and organism information
>gi|163868282|ref|YP_001609491.1| acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Bartonella tribocorum CIP 105476] Length = 165 Back     alignment and organism information
>gi|15965073|ref|NP_385426.1| acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Sinorhizobium meliloti 1021] Length = 158 Back     alignment and organism information
>gi|222085640|ref|YP_002544170.1| acetyl-CoA carboxylase, biotin carboxyl carrier protein [Agrobacterium radiobacter K84] Length = 155 Back     alignment and organism information
>gi|110634067|ref|YP_674275.1| biotin carboxyl carrier protein [Mesorhizobium sp. BNC1] Length = 155 Back     alignment and organism information
>gi|49474254|ref|YP_032296.1| acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Bartonella quintana str. Toulouse] Length = 163 Back     alignment and organism information
>gi|121602597|ref|YP_989058.1| acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Bartonella bacilliformis KC583] Length = 160 Back     alignment and organism information
>gi|325292690|ref|YP_004278554.1| acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Agrobacterium sp. H13-3] Length = 161 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target171 acetyl-CoA carboxylase biotin carboxyl carrier protein
PRK06302155 PRK06302, PRK06302, acetyl-CoA carboxylase biotin carbo 5e-38
TIGR00531156 TIGR00531, BCCP, acetyl-CoA carboxylase, biotin carboxy 4e-22
PRK09282592 PRK09282, PRK09282, pyruvate carboxylase subunit B; Val 1e-20
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Lipid m 1e-25
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or biotin 2e-19
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 3e-16
PRK0705180 PRK07051, PRK07051, hypothetical protein; Validated 1e-14
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protein of 3e-14
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 1e-13
PRK14040593 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisi 2e-11
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 8e-11
COG4770645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alp 2e-10
COG10381149 COG1038, PycA, Pyruvate carboxylase [Energy production 2e-10
PRK06549130 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carbo 2e-10
TIGR012351143 TIGR01235, pyruv_carbox, pyruvate carboxylase 1e-08
TIGR01108582 TIGR01108, oadA, oxaloacetate decarboxylase alpha subun 2e-08
KOG03691176 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy 3e-08
KOG0238670 KOG0238, KOG0238, KOG0238, 3-Methylcrotonyl-CoA carboxy 5e-08
PRK05641153 PRK05641, PRK05641, putative acetyl-CoA carboxylase bio 6e-08
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domai 6e-07
PRK0822570 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carbo 3e-06
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolip 2e-05
COG0508 404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase co 2e-05
TIGR01347 403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex d 5e-05
PRK11856 411 PRK11856, PRK11856, branched-chain alpha-keto acid dehy 1e-04
PRK0588971 PRK05889, PRK05889, putative acetyl-CoA carboxylase bio 2e-04
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; 4e-04
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase compl 4e-04
PRK14042596 PRK14042, PRK14042, pyruvate carboxylase subunit B; Pro 0.001
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; 0.002
PRK02597 1331 PRK02597, rpoC2, DNA-directed RNA polymerase subunit be 0.002
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 0.004
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or biotin 2e-05
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 3e-04
PRK14040593 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisi 0.002
>gnl|CDD|180522 PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|129622 TIGR00531, BCCP, acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>gnl|CDD|181754 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>gnl|CDD|30857 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|144088 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|180811 PRK07051, PRK07051, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|178564 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|183835 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|184472 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|162983 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|34383 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|31240 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180616 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|162205 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|35590 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|35459 KOG0238, KOG0238, KOG0238, 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|168146 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|30854 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162309 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|183339 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|180306 PRK05889, PRK05889, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|179447 PRK02597, rpoC2, DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|183835 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|184472 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 171 acetyl-CoA carboxylase biotin carboxyl carrier protein
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier protein 100.0
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 100.0
TIGR00531159 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier pr 99.97
PRK0705180 hypothetical protein; Validated 99.98
PRK129991147 pyruvate carboxylase; Reviewed 99.91
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 99.91
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 99.91
PRK09282580 pyruvate carboxylase subunit B; Validated 99.9
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 99.85
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 99.84
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 99.83
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 99.81
TIGR012351169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 99.81
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 99.81
COG10381149 PycA Pyruvate carboxylase [Energy production and conver 99.8
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 99.74
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 99.71
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 99.6
KOG03691176 consensus 99.54
KOG0238670 consensus 99.53
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 99.33
PRK11855 549 dihydrolipoamide acetyltransferase; Reviewed 99.26
PTZ00144 430 dihydrolipoamide succinyltransferase; Provisional 99.2
PRK11855 549 dihydrolipoamide acetyltransferase; Reviewed 99.19
PRK05704 406 dihydrolipoamide succinyltransferase; Validated 99.17
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 99.13
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 99.07
PRK11854 630 aceF dihydrolipoamide acetyltransferase; Validated 99.07
PRK11856 324 branched-chain alpha-keto acid dehydrogenase subunit E2 99.05
PRK11854 630 aceF dihydrolipoamide acetyltransferase; Validated 99.02
TIGR01347 435 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr 98.95
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 98.86
KOG0559 457 consensus 98.83
PRK11578 347 macrolide transporter subunit MacA; Provisional 98.29
KOG0368 2196 consensus 98.28
PRK10559 310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 98.06
KOG0557 470 consensus 98.03
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterized sub 98.02
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterized sub 98.02
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterized sub 98.02
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 97.85
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor; Rev 97.81
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 97.8
TIGR02927 607 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, 97.8
PRK09859 385 multidrug efflux system protein MdtE; Provisional 97.79
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxylase sy 97.69
PRK00624113 glycine cleavage system protein H; Provisional 97.66
TIGR03077110 not_gcvH glycine cleavage protein H homolog, Chlamydial 97.65
PRK09783 407 copper/silver efflux system membrane fusion protein Cus 97.61
KOG0558 474 consensus 97.59
TIGR01349 584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 97.57
PRK05352 448 Na(+)-translocating NADH-quinone reductase subunit A; P 97.56
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the Succ 97.56
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterized sub 97.46
PRK09439169 glucose-specific PTS system component; Provisional 97.43
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage H-pr 97.38
PRK0674884 hypothetical protein; Validated 97.37
PRK10255648 N-acetyl glucosamine specific PTS system components IIA 97.35
TIGR01945 444 rnfC electron transport complex, RnfABCDGE type, C subu 97.33
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterized sub 97.33
TIGR00527132 gcvH glycine cleavage system H protein; InterPro: IPR00 97.31
COG0509131 GcvH Glycine cleavage system H protein (lipoate-binding 97.29
COG3608331 Predicted deacylase [General function prediction only] 97.28
pfam06898 383 YqfD Putative stage IV sporulation protein YqfD. This f 97.28
TIGR02927 607 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, 97.25
PRK01202127 glycine cleavage system protein H; Provisional 97.23
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 97.21
PRK1278484 hypothetical protein; Provisional 97.21
PRK09824625 beta-glucoside-specific PTS system components IIABC; Pr 97.19
PRK05035 725 electron transport complex protein RnfC; Provisional 97.17
PRK13380132 glycine cleavage system protein H; Provisional 97.14
pfam01597122 GCV_H Glycine cleavage H-protein. This is a family of g 97.09
COG2190156 NagE Phosphotransferase system IIA components [Carbohyd 96.84
pfam04952289 AstE_AspA Succinylglutamate desuccinylase / Aspartoacyl 96.61
pfam05896 257 NQRA Na(+)-translocating NADH-quinone reductase subunit 96.53
TIGR01995660 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIA 96.5
KOG3373172 consensus 96.38
TIGR01349 584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 95.84
TIGR01936 466 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocatin 94.58
PRK09824625 beta-glucoside-specific PTS system components IIABC; Pr 94.35
PRK10255648 N-acetyl glucosamine specific PTS system components IIA 94.12
COG1726 447 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, s 93.89
PRK09603 2890 DNA-directed RNA polymerase subunit beta/beta'; Reviewe 92.95
pfam09891149 DUF2118 Uncharacterized protein conserved in archaea (D 92.03
PRK09439169 glucose-specific PTS system component; Provisional 91.97
COG2190156 NagE Phosphotransferase system IIA components [Carbohyd 91.93
KOG0368 2196 consensus 91.81
TIGR01995660 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIA 90.69
PRK05305214 phosphatidylserine decarboxylase; Provisional 90.38
PRK03598331 hypothetical protein; Provisional 98.18
PRK10476348 multidrug resistance protein MdtN; Provisional 98.08
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 97.5
pfam00358133 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphot 97.26
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 97.21
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specif 97.13
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 97.07
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 96.98
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 96.98
COG1566 352 EmrA Multidrug resistance efflux pump [Defense mechanis 96.97
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor; Rev 96.92
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.87
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 96.81
PRK09282580 pyruvate carboxylase subunit B; Validated 96.53
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 96.49
PRK09859 385 multidrug efflux system protein MdtE; Provisional 96.44
TIGR00830129 PTBA PTS system, glucose subfamily, IIA component; Inte 96.39
TIGR01843 434 type_I_hlyD type I secretion membrane fusion protein, H 96.37
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 96.16
PRK129991147 pyruvate carboxylase; Reviewed 96.09
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 95.94
TIGR012351169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 95.84
COG0845 372 AcrA Membrane-fusion protein [Cell envelope biogenesis, 95.17
COG10381149 PycA Pyruvate carboxylase [Energy production and conver 94.77
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 94.5
TIGR00999 284 8a0102 Membrane Fusion Protein cluster 2 protein; Inter 93.45
KOG0238670 consensus 93.31
PRK04350502 thymidine phosphorylase; Provisional 92.39
PRK1278484 hypothetical protein; Provisional 91.21
PRK09783 407 copper/silver efflux system membrane fusion protein Cus 90.81
TIGR02645499 ARCH_P_rylase putative thymidine phosphorylase; InterPr 90.63
PRK11578 347 macrolide transporter subunit MacA; Provisional 97.43
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 97.38
PRK10476348 multidrug resistance protein MdtN; Provisional 97.36
PRK03598331 hypothetical protein; Provisional 97.16
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 96.98
TIGR02645499 ARCH_P_rylase putative thymidine phosphorylase; InterPr 95.53
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 95.48
PRK0705180 hypothetical protein; Validated 94.98
COG1566352 EmrA Multidrug resistance efflux pump [Defense mechanis 94.48
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 94.21
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 94.1
PTZ00144 430 dihydrolipoamide succinyltransferase; Provisional 94.07
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 93.15
PRK11637404 hypothetical protein; Provisional 92.2
TIGR02971 363 heterocyst_DevB ABC exporter membrane fusion protein, D 91.92
PRK05704 406 dihydrolipoamide succinyltransferase; Validated 91.77
PRK02597 1295 DNA-directed RNA polymerase subunit beta'; Provisional 90.01
TIGR02876 406 spore_yqfD sporulation protein YqfD; InterPro: IPR01069 96.52
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein; InterPro: IPR001249 The proteins in this family are a component of the acetyl coenzyme A carboxylase complex (6 Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>KOG0557 consensus Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H homolog, Chlamydial Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>KOG0558 consensus Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK09439 glucose-specific PTS system component; Provisional Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK10255 N-acetyl glucosamine specific PTS system components IIABC; Provisional Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>pfam06898 YqfD Putative stage IV sporulation protein YqfD Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK09824 beta-glucoside-specific PTS system components IIABC; Provisional Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>pfam01597 GCV_H Glycine cleavage H-protein Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family Back     alignment and domain information
>pfam05896 NQRA Na(+)-translocating NADH-quinone reductase subunit A (NQRA) Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component; InterPro: IPR011297 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>KOG3373 consensus Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit; InterPro: IPR008703 This family consists of several bacterial Na^+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PRK09824 beta-glucoside-specific PTS system components IIABC; Provisional Back     alignment and domain information
>PRK10255 N-acetyl glucosamine specific PTS system components IIABC; Provisional Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>PRK09603 DNA-directed RNA polymerase subunit beta/beta'; Reviewed Back     alignment and domain information
>pfam09891 DUF2118 Uncharacterized protein conserved in archaea (DUF2118) Back     alignment and domain information
>PRK09439 glucose-specific PTS system component; Provisional Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component; InterPro: IPR011297 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>PRK05305 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>pfam00358 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 protein; InterPro: IPR005695 Gram-negative bacteria have evolved transport complexes that export macromolecules and toxic substances such as heavy metals across the two membranes of the cell envelope in a single energy coupled step Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>PRK04350 thymidine phosphorylase; Provisional Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase; InterPro: IPR013466 Proteins in this entry are closely related to characterised examples of thymidine phosphorylase (2 Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase; InterPro: IPR013466 Proteins in this entry are closely related to characterised examples of thymidine phosphorylase (2 Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family; InterPro: IPR014315 Members of this protein are found mostly in the Cyanobacteria, but also in the Planctomycetes Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PRK02597 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>TIGR02876 spore_yqfD sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target171 acetyl-CoA carboxylase biotin carboxyl carrier protein
1a6x_A87 Structure Of The Apo-Biotin Carboxyl Carrier Protei 2e-13
3bdo_A82 Solution Structure Of Apo-Biotinyl Domain From Acet 3e-12
1bdo_A80 Structure Of The Biotinyl Domain Of Acetyl-Coenzyme 5e-12
2d5d_A74 Structure Of Biotin Carboxyl Carrier Protein (74val 3e-07
1dcz_A77 Biotin Carboxyl Carrier Domain Of Transcarboxylase 2e-04
1o78_A84 Biotin Carboxyl Carrier Domain Of Transcarboxylase 5e-04
2ejm_A99 Solution Structure Of Ruh-072, An Apo-Biotnyl Domai 6e-04
3duf_I 428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 0.002
3n6r_A681 Crystal Structure Of The Holoenzyme Of Propionyl-Co 0.004
3bg5_A1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 6e-10
3hbl_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 7e-10
3ho8_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 7e-10
3hb9_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 7e-10
2qf7_A1165 Crystal Structure Of A Complete Multifunctional Pyr 3e-06
3bg3_A718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 1e-04
3bg9_A718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 1e-04
2jku_A94 Crystal Structure Of The N-Terminal Region Of The B 5e-05
>gi|157829716|pdb|1A6X|A Chain A, Structure Of The Apo-Biotin Carboxyl Carrier Protein (Apo- Bccp87) Of Escherichia Coli Acetyl-Coa Carboxylase, Nmr, 49 Structures Length = 87 Back     alignment and structure
 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 50/86 (58%)

Query: 80  LIPLLSPDNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAP 139
             P  +  + H V SPMVGT Y   SP +  F+  G  V  G TL I+EAMK MN I A 
Sbjct: 2   EAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEAD 61

Query: 140 CSGKVQDINVKDGQSVEYGDALLVLE 165
            SG V+ I V+ GQ VE+ + L+V+E
Sbjct: 62  KSGTVKAILVESGQPVEFDEPLVVIE 87


>gi|4930213|pdb|3BDO|A Chain A, Solution Structure Of Apo-Biotinyl Domain From Acetyl Coenzyme A Carboxylase Of Escherichia Coli Determined By Triple-Resonance Nmr Spectroscopy Length = 82 Back     alignment and structure
>gi|157830241|pdb|1BDO|A Chain A, Structure Of The Biotinyl Domain Of Acetyl-Coenzyme A Carboxylase Determined By Mad Phasing Length = 80 Back     alignment and structure
>gi|99032022|pdb|2D5D|A Chain A, Structure Of Biotin Carboxyl Carrier Protein (74val Start) From Pyrococcus Horikoshi Ot3 Ligand Free Form Ii Length = 74 Back     alignment and structure
>gi|159162200|pdb|1DCZ|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (Tc 1.3s) Length = 77 Back     alignment and structure
>gi|159162771|pdb|1O78|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (1.3s) [10-48] Deletion Mutant Length = 84 Back     alignment and structure
>gi|159164398|pdb|2EJM|A Chain A, Solution Structure Of Ruh-072, An Apo-Biotnyl Domain Form Human Acetyl Coenzyme A Carboxylase Length = 99 Back     alignment and structure
gi|219689228|pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure
gi|304445935|pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-Coa Carboxylase (Pcc) Length = 681 Back     alignment and structure
>gi|168988872|pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>gi|242556622|pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
gi|242556707|pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>gi|242556615|pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>gi|158430175|pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>gi|168988868|pdb|3BG3|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) Length = 718 Back     alignment and structure
>gi|168988876|pdb|3BG9|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) F1077a Mutant Length = 718 Back     alignment and structure
>gi|198443038|pdb|2JKU|A Chain A, Crystal Structure Of The N-Terminal Region Of The Biotin Acceptor Domain Of Human Propionyl-Coa Carboxylase Length = 94 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target171 acetyl-CoA carboxylase biotin carboxyl carrier protein
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 1e-21
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi-funct 6e-19
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 7e-17
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 2e-14
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 3e-13
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 3e-13
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 8e-13
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 1e-12
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 2e-12
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 3e-12
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 3e-12
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 1e-11
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 1e-10
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 1e-10
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 1e-10
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 1e-08
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 6e-08
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase component 5e-07
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric assem 3e-04
1zy8_K 229 Pyruvate dehydrogenase protein X component, mitochondri 0.001
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 1e-19
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 3e-18
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 0.003
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 0.004
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 0.003
3lnn_A 359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 8e-04
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, beta 0.002
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, lipo 0.002
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Length = 80 Back     alignment and structure
 Score = 97.7 bits (243), Expect = 1e-21
 Identities = 38/76 (50%), Positives = 47/76 (61%)

Query: 90  HTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINV 149
           H V SPMVGT Y   SP +  F+  G  V  G TL I+EAMK MN I A  SG V+ I V
Sbjct: 5   HIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILV 64

Query: 150 KDGQSVEYGDALLVLE 165
           + GQ VE+ + L+V+E
Sbjct: 65  ESGQPVEFDEPLVVIE 80


>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Length = 1165 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, polymorphism, disease mutation, nucleotide-binding; HET: PG4; 1.5A {Homo sapiens} Length = 94 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Length = 341 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans} Length = 359 Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Length = 369 Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport protein; 2.71A {Escherichia coli} Length = 277 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target171 acetyl-CoA carboxylase biotin carboxyl carrier protein
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 99.95
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 99.93
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi-funct 99.9
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 99.88
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 99.87
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 99.83
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 99.82
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 99.79
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 99.75
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 99.75
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 99.73
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 99.69
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 99.68
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 99.63
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 99.49
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 99.49
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 99.49
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 99.43
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 99.31
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 99.26
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 99.24
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 99.15
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 99.14
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase component 98.94
1zy8_K 229 Pyruvate dehydrogenase protein X component, mitochondri 98.9
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.42
3fmc_A368 Putative succinylglutamate desuccinylase / aspartoacyla 97.94
3h9i_A 407 Cation efflux system protein CUSB; three-helix bundle, 97.9
3lnn_A 359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 97.85
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; structur 97.77
2qj8_A332 MLR6093 protein; NP_106651.1, uncharacterized protein M 97.56
1zko_A136 Glycine cleavage system H protein; TM0212, structural g 97.38
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phosphotrans 97.35
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, decod 97.33
3klr_A125 Glycine cleavage system H protein; antiparallel beta sh 97.31
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransferase 97.31
3a7l_A128 H-protein, glycine cleavage system H protein; lipoic ac 97.3
3mxu_A143 Glycine cleavage system H protein; seattle structural g 97.28
1onl_A128 Glycine cleavage system H protein; hybrid barrel-sandwi 97.27
1hpc_A131 H protein of the glycine cleavage system; transit pepti 97.11
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, lipo 96.88
2gpr_A154 Glucose-permease IIA component; phosphotransferase, enz 96.85
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich-barre 96.39
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric assem 96.0
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phosphotrans 95.65
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransferase 94.15
2gpr_A154 Glucose-permease IIA component; phosphotransferase, enz 93.43
3d4r_A169 Domain of unknown function from the PFAM-B_34464; struc 91.91
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, beta 97.24
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 97.16
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 97.14
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 97.09
3lnn_A 359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 96.89
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi-funct 96.54
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 96.37
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 96.36
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, lipo 94.4
3h9i_A 407 Cation efflux system protein CUSB; three-helix bundle, 91.38
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric assem 97.19
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 97.03
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 96.86
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 96.79
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 96.69
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 96.64
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 96.48
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 95.56
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 95.55
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 95.5
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 95.38
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 95.26
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 94.63
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, beta 94.28
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 93.8
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 93.54
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 93.5
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 93.12
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 93.03
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 92.56
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
Probab=99.95  E-value=3.8e-28  Score=190.01  Aligned_cols=78  Identities=49%  Similarity=0.705  Sum_probs=76.0

Q ss_pred             CCCEEEECCCEEEEEECCCCCCCEECCCCCEEECCEEEEEECCCEEEEEECCCCCEEEEEECCCCCCCCCCCEEEEEE
Q ss_conf             662687046256774036764100012442010434899973772689998998199999848986836997299995
Q gi|254780267|r   88 NYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLE  165 (171)
Q Consensus        88 ~~~~I~SPmvGtfy~~psP~~~~~V~vGd~Vk~G~~l~iiEAMKm~n~I~a~~~G~I~~i~v~~G~~V~~gq~L~~i~  165 (171)
                      .++.|+|||+|+|||+|+|+.++||++||+|++||+||+||||||+++|.||++|+|.+|+|++|+.|++||+||+||
T Consensus         3 sg~~V~aPm~G~~~~~~~p~~~~~V~~Gd~V~~g~~l~~iEamK~~~~i~a~~~G~V~~i~v~~G~~V~~G~~L~~ie   80 (80)
T 1bdo_A            3 SGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE   80 (80)
T ss_dssp             CSEEEECSSSEEEESSSSTTSCCSCCTTCEECTTCEEEEEEETTEEEEEECSSCEEEEEECSCTTCEECTTCEEEEEC
T ss_pred             CCCEEECCCCEEEEECCCCCCCCEECCCCEEECCCEEEEEEECCCHHHCCCCCCEEEEEEEECCCCEECCCCEEEEEC
T ss_conf             899985898779981469999853268999966878999997620120659999899899868979989999999979



>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.5A {Homo sapiens} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspartoacylase; YP_926482.1, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Shewanella amazonensis SB2B} PDB: 3lwu_A* Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2qj8_A MLR6093 protein; NP_106651.1, uncharacterized protein MLR6093, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Mesorhizobium loti MAFF303099} Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} PDB: 2edg_A Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back