254780269

254780269

leucyl/phenylalanyl-tRNA--protein transferase

GeneID in NCBI database:8209250Locus tag:CLIBASIA_00770
Protein GI in NCBI database:254780269Protein Accession:YP_003064682.1
Gene range:+(150442, 150981)Protein Length:179aa
Gene description:leucyl/phenylalanyl-tRNA--protein transferase
COG prediction:[O] Leu/Phe-tRNA-protein transferase
KEGG prediction:aat; leucyl/phenylalanyl-tRNA--protein transferase (EC:2.3.2.6); K00684 leucyl/phenylalanyl-tRNA--protein transferase [EC:2.3.2.6]
SEED prediction:Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Protein degradation
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL
cccccccccEEEEcccccEEEcHHHccccHHHHHHHccccEEEEEEccHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccEEEEEEEccEEEEEEHHHHHccEEEccccEEEcccHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHccEEccHHHHHHHHHHHHHccccccc
cccccccccEEEEccccccccccccccccHHHHHHHcccccEEEEcHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEEcccEEccEEEEEcccccccccHccccccHHHHHHHHHHHHHHHcccEEEccccccHHHHHccccEccHHHHHHHHHHHHcccccccc
madsansqdiswikplrrgiipletfhtpkrLKKYIRRELYDIRINTAFESVISACAQKtqkrpttwINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAlkhpeisfl
madsansqdiswikplrrgiipletfhtpkrlkkyIRRELYDIRINTAFESVISACaqktqkrpttwiNMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEnalkhpeisfl
MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDvlvgglygvslgavFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL
*****NS*DISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL
********DISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL
******SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL
MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL
MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
315122827181 leucyl/phenylalanyl-tRNA--protein transferase [Candidat 1 1e-77
222085638207 leucyl/phenylalanyl-tRNA--protein transferase [Agrobact 1 7e-57
13470482205 leucyl/phenylalanyl-tRNA--protein transferase [Mesorhiz 1 1e-55
209549134204 leucyl/phenylalanyl-tRNA--protein transferase [Rhizobiu 1 2e-55
325292688204 leucyl/phenylalanyl-tRNA-protein transferase [Agrobacte 1 2e-55
150396173204 leucyl/phenylalanyl-tRNA--protein transferase [Sinorhiz 1 2e-55
15888654204 leucyl/phenylalanyl-tRNA--protein transferase [Agrobact 1 5e-55
15965071204 leucyl/phenylalanyl-tRNA--protein transferase [Sinorhiz 1 2e-54
222148331212 leucyl/phenylalanyl-tRNA--protein transferase [Agrobact 1 4e-54
241204458204 leucyl/phenylalanyl-tRNA--protein transferase [Rhizobiu 1 4e-54
>gi|315122827|ref|YP_004063316.1| leucyl/phenylalanyl-tRNA--protein transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 181 Back     alignment and organism information
 Score =  292 bits (748), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 133/178 (74%), Positives = 156/178 (87%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +S  I+WI+P++RGI+PLE FH  K LKK IRR +YDIRIN AFE VIS+CAQKT
Sbjct: 1   MANSDDSSKIAWIRPIKRGILPLENFHVSKSLKKIIRRGIYDIRINYAFEEVISSCAQKT 60

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           Q RP TWIN TIQK Y+DLF+MGYAH+IEAWK+  LVGGLYG+SLGA+FFGESMFS M+N
Sbjct: 61  QDRPNTWINPTIQKLYVDLFHMGYAHSIEAWKEKKLVGGLYGISLGAIFFGESMFSRMDN 120

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICLTHLV+HLKKRQFLLLD QFITNHLRQFG IEI+H +YA++L+NALKH E+SF
Sbjct: 121 ASKICLTHLVEHLKKRQFLLLDTQFITNHLRQFGTIEISHNKYARILQNALKHSEVSF 178


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085638|ref|YP_002544168.1| leucyl/phenylalanyl-tRNA--protein transferase [Agrobacterium radiobacter K84] Length = 207 Back     alignment and organism information
>gi|13470482|ref|NP_102051.1| leucyl/phenylalanyl-tRNA--protein transferase [Mesorhizobium loti MAFF303099] Length = 205 Back     alignment and organism information
>gi|209549134|ref|YP_002281051.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 204 Back     alignment and organism information
>gi|325292688|ref|YP_004278552.1| leucyl/phenylalanyl-tRNA-protein transferase [Agrobacterium sp. H13-3] Length = 204 Back     alignment and organism information
>gi|150396173|ref|YP_001326640.1| leucyl/phenylalanyl-tRNA--protein transferase [Sinorhizobium medicae WSM419] Length = 204 Back     alignment and organism information
>gi|15888654|ref|NP_354335.1| leucyl/phenylalanyl-tRNA--protein transferase [Agrobacterium tumefaciens str. C58] Length = 204 Back     alignment and organism information
>gi|15965071|ref|NP_385424.1| leucyl/phenylalanyl-tRNA--protein transferase [Sinorhizobium meliloti 1021] Length = 204 Back     alignment and organism information
>gi|222148331|ref|YP_002549288.1| leucyl/phenylalanyl-tRNA--protein transferase [Agrobacterium vitis S4] Length = 212 Back     alignment and organism information
>gi|241204458|ref|YP_002975554.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 204 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
PRK00301233 PRK00301, aat, leucyl/phenylalanyl-tRNA--protein transf 6e-68
pfam03588173 pfam03588, Leu_Phe_trans, Leucyl/phenylalanyl-tRNA prot 3e-51
TIGR00667185 TIGR00667, aat, leucyl/phenylalanyl-tRNA--protein trans 2e-36
COG2360221 COG2360, Aat, Leu/Phe-tRNA-protein transferase [Posttra 2e-58
>gnl|CDD|178969 PRK00301, aat, leucyl/phenylalanyl-tRNA--protein transferase; Reviewed Back     alignment and domain information
>gnl|CDD|112407 pfam03588, Leu_Phe_trans, Leucyl/phenylalanyl-tRNA protein transferase Back     alignment and domain information
>gnl|CDD|161987 TIGR00667, aat, leucyl/phenylalanyl-tRNA--protein transferase Back     alignment and domain information
>gnl|CDD|32507 COG2360, Aat, Leu/Phe-tRNA-protein transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
PRK00301232 aat leucyl/phenylalanyl-tRNA--protein transferase; Revi 100.0
COG2360221 Aat Leu/Phe-tRNA-protein transferase [Posttranslational 100.0
pfam03588173 Leu_Phe_trans Leucyl/phenylalanyl-tRNA protein transfer 100.0
TIGR00667212 aat leucyl/phenylalanyl-tRNA--protein transferase; Inte 100.0
PRK01305241 arginyl-tRNA-protein transferase; Provisional 94.84
>PRK00301 aat leucyl/phenylalanyl-tRNA--protein transferase; Reviewed Back     alignment and domain information
>COG2360 Aat Leu/Phe-tRNA-protein transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam03588 Leu_Phe_trans Leucyl/phenylalanyl-tRNA protein transferase Back     alignment and domain information
>TIGR00667 aat leucyl/phenylalanyl-tRNA--protein transferase; InterPro: IPR004616 Leucyl/phenylalanyl-tRNA--protein transferase 2 Back     alignment and domain information
>PRK01305 arginyl-tRNA-protein transferase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
2z3l_A233 Complex Structure Of Lf-Transferase And Peptide A L 2e-56
2dps_A254 Structure Of LeucylPHENYLALANYL-Trna-Protein Transf 2e-56
2cxa_A256 Crystal Structure Of LeucylPHENYLALANYL-Trna Protei 1e-55
>gi|159795696|pdb|2Z3L|A Chain A, Complex Structure Of Lf-Transferase And Peptide A Length = 233 Back     alignment and structure
 Score =  222 bits (566), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 62/177 (35%), Positives = 91/177 (51%), Gaps = 4/177 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   +   
Sbjct: 50  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDRE--E 107

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 108 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 167

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL--KHPEISFL 179
            L    +        L+D Q + +H    GA EI    Y   L      + P   ++
Sbjct: 168 ALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWV 224


>gi|122919950|pdb|2DPS|A Chain A, Structure Of LeucylPHENYLALANYL-Trna-Protein Transferase Length = 254 Back     alignment and structure
>gi|85544477|pdb|2CXA|A Chain A, Crystal Structure Of LeucylPHENYLALANYL-Trna Protein Transferase From Escherichia Coli Length = 256 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
2cxa_A256 Leucyl/phenylalanyl-tRNA-protein transferase; aminoacyl 2e-50
>2cxa_A Leucyl/phenylalanyl-tRNA-protein transferase; aminoacyl-tRNA, protein degradation, structural genomics, NPPSFA; HET: MSE; 1.60A {Escherichia coli} SCOP: d.108.1.6 PDB: 2dps_A 2dpt_A* 2z3o_A* 2z3k_A* 2z3l_A* 2z3m_A* 2z3n_A* 2z3p_A* Length = 256 Back     alignment and structure
 Score =  193 bits (492), Expect = 2e-50
 Identities = 60/174 (34%), Positives = 86/174 (49%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
                    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  C   +
Sbjct: 66  WFSP--GDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGC--AS 121

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +   TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MEN
Sbjct: 122 DREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMEN 181

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK  L    +        L+D Q + +H    GA EI    Y   L       
Sbjct: 182 ASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGR 235


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
2cxa_A256 Leucyl/phenylalanyl-tRNA-protein transferase; aminoacyl 100.0
3gkr_A336 FEMX; peptidoglycan, hexapeptide, transferase; HET: UDP 96.26
>2cxa_A Leucyl/phenylalanyl-tRNA-protein transferase; aminoacyl-tRNA, protein degradation, structural genomics, NPPSFA; HET: MSE; 1.60A {Escherichia coli} SCOP: d.108.1.6 PDB: 2dps_A 2dpt_A* 2z3o_A* 2z3k_A* 2z3l_A* 2z3m_A* 2z3n_A* 2z3p_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=513.68  Aligned_cols=171  Identities=36%  Similarity=0.607  Sum_probs=164.5

Q ss_pred             CCCCCCCCEEEEECCCCCEEEEHHHCCCCHHHHHHHHCCCCEEEECCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             98887887078873996187424446117457765215881687669889999998502668899872699999999998
Q gi|254780269|r    1 MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLF   80 (179)
Q Consensus         1 Mad~~d~~~i~WwsP~~R~il~~~~~hisrsLrk~lrk~~~~itin~~F~~VI~~Ca~~r~~~~~TWI~~~i~~aY~~Lh   80 (179)
                      |++  +++||+||||+||+||+|++|||||||||.+|++.|+||+|++|++||++||.++  +++||||++|+++|++||
T Consensus        66 w~~--~~~pi~WwsP~pR~Vl~p~~~hisrSLrk~lr~~~f~it~d~~F~~VI~~Ca~~r--~~~TWI~~eii~aY~~LH  141 (256)
T 2cxa_A           66 WFS--PGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDR--EEGTWITRGVVEAYHRLH  141 (256)
T ss_dssp             CCC--TTSCCEEECCSSEEEECGGGCCCCHHHHHHHHTCCCEEEESSCHHHHHHHHHTC-----CTTCCHHHHHHHHHHH
T ss_pred             CCC--CCCCEEEECCCCCEEECCCCCCCCHHHHHHHCCCCEEEEECCCHHHHHHHHCCCC--CCCCCCCHHHHHHHHHHH
T ss_conf             788--9996379827986686777643677788775569759987864799998427889--898478879999999999


Q ss_pred             HCCCEEEEEEEECCCEEEEEEEEEECCCEEEEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHCCCEEECH
Q ss_conf             64982699996537201211023205721200344525768999999999999968973999075893477119798369
Q gi|254780269|r   81 YMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITH  160 (179)
Q Consensus        81 ~~G~aHSvE~w~~~~LvGGlyGv~iG~~F~GESMFs~~~nASKiAl~~L~~~l~~~g~~liD~Q~~t~HL~slGa~~i~r  160 (179)
                      ++|+|||||||++++||||+|||+||++||||||||+++|||||||++|+++|+.+||.|||||++||||+||||++|||
T Consensus       142 ~~G~AHSVEvW~~~~LVGGlYGv~iG~~F~GESMFs~~~nASKvAL~~L~~~L~~~g~~liDcQ~~t~HL~slGA~~I~R  221 (256)
T 2cxa_A          142 ELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPR  221 (256)
T ss_dssp             HTTSEEEEEEEETTEEEEEEEEEEETTEEEEEEEEESSTTHHHHHHHHHHHHHHHTTCCEEEEESCCHHHHHTTCEEECH
T ss_pred             HCCCEEEEEEEECCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHCCCEEECH
T ss_conf             67936999999899888635799768858723410306762599999999999977992999676987798529999589


Q ss_pred             HHHHHHHHHHHHCCC
Q ss_conf             999999999983899
Q gi|254780269|r  161 VQYAKLLENALKHPE  175 (179)
Q Consensus       161 ~~fl~~L~~al~~p~  175 (179)
                      ++|+++|++++.+|.
T Consensus       222 ~eFl~~L~~~~~~~~  236 (256)
T 2cxa_A          222 RDYLNYLNQMRLGRL  236 (256)
T ss_dssp             HHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHHHCCCC
T ss_conf             999999999970789



>3gkr_A FEMX; peptidoglycan, hexapeptide, transferase; HET: UDP UM0 UM1 UM2; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
d2cxaa1232 d.108.1.6 (A:1-232) Leucyl/phenylalanyl-tRNA-protein tr 8e-50
>d2cxaa1 d.108.1.6 (A:1-232) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: LFTR-like
domain: Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat)
species: Escherichia coli [TaxId: 562]
 Score =  190 bits (483), Expect = 8e-50
 Identities = 60/174 (34%), Positives = 86/174 (49%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
                    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  C   +
Sbjct: 49  WFSP--GDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGC--AS 104

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +   TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MEN
Sbjct: 105 DREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMEN 164

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK  L    +        L+D Q + +H    GA EI    Y   L       
Sbjct: 165 ASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGR 218


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
d2cxaa1232 Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat 100.0
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [TaxId: 96.59
d1lrza3182 Methicillin resistance protein FemA {Staphylococcus aur 95.98
>d2cxaa1 d.108.1.6 (A:1-232) Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: LFTR-like
domain: Leucyl/phenylalanyl-tRNA-protein transferase, LFTR (Aat)
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=513.01  Aligned_cols=174  Identities=35%  Similarity=0.600  Sum_probs=165.8

Q ss_pred             CCCCCCCCEEEEECCCCCEEEEHHHCCCCHHHHHHHHCCCCEEEECCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             98887887078873996187424446117457765215881687669889999998502668899872699999999998
Q gi|254780269|r    1 MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLF   80 (179)
Q Consensus         1 Mad~~d~~~i~WwsP~~R~il~~~~~hisrsLrk~lrk~~~~itin~~F~~VI~~Ca~~r~~~~~TWI~~~i~~aY~~Lh   80 (179)
                      |++  +++||+||||+||+||+|++|||||||||.+|+++|+||+|++|++||++||.++  +++|||+++|+++|++||
T Consensus        49 w~~--~~~~i~WwsP~~R~vl~~~~~~iskslrk~lk~~~f~itin~~F~~VI~~Ca~~~--~~~tWI~~~ii~aY~~Lh  124 (232)
T d2cxaa1          49 WFS--PGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDR--EEGTWITRGVVEAYHRLH  124 (232)
T ss_dssp             CCC--TTSCCEEECCSSEEEECGGGCCCCHHHHHHHHTCCCEEEESSCHHHHHHHHHTC-----CTTCCHHHHHHHHHHH
T ss_pred             CCC--CCCCEEEEECCCCEEECCCCCCCCHHHHHHHCCCCCEEEECCHHHHHHHHCCCCC--CCCCCHHHHHHHHHHHHH
T ss_conf             786--9997699960799898777753576899987258966877805899998207899--878040489999999998


Q ss_pred             HCCCEEEEEEEECCCEEEEEEEEEECCCEEEEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHCCCEEECH
Q ss_conf             64982699996537201211023205721200344525768999999999999968973999075893477119798369
Q gi|254780269|r   81 YMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITH  160 (179)
Q Consensus        81 ~~G~aHSvE~w~~~~LvGGlyGv~iG~~F~GESMFs~~~nASKiAl~~L~~~l~~~g~~liD~Q~~t~HL~slGa~~i~r  160 (179)
                      ++|+|||||||++++||||+|||+||++||||||||+++|||||||++|+++|+.+||.+||||++||||+||||++|||
T Consensus       125 ~~G~AHSVEvw~~~~LvGGlYGv~iG~~F~GESMFs~~~nASKvAl~~L~~~L~~~g~~liD~Q~~t~HL~slGa~~I~R  204 (232)
T d2cxaa1         125 ELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPR  204 (232)
T ss_dssp             HTTSEEEEEEEETTEEEEEEEEEEETTEEEEEEEEESSTTHHHHHHHHHHHHHHHTTCCEEEEESCCHHHHHTTCEEECH
T ss_pred             HCCEEEEEEEEECCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHCCCEECCH
T ss_conf             67868998898558068745678728858876410148977899999999999978981999676888898629988289


Q ss_pred             HHHHHHHHHHHHCC--CCCC
Q ss_conf             99999999998389--9887
Q gi|254780269|r  161 VQYAKLLENALKHP--EISF  178 (179)
Q Consensus       161 ~~fl~~L~~al~~p--~~~w  178 (179)
                      ++|+++|++++.+|  ...|
T Consensus       205 ~~fl~~L~~~~~~~~~~~~w  224 (232)
T d2cxaa1         205 RDYLNYLNQMRLGRLPNNFW  224 (232)
T ss_dssp             HHHHHHHHHHTTCCCCTTTT
T ss_pred             HHHHHHHHHHHCCCCCCCCC
T ss_conf             99999999996389986677



>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 179 leucyl/phenylalanyl-tRNA--protein transferase [Can
2cxa_A_79-256178 (A:79-256) Leucyl/phenylalanyl-tRNA-protein transf 1e-52
>2cxa_A (A:79-256) Leucyl/phenylalanyl-tRNA-protein transferase; aminoacyl-tRNA, protein degradation, structural genomics, NPPSFA; HET: MSE; 1.60A {Escherichia coli}Length = 178 Back     alignment and structure
 Score =  200 bits (510), Expect = 1e-52
 Identities = 56/157 (35%), Positives = 78/157 (49%), Gaps = 2/157 (1%)

Query: 18  RGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYI 77
           R ++  E+ H  +  K++ +R  Y +  N AF  VI  CA    +   TWI   + +AY 
Sbjct: 3   RAVLWPESLHISRSXKRFHKRSPYRVTXNYAFGQVIEGCAS--DREEGTWITRGVVEAYH 60

Query: 78  DLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQ 137
            L  +G+AH+IE W++D LVGG YGV+ G +F GES FS  ENASK  L    +      
Sbjct: 61  RLHELGHAHSIEVWREDELVGGXYGVAQGTLFCGESXFSRXENASKTALLVFCEEFIGHG 120

Query: 138 FLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             L+D Q + +H    GA EI    Y   L       
Sbjct: 121 GKLIDCQVLNDHTASLGACEIPRRDYLNYLNQXRLGR 157


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target179 leucyl/phenylalanyl-tRNA--protein transferase [Candidat
2cxa_A_79-256178 Leucyl/phenylalanyl-tRNA-protein transferase; amin 100.0
1ne9_A_138-317180 FEMX; protein, ligase; 1.70A {Weissella viridescen 97.57
>2cxa_A (A:79-256) Leucyl/phenylalanyl-tRNA-protein transferase; aminoacyl-tRNA, protein degradation, structural genomics, NPPSFA; HET: MSE; 1.60A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=455.97  Aligned_cols=160  Identities=35%  Similarity=0.572  Sum_probs=155.3

Q ss_pred             CCCEEEEHHHCCCCHHHHHHHHCCCCEEEECCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             96187424446117457765215881687669889999998502668899872699999999998649826999965372
Q gi|254780269|r   16 LRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDV   95 (179)
Q Consensus        16 ~~R~il~~~~~hisrsLrk~lrk~~~~itin~~F~~VI~~Ca~~r~~~~~TWI~~~i~~aY~~Lh~~G~aHSvE~w~~~~   95 (179)
                      |||+||+|+++||||||+|.+|++.|+|++|++|++||++||.++  +++|||+++|+++|.+||++|+|||||||++|+
T Consensus         1 dPR~vl~~~~~hisrsl~k~~r~~~~~i~in~~F~~Vi~~Ca~~~--~~~TWI~~~~~~aY~~Lh~~G~aHSVEvw~~~e   78 (178)
T 2cxa_A            1 DPRAVLWPESLHISRSXKRFHKRSPYRVTXNYAFGQVIEGCASDR--EEGTWITRGVVEAYHRLHELGHAHSIEVWREDE   78 (178)
T ss_dssp             SSEEEECGGGCCCCHHHHHHHHTCCCEEEESSCHHHHHHHHHTC-----CTTCCHHHHHHHHHHHHTTSEEEEEEEETTE
T ss_pred             CCCEEECCCCCCCCHHHHHHHCCCCCEEEECCHHHHHHHHCCCCC--CCCEECHHHHHHHHHHHHHCCEEEEEEEEECCC
T ss_conf             789898876524577898886348866877804899997107899--888110589999999998688689998996582


Q ss_pred             EEEEEEEEEECCCEEEEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHCCCEEECHHHHHHHHHHHHHCCC
Q ss_conf             01211023205721200344525768999999999999968973999075893477119798369999999999983899
Q gi|254780269|r   96 LVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE  175 (179)
Q Consensus        96 LvGGlyGv~iG~~F~GESMFs~~~nASKiAl~~L~~~l~~~g~~liD~Q~~t~HL~slGa~~i~r~~fl~~L~~al~~p~  175 (179)
                      ||||+|||+||++||||||||+++||||+||++|+++|+.+||.|||||++||||+||||++|||++|+++|++++++|.
T Consensus        79 LvGGlyGv~iG~~f~gESMFs~~~~aSK~al~~L~~~l~~~g~~liD~Q~~~~hl~slGa~~i~R~~Fl~~l~~a~~~~~  158 (178)
T 2cxa_A           79 LVGGXYGVAQGTLFCGESXFSRXENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQXRLGRL  158 (178)
T ss_dssp             EEEEEEEEEETTEEEEEEEEESSTTHHHHHHHHHHHHHHHTTCCEEEEESCCHHHHHTTCEEECHHHHHHHHHHHTTCCC
T ss_pred             EEEEEEEEEECCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHCCCEECCHHHHHHHHHHHHHCCC
T ss_conf             57777899638848853201058977899999999999978990999566988898529988289999999999971899


Q ss_pred             CC
Q ss_conf             88
Q gi|254780269|r  176 IS  177 (179)
Q Consensus       176 ~~  177 (179)
                      ..
T Consensus       159 ~~  160 (178)
T 2cxa_A          159 PN  160 (178)
T ss_dssp             CT
T ss_pred             CC
T ss_conf             85



>1ne9_A (A:138-317) FEMX; protein, ligase; 1.70A {Weissella viridescens} Back     alignment and structure