254780268

254780268

acetyl-CoA carboxylase biotin carboxylase subunit

GeneID in NCBI database:8209249Locus tag:CLIBASIA_00765
Protein GI in NCBI database:254780268Protein Accession:YP_003064681.1
Gene range:+(149019, 150350)Protein Length:443aa
Gene description:acetyl-CoA carboxylase biotin carboxylase subunit
COG prediction:[I] Biotin carboxylase
KEGG prediction:acetyl-CoA carboxylase biotin carboxylase subunit (EC:6.4.1.2); K01961 acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
SEED prediction:Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)
Pathway involved in KEGG:Pyruvate metabolism [PATH:las00620]
Propanoate metabolism [PATH:las00640]
Fatty acid biosynthesis [PATH:las00061]
Tetracycline biosynthesis
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK
ccEEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccHHHHccEEEEccccccHHHHccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHccccEEcccHHHHHHHHcHHHHHHHHHHcccccccccccccHHHHHHHHHHccccEEEEEccccccccEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEEEEEEcccccEEEEcccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHcccHHHHHHHHHcccccccccccccccccEEEEEEEccccccccccccEEEEEEccccccEEEEEEEEEccccccccccEEEEEEEEcccHHHHHHHHHHHHHHEEEEcccccHHHHHHHHccHHHHcccccHHHHHHHccc
cccEEEEcccHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHccEEEEEEcccHHHccccHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHcccEEccccHHHHHHHHcHHHHHHHHHHHcccEccEcccccHHHHHHHHHHHcccEEEEEccccccccEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEccEEEEEEEEccccccHHHHHHHHcccHHHHHHHHHccccccccHHHcccccEEEEEEEEEEccccccEccEEccEEEccccccEEEEEccccccEEccccccEEEEEEEEEccHHHHHHHHHHHHHHcEEEcccEcHHHHHHHHccHHHHHccccccHHHHHHcc
MISKILIANRGEIALRILRACKElgiptvavhstadsgAMHVRLAdesvcigppsskdsyLNIQQIVAACEvtgadaihpgygflsenAKFAEILEDHhikfigpssehIKIMGDKITAKKTaqqlgipvvpgsgevyphtampiakeIGFPVLVkasaggggrgmriaysenDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFgdgmgnaihfgerdcsvqRRNQKIWEeahspvisaqdrTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMntrlqvehpvteaitgIDLVHEQIYVASEnrlsvqqkditfsghaiecrinaedpenfipnpgeityfhapgglgirmdsasyqgytvpsyYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIknediiegnydiHWLENKYLK
miskiliaNRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEeahspvisaqdrteIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKnediiegnydihwlenkylk
MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK
MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK
MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK
MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK
MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK
MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target443 acetyl-CoA carboxylase biotin carboxylase subunit [Cand
2547804391162 carbamoyl phosphate synthase large subunit [Candid 6e-09
254780439 1162 carbamoyl phosphate synthase large subunit [Candid 3e-05
254780206424 phosphoribosylamine--glycine ligase [Candidatus Li 1e-06
>gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Back     alignment
 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 96/230 (41%), Gaps = 42/230 (18%)

Query: 90  KFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYP-HTAMPIAKE 148
           K ++ILE + I  +G   + I +  D+   +K   +L +   P +G  +    A  IA E
Sbjct: 712 KLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQ-PRNGISHSVEHARLIACE 770

Query: 149 IGFPVLVKASAGGGGRGMRIAYSENDLSEAI-----------------DQARSEALAAFG 191
           IGFP+L++ S   GGR M+I YSEN L + +                 +    +     G
Sbjct: 771 IGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLG 830

Query: 192 NDAVYIEKYLENPRHIEV-------QIFGDGM-----GNAIHFGERDCSVQRRNQKIWEE 239
              +  + YL +   I+V       Q+   G+        IH G+  CS+  R+      
Sbjct: 831 THPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRS------ 884

Query: 240 AHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTR 289
                +S Q + E+          ++  G   +++  ++G+ Y +E+N R
Sbjct: 885 -----LSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPR 929

>gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Back     alignment
 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 78/188 (41%), Gaps = 17/188 (9%)

Query: 148 EIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHI 207
           EIG P++++ S   GG G  IAY+ ++  E ++      L A     V IE+ +   +  
Sbjct: 214 EIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVEN----GLHASPTTEVLIEESVLGWKEY 269

Query: 208 EVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHS----PVISAQDR--TEIGETCVKAM 261
           E+++  D  GN I      CS++  +        S    P ++  D+    +    +  +
Sbjct: 270 ELEMMRDIKGNCIVV----CSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVL 325

Query: 262 KKIDYR-GAGTIEFLY--ENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRL 318
           K+I    G   ++F    +NG+   IEMN R+     +    TG  +      +A    L
Sbjct: 326 KEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTL 385

Query: 319 SVQQKDIT 326
                DIT
Sbjct: 386 DELGNDIT 393

>gi|254780206|ref|YP_003064619.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Back     alignment
 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 8/113 (7%)

Query: 100 IKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASA 159
            K  GPS    K+   K  AKK   + GIP         P  A    +    P++VKA  
Sbjct: 87  FKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADG 146

Query: 160 GGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIF 212
              G+G+ +A + ++ + AID+   +      N  V IE+YLE     EV  F
Sbjct: 147 LCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEG---FEVSFF 191

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target443 acetyl-CoA carboxylase biotin carboxylase subunit [Cand
315122826446 acetyl-CoA carboxylase biotin carboxylase subunit [Cand 1 0.0
325292689448 Biotin carboxylase [Agrobacterium sp. H13-3] Length = 4 1 0.0
222148332450 acetyl-CoA carboxylase biotin carboxylase subunit [Agro 1 0.0
114704667448 acetyl-CoA carboxylase [Fulvimarina pelagi HTCC2506] Le 1 0.0
150396174447 acetyl-CoA carboxylase biotin carboxylase subunit [Sino 1 0.0
195970180449 acetyl-CoA carboxylase biotin carboxylase subunit [Sino 1 0.0
307301143447 acetyl-CoA carboxylase, biotin carboxylase [Sinorhizobi 1 0.0
227821676447 acetyl-CoA carboxylase biotin carboxylase subunit [Sino 1 0.0
116251848451 acetyl-CoA carboxylase biotin carboxylase subunit [Rhiz 1 0.0
86357495449 acetyl-CoA carboxylase biotin carboxylase subunit [Rhiz 1 0.0
>gi|315122826|ref|YP_004063315.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 446 Back     alignment and organism information
 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/443 (89%), Positives = 424/443 (95%), Gaps = 1/443 (0%)

Query: 1   MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLADESVCIGPPSSKDSY 60
           MISKILIANRGEIALRILRACKELGI TVAVHSTADS AMHVRLADESVCIGPPSSK+SY
Sbjct: 1   MISKILIANRGEIALRILRACKELGISTVAVHSTADSSAMHVRLADESVCIGPPSSKESY 60

Query: 61  LNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIGPSSEHIKIMGDKITAK 120
           LNIQQIVAACEVTGADA+HPGYGFLSENAKFAEILE H+IKFIGPSSEHIKIMGDKITAK
Sbjct: 61  LNIQQIVAACEVTGADAVHPGYGFLSENAKFAEILEAHNIKFIGPSSEHIKIMGDKITAK 120

Query: 121 KTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGGRGMRIAYSENDLSEAID 180
           +TAQ+LGIPVVPGSGE+   TAMPIA++IGFPVLVKASAGGGGRGMRIA+SE +L EAI+
Sbjct: 121 ETAQKLGIPVVPGSGEICVRTAMPIAQKIGFPVLVKASAGGGGRGMRIAHSEKNLIEAIN 180

Query: 181 QARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEA 240
           QARSE+L+AFG+DAVYIEKYL+ PRHIE+QIFGDG GNAIHFGERDCSVQRRNQKIWEEA
Sbjct: 181 QARSESLSAFGSDAVYIEKYLKKPRHIEIQIFGDGKGNAIHFGERDCSVQRRNQKIWEEA 240

Query: 241 HSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAI 300
           HS +ISAQDR EIGE CV+AMKKI+YRGAGT+EFLYENGQFYFIEMNTRLQVEHP+TEAI
Sbjct: 241 HS-LISAQDRAEIGEICVQAMKKIEYRGAGTVEFLYENGQFYFIEMNTRLQVEHPITEAI 299

Query: 301 TGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAEDPENFIPNPGEITYFHAPGGL 360
           TGIDLVHEQIYVASEN LS+QQKDI FSGHAIECRINAEDPENFIPNPG IT+FHAPGGL
Sbjct: 300 TGIDLVHEQIYVASENNLSIQQKDIVFSGHAIECRINAEDPENFIPNPGTITHFHAPGGL 359

Query: 361 GIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRLNRALNEIIIDGIKTTIPLFQK 420
           GIRMDSASYQGYTVP +YDSLIAKLIVHGKNR ECMMRL+RALNEIIIDGIKTTIPLFQK
Sbjct: 360 GIRMDSASYQGYTVPPHYDSLIAKLIVHGKNRNECMMRLDRALNEIIIDGIKTTIPLFQK 419

Query: 421 LIKNEDIIEGNYDIHWLENKYLK 443
           LIKNEDII+GNYDIHWLE+ YLK
Sbjct: 420 LIKNEDIIQGNYDIHWLEDNYLK 442


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325292689|ref|YP_004278553.1| Biotin carboxylase [Agrobacterium sp. H13-3] Length = 448 Back     alignment and organism information
>gi|222148332|ref|YP_002549289.1| acetyl-CoA carboxylase biotin carboxylase subunit [Agrobacterium vitis S4] Length = 450 Back     alignment and organism information
>gi|114704667|ref|ZP_01437575.1| acetyl-CoA carboxylase [Fulvimarina pelagi HTCC2506] Length = 448 Back     alignment and organism information
>gi|150396174|ref|YP_001326641.1| acetyl-CoA carboxylase biotin carboxylase subunit [Sinorhizobium medicae WSM419] Length = 447 Back     alignment and organism information
>gi|195970180|ref|NP_385425.3| acetyl-CoA carboxylase biotin carboxylase subunit [Sinorhizobium meliloti 1021] Length = 449 Back     alignment and organism information
>gi|307301143|ref|ZP_07580912.1| acetyl-CoA carboxylase, biotin carboxylase [Sinorhizobium meliloti BL225C] Length = 447 Back     alignment and organism information
>gi|227821676|ref|YP_002825646.1| acetyl-CoA carboxylase biotin carboxylase subunit [Sinorhizobium fredii NGR234] Length = 447 Back     alignment and organism information
>gi|116251848|ref|YP_767686.1| acetyl-CoA carboxylase biotin carboxylase subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 451 Back     alignment and organism information
>gi|86357495|ref|YP_469387.1| acetyl-CoA carboxylase biotin carboxylase subunit [Rhizobium etli CFN 42] Length = 449 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target443 acetyl-CoA carboxylase biotin carboxylase subunit [Cand
PRK08591451 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carbo 0.0
TIGR00514449 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxy 0.0
PRK08654499 PRK08654, PRK08654, pyruvate carboxylase subunit A; Val 0.0
PRK05586447 PRK05586, PRK05586, biotin carboxylase; Validated 0.0
PRK06111450 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carbo 1e-180
PRK12999 1146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 1e-173
COG4770 645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alp 1e-169
PRK12833467 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carbo 1e-161
PRK08462445 PRK08462, PRK08462, biotin carboxylase; Validated 1e-161
KOG0238 670 KOG0238, KOG0238, KOG0238, 3-Methylcrotonyl-CoA carboxy 1e-154
PRK07178472 PRK07178, PRK07178, pyruvate carboxylase subunit A; Val 1e-154
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy production 1e-142
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 1e-139
TIGR02712 1201 TIGR02712, urea_carbox, urea carboxylase 1e-137
PRK08463478 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; V 1e-134
KOG0369 1176 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy 1e-127
KOG0368 2196 KOG0368, KOG0368, KOG0368, Acetyl-CoA carboxylase [Lipi 2e-73
COG0439449 COG0439, AccC, Biotin carboxylase [Lipid metabolism] 1e-172
pfam02786211 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L 4e-70
PRK128151068 PRK12815, carB, carbamoyl phosphate synthase large subu 1e-16
TIGR013691050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, 6e-16
PLN027351102 PLN02735, PLN02735, carbamoyl-phosphate synthase 3e-11
KOG03701435 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine s 4e-07
COG0151428 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucl 9e-07
pfam02222171 pfam02222, ATP-grasp, ATP-grasp domain 6e-06
PRK14569296 PRK14569, PRK14569, D-alanyl-alanine synthetase A; Prov 9e-06
pfam08443190 pfam08443, RimK, RimK-like ATP-grasp domain 0.004
pfam00289109 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase 1e-44
smart00878107 smart00878, Biotin_carb_C, Biotin carboxylase C-termina 5e-44
pfam02785107 pfam02785, Biotin_carb_C, Biotin carboxylase C-terminal 1e-40
COG0458400 COG0458, CarB, Carbamoylphosphate synthase large subuni 2e-18
TIGR01205315 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase 5e-14
COG1181317 COG1181, DdlA, D-alanine-D-alanine ligase and related A 2e-11
PRK12815 1068 PRK12815, carB, carbamoyl phosphate synthase large subu 3e-11
PRK01966333 PRK01966, ddl, D-alanyl-alanine synthetase A; Reviewed 1e-09
PRK14573809 PRK14573, PRK14573, bifunctional D-alanyl-alanine synth 3e-07
PRK02186 887 PRK02186, PRK02186, argininosuccinate lyase; Provisiona 9e-07
COG0189318 COG0189, RimK, Glutathione synthase/Ribosomal protein S 8e-05
PRK14571299 PRK14571, PRK14571, D-alanyl-alanine synthetase A; Prov 4e-04
PRK14568343 PRK14568, vanB, D-alanine--D-lactate ligase; Provisiona 0.002
pfam07478201 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-termin 6e-12
PRK01372304 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed 5e-10
PRK14570364 PRK14570, PRK14570, D-alanyl-alanine synthetase A; Prov 3e-04
PRK052941066 PRK05294, carB, carbamoyl phosphate synthase large subu 1e-11
PRK05294 1066 PRK05294, carB, carbamoyl phosphate synthase large subu 1e-07
PRK14016 727 PRK14016, PRK14016, cyanophycin synthetase; Provisional 2e-05
TIGR02144280 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX 1e-04
PLN02735 1102 PLN02735, PLN02735, carbamoyl-phosphate synthase 2e-04
PRK13790379 PRK13790, PRK13790, phosphoribosylamine--glycine ligase 4e-04
TIGR02068 864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 6e-04
TIGR00877423 TIGR00877, purD, phosphoribosylamine--glycine ligase 8e-04
PLN02948 577 PLN02948, PLN02948, phosphoribosylaminoimidazole carbox 0.001
TIGR00768277 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK fa 0.002
PRK13789426 PRK13789, PRK13789, phosphoribosylamine--glycine ligase 0.004
TIGR01369 1050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, 1e-10
TIGR01161352 TIGR01161, purK, phosphoribosylaminoimidazole carboxyla 1e-10
COG0026375 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase 6e-10
KOG0370 1435 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine s 0.001
PRK12767326 PRK12767, PRK12767, carbamoyl phosphate synthase-like p 5e-10
COG0027394 COG0027, PurT, Formate-dependent phosphoribosylglycinam 9e-08
PRK06019372 PRK06019, PRK06019, phosphoribosylaminoimidazole carbox 4e-07
TIGR01142380 TIGR01142, purT, phosphoribosylglycinamide formyltransf 5e-06
PLN02257434 PLN02257, PLN02257, phosphoribosylamine--glycine ligase 8e-05
>gnl|CDD|181492 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|181524 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|183835 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|34383 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>gnl|CDD|181436 PRK08462, PRK08462, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|35459 KOG0238, KOG0238, KOG0238, 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|31240 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|162983 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|35590 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|35589 KOG0368, KOG0368, KOG0368, Acetyl-CoA carboxylase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30788 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|145768 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>gnl|CDD|183765 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|162321 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|178336 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30500 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|145401 pfam02222, ATP-grasp, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|173033 PRK14569, PRK14569, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|117020 pfam08443, RimK, RimK-like ATP-grasp domain Back     alignment and domain information
>gnl|CDD|144029 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>gnl|CDD|129111 smart00878, Biotin_carb_C, Biotin carboxylase C-terminal domain Back     alignment and domain information
>gnl|CDD|145767 pfam02785, Biotin_carb_C, Biotin carboxylase C-terminal domain Back     alignment and domain information
>gnl|CDD|30806 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|162248 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase Back     alignment and domain information
>gnl|CDD|31374 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183765 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|179356 PRK01966, ddl, D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>gnl|CDD|184752 PRK14573, PRK14573, bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|167327 PRK02186, PRK02186, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|30538 COG0189, RimK, Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|184751 PRK14571, PRK14571, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|184750 PRK14568, vanB, D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>gnl|CDD|148851 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus Back     alignment and domain information
>gnl|CDD|179288 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|173034 PRK14570, PRK14570, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|179998 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|179998 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|184454 PRK14016, PRK14016, cyanophycin synthetase; Provisional Back     alignment and domain information
>gnl|CDD|131199 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX Back     alignment and domain information
>gnl|CDD|178336 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|184328 PRK13790, PRK13790, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|162082 TIGR00877, purD, phosphoribosylamine--glycine ligase Back     alignment and domain information
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>gnl|CDD|162031 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>gnl|CDD|184327 PRK13789, PRK13789, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|162321 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|162228 TIGR01161, purK, phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>gnl|CDD|30376 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|183732 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|30377 COG0027, PurT, Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|180352 PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>gnl|CDD|130212 TIGR01142, purT, phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>gnl|CDD|177899 PLN02257, PLN02257, phosphoribosylamine--glycine ligase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 443 acetyl-CoA carboxylase biotin carboxylase subunit [Cand
TIGR00514451 accC acetyl-CoA carboxylase, biotin carboxylase; InterP 100.0
TIGR02712 1226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 100.0
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 100.0
PRK08591449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 100.0
PRK12999 1147 pyruvate carboxylase; Reviewed 100.0
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 100.0
PRK06111449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 100.0
PRK08654497 pyruvate carboxylase subunit A; Validated 100.0
PRK07178471 acetyl-CoA carboxylase; Validated 100.0
PRK05586447 biotin carboxylase; Validated 100.0
PRK08463478 acetyl-CoA carboxylase; Validated 100.0
PRK08462446 biotin carboxylase; Validated 100.0
PRK12833458 acetyl-CoA carboxylase biotin carboxylase subunit; Prov 100.0
KOG0238 670 consensus 100.0
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 100.0
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 100.0
KOG0369 1176 consensus 100.0
KOG0368 2196 consensus 100.0
TIGR013691089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 100.0
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 100.0
KOG0370 1435 consensus 100.0
KOG0237 788 consensus 99.84
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 100.0
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 100.0
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 100.0
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 100.0
PRK02186 892 argininosuccinate lyase; Provisional 100.0
KOG03701435 consensus 100.0
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 100.0
PRK07206415 hypothetical protein; Provisional 99.97
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 99.97
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 99.96
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 99.96
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotide tra 99.95
PRK05784485 phosphoribosylamine--glycine ligase; Provisional 99.94
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 99.94
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 99.92
COG2232389 Predicted ATP-dependent carboligase related to biotin c 99.86
TIGR01142407 purT phosphoribosylglycinamide formyltransferase 2; Int 99.8
PRK052941063 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK128151068 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 100.0
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 99.97
PRK06849387 hypothetical protein; Provisional 99.89
PRK10446300 ribosomal protein S6 modification protein; Provisional 99.86
TIGR00768321 rimK_fam alpha-L-glutamate ligases, RimK family; InterP 99.83
TIGR02144289 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IP 99.83
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 modifica 99.74
COG3919415 Predicted ATP-grasp enzyme [General function prediction 99.34
PRK05246316 glutathione synthetase; Provisional 98.3
TIGR01380322 glut_syn glutathione synthase; InterPro: IPR006284 Thes 95.71
pfam02786211 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP b 100.0
pfam08443190 RimK RimK-like ATP-grasp domain. This ATP-grasp domain 99.91
TIGR01016389 sucCoAbeta succinyl-CoA synthetase, beta subunit; Inter 98.63
TIGR02291320 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterP 98.24
PRK12458349 glutathione synthetase; Provisional 97.43
TIGR01205375 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: 100.0
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 100.0
PRK01966344 ddl D-alanyl-alanine synthetase A; Reviewed 100.0
TIGR01161386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 100.0
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 99.93
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 99.73
PRK13278356 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 99.17
PRK13277363 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuran 99.1
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranos 98.95
pfam00289109 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N- 100.0
pfam0284499 GARS_N Phosphoribosylglycinamide synthetase, N domain. 96.44
pfam06849124 DUF1246 Protein of unknown function (DUF1246). This fam 95.8
PRK10124464 putative UDP-glucose lipid carrier transferase; Provisi 91.14
pfam02785107 Biotin_carb_C Biotin carboxylase C-terminal domain. Bio 100.0
smart00878107 Biotin_carb_C Biotin carboxylase C-terminal domain. Bio 100.0
pfam01071193 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp 99.96
pfam02222171 ATP-grasp ATP-grasp domain. This family does not contai 99.96
pfam07478201 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This fam 99.95
pfam02655160 ATP-grasp_3 ATP-grasp domain. No functional information 99.86
pfam08442202 ATP-grasp_2 ATP-grasp domain. 98.89
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy prod 98.68
pfam02955176 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp 98.27
pfam05770307 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase 97.43
pfam02750203 Synapsin_C Synapsin, ATP binding domain. Ca dependent A 96.44
TIGR01285451 nifN nitrogenase molybdenum-iron cofactor biosynthesis 91.46
TIGR02068 876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 99.71
pfam11379355 DUF3182 Protein of unknown function (DUF3182). This fam 97.39
PRK02471753 bifunctional glutamate--cysteine ligase/glutathione syn 99.44
PRK06524480 biotin carboxylase-like protein; Validated 99.43
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) 99.43
KOG3895488 consensus 96.55
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisional 98.71
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 92.35
pfam03133291 TTL Tubulin-tyrosine ligase family. Tubulins and microt 96.85
KOG2157497 consensus 91.36
PRK06241 870 phosphoenolpyruvate synthase; Validated 95.58
PRK06988313 putative formyltransferase; Provisional 93.56
PRK09248246 putative hydrolase; Validated 93.26
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 93.44
PRK00912237 ribonuclease P protein component 3; Provisional 93.19
CHL00194319 ycf39 Ycf39; Provisional 93.08
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nucleot 90.98
cd01968410 Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup of th 93.06
cd01965428 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: 90.68
pfam09370268 TIM-br_sig_trns TIM-barrel signal transduction protein. 92.51
KOG2799434 consensus 92.49
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) fa 92.24
cd01976421 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitro 90.82
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 90.13
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549 This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK07178 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase; InterPro: IPR000115 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2; InterPro: IPR005862 The formation of isosinate, a precursor of adenylate and guanylate, from 5-phosphoribosyl 1-pyrophosphate in the de novo purine biosynthesis pathway is basically composed of 10 steps of reactions Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family; InterPro: IPR004666 Escherichia coli RimK adds additional Glu residues to the native Glu-Glu C-terminus of ribosomal protein S6 Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IPR011870 The family of proteins found in this family include the characterised LysX from Thermus thermophilus which is part of a well-organised lysine biosynthesis gene cluster Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthase; InterPro: IPR006284 These are the glutathione synthetases found in Gram-negative bacteria Back     alignment and domain information
>pfam02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>pfam08443 RimK RimK-like ATP-grasp domain Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterPro: IPR011758 Members of this protein family contain a region of homology to the RimK family of alpha-L-glutamate ligases (IPR004666 from INTERPRO), various members of which modify the Glu-Glu C-terminus of ribosomal protein S6, or tetrahydromethanopterin, or a form of coenzyme F420 derivative Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: IPR005905 D-alanine--D-alanine ligase (6 Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, ATPase subunit; InterPro: IPR005875 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam00289 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>pfam02844 GARS_N Phosphoribosylglycinamide synthetase, N domain Back     alignment and domain information
>pfam06849 DUF1246 Protein of unknown function (DUF1246) Back     alignment and domain information
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional Back     alignment and domain information
>pfam02785 Biotin_carb_C Biotin carboxylase C-terminal domain Back     alignment and domain information
>smart00878 Biotin_carb_C Biotin carboxylase C-terminal domain Back     alignment and domain information
>pfam01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>pfam02222 ATP-grasp ATP-grasp domain Back     alignment and domain information
>pfam07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus Back     alignment and domain information
>pfam02655 ATP-grasp_3 ATP-grasp domain Back     alignment and domain information
>pfam08442 ATP-grasp_2 ATP-grasp domain Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>pfam02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain Back     alignment and domain information
>pfam05770 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase Back     alignment and domain information
>pfam02750 Synapsin_C Synapsin, ATP binding domain Back     alignment and domain information
>TIGR01285 nifN nitrogenase molybdenum-iron cofactor biosynthesis protein NifN; InterPro: IPR005975 The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>pfam11379 DUF3182 Protein of unknown function (DUF3182) Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>KOG3895 consensus Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>pfam03133 TTL Tubulin-tyrosine ligase family Back     alignment and domain information
>KOG2157 consensus Back     alignment and domain information
>PRK06241 phosphoenolpyruvate synthase; Validated Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>PRK09248 putative hydrolase; Validated Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00912 ribonuclease P protein component 3; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd01968 Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup of the NifE subunit of the NifEN complex: NifE forms an alpha2beta2 tetramer with NifN Back     alignment and domain information
>cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like Back     alignment and domain information
>pfam09370 TIM-br_sig_trns TIM-barrel signal transduction protein Back     alignment and domain information
>KOG2799 consensus Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>cd01976 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target443 acetyl-CoA carboxylase biotin carboxylase subunit [Cand
2vqd_A464 Crystal Structure Of Biotin Carboxylase From Pseudo 1e-110
3jzf_A486 Crystal Structure Of Biotin Carboxylase From E. Col 1e-107
1bnc_A449 Three-Dimensional Structure Of The Biotin Carboxyla 1e-106
2gpw_A469 Crystal Structure Of The Biotin Carboxylase Subunit 1e-106
3g8c_A444 Crystal Stucture Of Biotin Carboxylase In Complex W 1e-106
1dv2_A452 The Structure Of Biotin Carboxylase, Mutant E288k, 1e-106
2gps_A469 Crystal Structure Of The Biotin Carboxylase Subunit 1e-106
3g8d_A444 Crystal Structure Of The Biotin Carboxylase Subunit 1e-106
2vpq_A451 Crystal Structure Of Biotin Carboxylase From S. Aur 1e-103
3n6r_A 681 Crystal Structure Of The Holoenzyme Of Propionyl-Co 1e-101
2dzd_A461 Crystal Structure Of The Biotin Carboxylase Domain 1e-100
3hbl_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-100
3hb9_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-100
3bg5_A 1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 1e-100
3ho8_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-100
1ulz_A451 Crystal Structure Of The Biotin Carboxylase Subunit 1e-99
2qf7_A 1165 Crystal Structure Of A Complete Multifunctional Pyr 4e-91
3ouz_A446 Crystal Structure Of Biotin Carboxylase-Adp Complex 2e-81
3jrx_A587 Crystal Structure Of The Bc Domain Of Acc2 In Compl 7e-64
3jrw_A587 Phosphorylated Bc Domain Of Acc2 Length = 587 7e-64
3gid_A540 The Biotin Carboxylase (Bc) Domain Of Human Acetyl- 7e-64
2hjw_A573 Crystal Structure Of The Bc Domain Of Acc2 Length = 8e-64
1w96_A554 Crystal Structure Of Biotin Carboxylase Domain Of A 2e-63
1w93_A553 Crystal Structure Of Biotin Carboxylase Domain Of A 3e-63
1jdb_B 1073 Carbamoyl Phosphate Synthetase From Escherichia Col 1e-34
1jdb_B1073 Carbamoyl Phosphate Synthetase From Escherichia Col 8e-25
1a9x_A 1073 Carbamoyl Phosphate Synthetase: Caught In The Act O 1e-33
1a9x_A