254780271

254780271

ATP-dependent protease ATP-binding subunit ClpX

GeneID in NCBI database:8209252Locus tag:CLIBASIA_00780
Protein GI in NCBI database:254780271Protein Accession:YP_003064684.1
Gene range:-(153788, 155062)Protein Length:424aa
Gene description:ATP-dependent protease ATP-binding subunit ClpX
COG prediction:[O] ATP-dependent protease Clp, ATPase subunit
KEGG prediction:clpX; ATP-dependent protease ATP-binding subunit ClpX; K03544 ATP-dependent Clp protease ATP-binding subunit ClpX
SEED prediction:ATP-dependent Clp protease ATP-binding subunit ClpX
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteasome bacterial;
Proteolysis in bacteria, ATP-dependent
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420----
MSKASNNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKANVSA
cccccccccccccEEEcccccccHHHHHHHHccccEEEEHHHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEccccccHHHHHHHHHHHHcccEEEEEccHHcccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccccEEEEEccHHHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHcccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHccccccEEEccccccHHHHccc
cccccccccccccEEEEccccccHHHHHHHcccccEEEccHHHHHHHHHHHHHHHHcHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccEHcccccEEEEccccccHHHHHHHHHHHHcccEEEEEHHHHcccccccccccHHHHHHHHHccccHHHHHHcEEEEEcHcHccccccccccccccccHHHHHHHHHHHHccccccccccccccccccEEEEccccEEEEccHHHHHHHHHHHHHccccccccccEEccccHccccHHHHHccHHHHHHccccHHHHHHccEEEEcccccHHHHHHHHHcccccHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccEEEEEcHHHcccccccEEEEcccccccccccc
mskasnngsvsknALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKssitkshegipnpQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAksnillvgptgcgktYLAQTLARIIDvpftmadattlteagyvgeDVENIILKLLQAADYNVERAQRGIVYIdevdkisrksdnpsitrdvsgEGVQQALLKIMEGtiasvppqggrkhpqqeflqvdtTNILFICGGAFAGLDRIISARGEKASIGFSavvkdsdnrpvgevlrnlesedlvkfglipefigrlpvlatledldenSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFelpmlkgvssviisddvvkgkacplnvytdrrdekanvsa
mskasnngsvsknALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENkssitkshegipnpQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLahsskssnvELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGivyidevdkisrksdnpsitrdvsgEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIgfsavvkdsdnrpvgevlrnlesedlvkFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSsviisddvvkgkacplnvytdrrdekanvsa
MSKASNNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGvssviisddvvKGKACPLNVYTDRRDEKANVSA
***************YCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIRE****************QEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLA********ELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASI*****************LRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACP****************
**********SKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVP********QQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKANVSA
**********SKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTD**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKASNNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKANVSA
MSKASNNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKANVSA
MSKASNNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKANVSA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target424 ATP-dependent protease ATP-binding subunit ClpX [Candid
254780829437 ATP-dependent protease ATP-binding subunit [Candid 2e-21
254780829437 ATP-dependent protease ATP-binding subunit [Candid 1e-14
254780163798 ATP-dependent Clp protease ATP-binding subunit [Ca 2e-06
254780163 798 ATP-dependent Clp protease ATP-binding subunit [Ca 0.011
254780545 647 metalloprotease [Candidatus Liberibacter asiaticus 4e-05
254780552334 Holliday junction DNA helicase RuvB [Candidatus Li 4e-05
254780877853 ATP-dependent Clp protease, ATP-binding subunit pr 5e-04
254780718240 putative high-affinity zinc uptake system ATP-bind 0.007
>gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Back     alignment
 Score = 95.1 bits (235), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (61%), Gaps = 2/113 (1%)

Query: 67  NPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGK 126
           +P+EI+  LD Y+IGQ  AK+ +A+A+ N ++R    +   + EL   NILLVGPTG GK
Sbjct: 8   SPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRD-ELMPKNILLVGPTGVGK 66

Query: 127 TYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQR 179
           T +++ LAR+   PF   + T  TE GYVG +VE II  L+  A  N+ R  R
Sbjct: 67  TAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVA-INIVRESR 118

>gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Back     alignment
 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 101/222 (45%), Gaps = 57/222 (25%)

Query: 180 GIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQV 239
           GIV++DE DKI  +     I   VS EGVQ+ LL ++EG+  S            ++  +
Sbjct: 245 GIVFLDEFDKIVARDSGNGIG--VSREGVQRDLLPLVEGSSVST-----------KYGSI 291

Query: 240 DTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGL 299
           +T +ILFI  GAF                          +RP                 L
Sbjct: 292 NTDHILFIASGAFHV------------------------SRPAD---------------L 312

Query: 300 IPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIAR 359
           +PE  GR PV   L+ L+++    IL++ ++ LI QY+ L   E + L F ED++  +A 
Sbjct: 313 LPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALAD 372

Query: 360 CAIAHKT-----GARGLRSILEKILLDTMFELPMLKGVSSVI 396
            A+   +     GAR L++++E++L D  F    L+  + VI
Sbjct: 373 VAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVI 414

>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment
 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 82/346 (23%), Positives = 137/346 (39%), Gaps = 75/346 (21%)

Query: 98  KRLAHSSKSSNVELAKSN-----ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTE- 151
           K+L+ S K +   L+  N      +  GPTG GKT +++ LA  + V     D +   E 
Sbjct: 487 KKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMER 546

Query: 152 ----------AGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITR 201
                      GYVG     I+      AD +V++    +V +DE++K            
Sbjct: 547 HAVSRLIGAPPGYVGFGQGGIL------AD-SVDQNPYSVVLLDEIEK------------ 587

Query: 202 DVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISA 261
             S   V   LL+IM+  I  +  Q G+K   +  + + TTN      GA          
Sbjct: 588 --SHPDVLNILLQIMDYGI--LTDQSGKKISFRNVILIMTTN-----AGAL--------- 629

Query: 262 RGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSL 321
              KA IGF +   D  ++   E LRN          L PEF+ RL  +     L  +  
Sbjct: 630 EMSKARIGFGSSRNDDADK---EALRNF---------LSPEFLNRLDSIIPFFPLSSD-- 675

Query: 322 IRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEK---- 377
             I+ +  +  I + +     + +   F E+ +  +       K GAR L  I+++    
Sbjct: 676 --IIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKV 733

Query: 378 ILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKANVS 423
            L D +    + KG   V +S +  K  + P  ++ +  +  +N+S
Sbjct: 734 PLADEILFGKLKKGGGVVKVSLNPDKSASSP--IFFEIENSGSNIS 777

>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment
 Score = 32.7 bits (73), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 16/104 (15%)

Query: 112 AKSNILLVGPTGCGKTYLAQTLAR-IID--VP--------FTMADATTLTEAGYVGEDVE 160
           +K+N L VG  G GKT +A+  A+ I+D  VP        F++     +    Y G D E
Sbjct: 224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRG-DFE 282

Query: 161 NIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVS 204
             I K+++     +E     I+YIDE+  +        I+ D S
Sbjct: 283 ERIKKIVK----EIESYANAILYIDEIHTLVGAGSASGISVDAS 322

>gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Back     alignment
 Score = 40.8 bits (94), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175
           +LLVGP G GKT LA+ +A   +VPF     +   E  +VG     +     QA + +  
Sbjct: 184 VLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVEL-FVGVGASRVRDMFEQAKNNS-- 240

Query: 176 RAQRGIVYIDEVDKISR 192
                IV++DE+D + R
Sbjct: 241 ---PCIVFVDEIDAVGR 254

>gi|254780552|ref|YP_003064965.1| Holliday junction DNA helicase RuvB [Candidatus Liberibacter asiaticus str. psy62] Length = 334 Back     alignment
 Score = 40.8 bits (94), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 14/80 (17%)

Query: 112 AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAAD 171
           A  ++L VGP G GKT LAQ +AR + V F       + +AG +   + N+         
Sbjct: 53  ALDHVLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTNL--------- 103

Query: 172 YNVERAQRGIVYIDEVDKIS 191
                  R +++IDE+ ++S
Sbjct: 104 -----EDRDVLFIDEIHRLS 118

>gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Back     alignment
 Score = 37.4 bits (85), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 16/104 (15%)

Query: 44  ELCMDIIREENKSSITKSHEGIP-------NPQEILRV---LDEYVIGQGQAKKVLAVAV 93
           ++  +++  +N ++I     GIP       + ++ LR+   + + VIGQ  A +    +V
Sbjct: 525 DMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVE----SV 580

Query: 94  HNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARII 137
            N  +R     +     +   + + +GPTG GKT L ++LAR++
Sbjct: 581 SNALRRFRAGLQDPQRPMG--SFMFLGPTGVGKTELVKSLARLL 622

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 33.5 bits (75), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 51/102 (50%), Gaps = 7/102 (6%)

Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDV--ENII-LKLLQAADY 172
           + L+GP G GK+ +A+ +  II               GYV + V  EN + L L++    
Sbjct: 39  VTLIGPNGSGKSTIAKLITGIIKPTIGSVKRHPQLIVGYVPQKVTIENTLPLSLMRFMTL 98

Query: 173 NVERAQRGIVYI-DEVDKISRKSDNPSITRDVSGEGVQQALL 213
           ++  ++  ++ I D V+ I + + N    +D+SG   Q+ALL
Sbjct: 99  SMPSSRDDVLQILDRVNLIGKYNRN---IKDLSGGEFQRALL 137

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target424 ATP-dependent protease ATP-binding subunit ClpX [Candid
315122829424 ATP-dependent protease ATP-binding subunit ClpX [Candid 1 0.0
15888589425 ATP-dependent protease ATP-binding subunit [Agrobacteri 1 0.0
325292626425 ATP-dependent clp protease ATP-binding subunit ClpX [Ag 1 0.0
227821607425 ATP-dependent protease ATP-binding subunit ClpX [Sinorh 1 0.0
86357225425 ATP-dependent protease ATP-binding subunit [Rhizobium e 1 0.0
209548851425 ATP-dependent protease ATP-binding subunit ClpX [Rhizob 1 0.0
15965009425 ATP-dependent protease ATP-binding subunit [Sinorhizobi 1 0.0
116251455425 ATP-dependent protease ATP-binding subunit ClpX [Rhizob 1 0.0
222085565470 ATP-dependent Clp protease [Agrobacterium radiobacter K 1 0.0
150396096425 ATP-dependent protease ATP-binding subunit ClpX [Sinorh 1 0.0
>gi|315122829|ref|YP_004063318.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 424 Back     alignment and organism information
 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/424 (93%), Positives = 416/424 (98%)

Query: 1   MSKASNNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITK 60
           MSKA +NGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSI+K
Sbjct: 1   MSKAGSNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSISK 60

Query: 61  SHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVG 120
           SHEG+P PQ+IL+VLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSK+S+VELAKSNILLVG
Sbjct: 61  SHEGVPTPQDILQVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKNSSVELAKSNILLVG 120

Query: 121 PTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRG 180
           PTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRG
Sbjct: 121 PTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRG 180

Query: 181 IVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVD 240
           IVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVD
Sbjct: 181 IVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVD 240

Query: 241 TTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLI 300
           TTNILFICGGAFAGLDRIISARGEKASIGFSAVVK+SD+RPVGEVLRN+ESEDLVKFGLI
Sbjct: 241 TTNILFICGGAFAGLDRIISARGEKASIGFSAVVKNSDDRPVGEVLRNIESEDLVKFGLI 300

Query: 301 PEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARC 360
           PEFIGRLPVLATLEDLDE+SLIRILSEPKNAL+KQYQCLF+MED+ELVFHEDALREIAR 
Sbjct: 301 PEFIGRLPVLATLEDLDEDSLIRILSEPKNALVKQYQCLFEMEDIELVFHEDALREIARR 360

Query: 361 AIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKA 420
           AI HKTGARGLRSI+EKILLDTMFELP+LKGV+ +IISDDVVKGKA PLN+Y DR +EKA
Sbjct: 361 AIIHKTGARGLRSIMEKILLDTMFELPVLKGVNGIIISDDVVKGKARPLNIYVDRGEEKA 420

Query: 421 NVSA 424
           NVSA
Sbjct: 421 NVSA 424


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888589|ref|NP_354270.1| ATP-dependent protease ATP-binding subunit [Agrobacterium tumefaciens str. C58] Length = 425 Back     alignment and organism information
>gi|325292626|ref|YP_004278490.1| ATP-dependent clp protease ATP-binding subunit ClpX [Agrobacterium sp. H13-3] Length = 425 Back     alignment and organism information
>gi|227821607|ref|YP_002825577.1| ATP-dependent protease ATP-binding subunit ClpX [Sinorhizobium fredii NGR234] Length = 425 Back     alignment and organism information
>gi|86357225|ref|YP_469117.1| ATP-dependent protease ATP-binding subunit [Rhizobium etli CFN 42] Length = 425 Back     alignment and organism information
>gi|209548851|ref|YP_002280768.1| ATP-dependent protease ATP-binding subunit ClpX [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 425 Back     alignment and organism information
>gi|15965009|ref|NP_385362.1| ATP-dependent protease ATP-binding subunit [Sinorhizobium meliloti 1021] Length = 425 Back     alignment and organism information
>gi|116251455|ref|YP_767293.1| ATP-dependent protease ATP-binding subunit ClpX [Rhizobium leguminosarum bv. viciae 3841] Length = 425 Back     alignment and organism information
>gi|222085565|ref|YP_002544095.1| ATP-dependent Clp protease [Agrobacterium radiobacter K84] Length = 470 Back     alignment and organism information
>gi|150396096|ref|YP_001326563.1| ATP-dependent protease ATP-binding subunit ClpX [Sinorhizobium medicae WSM419] Length = 425 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target424 ATP-dependent protease ATP-binding subunit ClpX [Candid
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding subu 0.0
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding regulato 1e-180
KOG0745564 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-t 1e-124
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase subun 0.0
PRK05201443 PRK05201, hslU, ATP-dependent protease ATP-binding subu 2e-37
COG1220444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), AT 7e-33
TIGR00390441 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase s 5e-29
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 3e-34
COG1220444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), AT 2e-22
PRK05201443 PRK05201, hslU, ATP-dependent protease ATP-binding subu 3e-22
TIGR00390441 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase s 2e-21
pfam05496234 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB 7e-05
COG2255332 COG2255, RuvB, Holliday junction resolvasome, helicase 8e-05
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Re 5e-04
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB s 0.004
pfam0668939 pfam06689, zf-C4_ClpX, ClpX C4-type zinc finger 1e-17
pfam00004131 pfam00004, AAA, ATPase family associated with various c 4e-13
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 2e-12
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslat 7e-09
KOG0733 802 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subf 3e-08
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily 4e-06
KOG0731 774 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing 1e-05
COG2256436 COG2256, MGS1, ATPase related to the helicase subunit o 1e-05
pfam07728139 pfam07728, AAA_5, AAA domain (dynein-related subfamily) 2e-05
smart00382148 smart00382, AAA, ATPases associated with a variety of c 2e-05
KOG0735952 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttransl 9e-05
KOG0737386 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttransl 1e-04
COG0542 786 COG0542, ClpA, ATPases with chaperone activity, ATP-bin 2e-04
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed 2e-04
KOG0739439 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttransl 4e-04
KOG0741 744 KOG0741, KOG0741, KOG0741, AAA+-type ATPase [Posttransl 6e-04
KOG0738491 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttransl 8e-04
PRK11034 758 PRK11034, clpA, ATP-dependent Clp protease ATP-binding 9e-04
KOG0740428 KOG0740, KOG0740, KOG0740, AAA+-type ATPase [Posttransl 0.001
KOG0727408 KOG0727, KOG0727, KOG0727, 26S proteasome regulatory co 0.001
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 family 0.001
KOG0651388 KOG0651, KOG0651, KOG0651, 26S proteasome regulatory co 0.002
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regulatory 0.003
COG0542786 COG0542, ClpA, ATPases with chaperone activity, ATP-bin 1e-10
TIGR02639731 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding 2e-09
KOG1051898 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related 0.002
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 5e-10
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [ 2e-08
PRK13342413 PRK13342, PRK13342, recombination factor protein RarA; 9e-06
pfam1043189 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, 2e-07
KOG0734 752 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing 1e-05
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-binding 3e-04
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subunit C 0.001
>gnl|CDD|180029 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|161849 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|35964 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31412 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179962 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>gnl|CDD|31413 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|161852 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|116338 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|31413 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179962 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>gnl|CDD|161852 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|147593 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|32436 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|178847 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|148346 pfam06689, zf-C4_ClpX, ClpX C4-type zinc finger Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|30812 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35952 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162267 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|35950 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32437 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|35954 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35956 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|35958 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35960 KOG0741, KOG0741, KOG0741, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35957 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182917 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|35959 KOG0740, KOG0740, KOG0740, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35946 KOG0727, KOG0727, KOG0727, 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|35870 KOG0651, KOG0651, KOG0651, 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31415 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|36269 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|31416 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|183986 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|151009 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|35953 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182917 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 424 ATP-dependent protease ATP-binding subunit ClpX [Candid
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 100.0
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 100.0
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 100.0
KOG0745564 consensus 100.0
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 100.0
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 100.0
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 100.0
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 100.0
CHL00095823 clpC Clp protease ATP binding subunit 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 100.0
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.72
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 99.6
PRK13342 417 recombination factor protein RarA; Reviewed 99.56
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.51
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.46
KOG2028 554 consensus 99.04
KOG0736953 consensus 98.7
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 98.62
KOG1051898 consensus 99.98
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 99.7
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.63
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.62
CHL00181287 cbbX CbbX; Provisional 99.59
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.53
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.43
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 99.25
PRK11608325 pspF phage shock protein operon transcriptional activat 99.23
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 99.2
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.19
PRK05022510 anaerobic nitric oxide reductase transcription regulato 99.16
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 99.08
pfam00493327 MCM MCM2/3/5 family. 98.99
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 98.93
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.91
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.85
COG1221403 PspF Transcriptional regulators containing an AAA-type 98.84
smart00350509 MCM minichromosome maintenance proteins. 98.61
KOG2170344 consensus 98.57
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 98.4
COG1241682 MCM2 Predicted ATPase involved in replication control, 98.24
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.22
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.2
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 98.1
PRK05642234 DNA replication initiation factor; Validated 98.1
PRK08084235 DNA replication initiation factor; Provisional 98.05
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 97.81
PRK06893229 DNA replication initiation factor; Validated 97.66
PRK00149447 dnaA chromosomal replication initiation protein; Review 97.63
PRK12422455 chromosomal replication initiation protein; Provisional 97.43
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 97.11
PTZ00112 650 origin recognition complex 1 protein; Provisional 96.9
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 96.8
TIGR02329658 propionate_PrpR propionate catabolism operon regulatory 96.58
PRK08727233 hypothetical protein; Validated 96.01
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 99.95
CHL00195491 ycf46 Ycf46; Provisional 99.53
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 97.16
CHL00176 631 ftsH cell division protein; Validated 99.63
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.59
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 99.43
KOG0731 774 consensus 99.4
COG0714329 MoxR-like ATPases [General function prediction only] 99.38
PRK12402337 replication factor C small subunit 2; Reviewed 99.34
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 99.26
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 99.25
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 99.24
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 99.24
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 99.23
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 99.23
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 99.21
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 99.2
KOG0738491 consensus 99.19
KOG0734 752 consensus 99.19
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 99.19
PRK04195403 replication factor C large subunit; Provisional 99.18
KOG0730693 consensus 99.13
PRK00440318 rfc replication factor C small subunit; Reviewed 99.13
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 99.13
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 99.1
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 99.09
KOG0733802 consensus 99.06
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 99.04
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 99.03
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 99.0
PRK07940395 DNA polymerase III subunit delta'; Validated 98.96
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 98.95
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 98.94
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 98.93
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 98.93
PRK05564313 DNA polymerase III subunit delta'; Validated 98.84
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 98.84
KOG0735952 consensus 98.83
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 98.82
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.81
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 98.78
KOG0740428 consensus 98.75
PRK08058329 DNA polymerase III subunit delta'; Validated 98.72
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 98.58
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 98.47
KOG0730 693 consensus 98.44
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 98.35
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 98.3
PRK13531 498 regulatory ATPase RavA; Provisional 98.25
PRK06871324 DNA polymerase III subunit delta'; Validated 98.07
PRK07993334 DNA polymerase III subunit delta'; Validated 97.98
PRK05707328 DNA polymerase III subunit delta'; Validated 97.88
KOG0989346 consensus 97.5
KOG0743457 consensus 97.47
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 97.43
KOG0991333 consensus 97.34
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 96.9
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. Myos 93.42
PRK03992390 proteasome-activating nucleotidase; Provisional 99.61
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.44
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 99.41
KOG0728404 consensus 98.86
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 99.35
PRK09862506 putative ATP-dependent protease; Provisional 99.26
KOG2004 906 consensus 99.33
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 99.19
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 99.15
PRK10365441 transcriptional regulatory protein ZraR; Provisional 99.11
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 99.09
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 99.06
COG2204464 AtoC Response regulator containing CheY-like receiver, 98.82
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.63
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 98.16
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.83
KOG0742630 consensus 97.72
TIGR02974349 phageshock_pspF psp operon transcriptional activator Ps 97.33
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.08
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 95.91
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 99.25
pfam00004131 AAA ATPase family associated with various cellular acti 99.23
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 99.17
KOG0733 802 consensus 99.13
KOG0727408 consensus 98.76
KOG0651388 consensus 98.74
KOG0741 744 consensus 98.71
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 98.7
PRK10865 857 protein disaggregation chaperone; Provisional 98.67
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.66
CHL00095 823 clpC Clp protease ATP binding subunit 98.6
KOG0729435 consensus 98.58
KOG0652424 consensus 98.5
KOG0726440 consensus 98.49
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.48
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 98.27
smart00382148 AAA ATPases associated with a variety of cellular activ 98.25
PRK08769319 DNA polymerase III subunit delta'; Validated 98.09
KOG0735 952 consensus 98.03
PRK08699325 DNA polymerase III subunit delta'; Validated 97.98
PRK05917290 DNA polymerase III subunit delta'; Validated 97.93
KOG0732 1080 consensus 97.91
PRK06090319 DNA polymerase III subunit delta'; Validated 97.91
COG4650531 RtcR Sigma54-dependent transcription regulator containi 97.54
KOG0741744 consensus 97.52
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 97.48
PRK07132303 DNA polymerase III subunit delta'; Validated 97.43
KOG0736 953 consensus 97.22
KOG0478804 consensus 97.07
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational modi 96.71
PRK05818262 DNA polymerase III subunit delta'; Validated 96.67
PRK07276290 DNA polymerase III subunit delta'; Validated 96.66
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 95.97
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 95.03
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 93.14
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 99.25
PRK08116262 hypothetical protein; Validated 98.4
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.24
KOG0737386 consensus 98.74
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.16
PTZ00111 916 DNA replication licensing factor MCM4; Provisional 96.92
KOG0477854 consensus 96.05
PRK10867453 signal recognition particle protein; Provisional 95.77
KOG0479 818 consensus 95.67
KOG1051 898 consensus 94.78
COG1493308 HprK Serine kinase of the HPr protein, regulates carboh 93.82
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 93.79
pfam0668939 zf-C4_ClpX ClpX C4-type zinc finger. The ClpX heat shoc 99.18
PRK09112352 DNA polymerase III subunit delta'; Validated 99.13
PRK13765 637 ATP-dependent protease Lon; Provisional 99.13
PRK07471363 DNA polymerase III subunit delta'; Validated 98.95
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 98.84
PRK07399314 DNA polymerase III subunit delta'; Validated 98.65
pfam06309127 Torsin Torsin. This family consists of several eukaryot 98.16
KOG1942456 consensus 98.04
PRK04132 863 replication factor C small subunit; Provisional 97.65
PRK12377248 putative replication protein; Provisional 97.63
PRK07952242 DNA replication protein DnaC; Validated 97.3
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.21
KOG2680454 consensus 97.04
PRK09087226 hypothetical protein; Validated 97.03
pfam05621302 TniB Bacterial TniB protein. This family consists of se 97.0
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 96.83
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.29
CHL00179 2262 consensus 96.25
PRK04220306 2-phosphoglycerate kinase; Provisional 96.17
PRK06620214 hypothetical protein; Validated 96.11
CHL00178 2133 consensus 96.05
TIGR00764 662 lon_rel ATP-dependent protease, putative; InterPro: IPR 95.23
PRK12337492 2-phosphoglycerate kinase; Provisional 95.06
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 94.7
PRK00771433 signal recognition particle protein Srp54; Provisional 94.66
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.12
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.07
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 98.65
PHA02244383 ATPase-like protein 97.81
PRK09183258 transposase/IS protein; Provisional 97.65
KOG0744423 consensus 97.63
PRK08181269 transposase; Validated 97.61
PRK06526254 transposase; Provisional 97.51
KOG1808 1856 consensus 97.4
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 95.93
pfam1043189 ClpB_D2-small C-terminal, D2-small domain, of ClpB prot 98.84
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.24
PRK08903227 hypothetical protein; Validated 97.88
COG1123539 ATPase components of various ABC-type transport systems 94.07
KOG0739439 consensus 98.29
PRK08939306 primosomal protein DnaI; Reviewed 96.85
PRK00131175 aroK shikimate kinase; Reviewed 98.1
PRK13946195 shikimate kinase; Provisional 97.99
PRK05057172 aroK shikimate kinase I; Reviewed 97.94
PRK03731172 aroL shikimate kinase II; Reviewed 97.87
PRK13947171 shikimate kinase; Provisional 97.79
PRK13948182 shikimate kinase; Provisional 97.76
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 97.73
PRK13949169 shikimate kinase; Provisional 97.68
PRK07261171 topology modulation protein; Provisional 97.67
PRK08118167 topology modulation protein; Reviewed 97.62
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 97.55
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.55
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 97.49
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 97.45
PRK00625173 shikimate kinase; Provisional 97.45
PRK09825176 idnK D-gluconate kinase; Provisional 97.42
PRK11545177 gntK gluconate kinase 1; Provisional 97.38
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.29
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 97.08
PRK06835330 DNA replication protein DnaC; Validated 97.07
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.05
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 96.94
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 96.9
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.86
PRK06217185 hypothetical protein; Validated 96.75
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 96.74
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 96.7
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 96.67
COG1484254 DnaC DNA replication protein [DNA replication, recombin 96.57
PTZ00088225 adenylate kinase 1; Provisional 96.57
PRK00279215 adk adenylate kinase; Reviewed 96.55
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 96.55
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 96.47
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.42
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 96.36
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 96.35
PRK02496185 adk adenylate kinase; Provisional 96.35
KOG1969 877 consensus 96.28
CHL00026 2286 ycf2 Ycf2 96.14
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.12
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 96.11
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 96.1
PRK00023225 cmk cytidylate kinase; Provisional 96.02
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 96.02
pfam00625182 Guanylate_kin Guanylate kinase. 95.99
KOG1970 634 consensus 95.97
KOG3347176 consensus 95.96
TIGR01526346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 95.92
PRK04182178 cytidylate kinase; Provisional 95.91
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 95.82
PRK07667190 uridine kinase; Provisional 95.74
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 95.65
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 95.61
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 95.59
PRK13695174 putative NTPase; Provisional 95.57
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 95.5
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.5
PRK10416499 cell division protein FtsY; Provisional 95.5
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 95.47
PRK05541176 adenylylsulfate kinase; Provisional 95.4
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 95.35
KOG3354191 consensus 95.35
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 95.34
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 95.21
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 95.2
PRK03846198 adenylylsulfate kinase; Provisional 95.17
PRK03839180 putative kinase; Provisional 95.14
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 95.12
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 95.11
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.11
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 95.1
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 95.05
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 95.0
PRK09270230 frcK putative fructose transport system kinase; Reviewe 94.99
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.94
PRK10789569 putative multidrug transporter membrane\ATP-binding com 94.92
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 94.88
pfam01202158 SKI Shikimate kinase. 94.88
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.85
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 94.81
PRK00889175 adenylylsulfate kinase; Provisional 94.81
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 94.78
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 94.77
KOG2543438 consensus 94.75
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.73
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 94.73
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 94.69
COG3172187 NadR Predicted ATPase/kinase involved in NAD metabolism 94.6
PRK13808297 adenylate kinase; Provisional 94.58
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 94.58
PRK05480209 uridine kinase; Provisional 94.55
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.53
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 94.53
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.51
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 94.51
pfam00406186 ADK Adenylate kinase. 94.5
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 94.44
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 94.36
COG4988559 CydD ABC-type transport system involved in cytochrome b 94.34
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.32
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.3
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 94.3
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 94.28
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 94.26
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 94.24
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 94.21
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 94.16
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.14
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 94.13
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 94.13
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.1
PRK06696227 uridine kinase; Validated 94.08
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.0
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 94.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 93.96
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 93.92
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.9
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 93.85
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.76
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 93.73
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 93.73
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 93.71
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 93.69
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.68
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.67
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 93.66
PRK11147632 ABC transporter ATPase component; Reviewed 93.65
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 93.63
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 93.62
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 93.6
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.59
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 93.55
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 93.48
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 93.36
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 93.36
PRK06547184 hypothetical protein; Provisional 93.36
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.35
TIGR02322183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 93.34
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 93.33
PRK10436461 hypothetical protein; Provisional 93.25
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 93.25
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 93.24
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 93.21
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 93.21
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 93.16
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.15
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.15
PRK06964342 DNA polymerase III subunit delta'; Validated 97.83
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.53
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.43
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.36
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.33
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.2
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.17
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.13
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.12
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.03
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.9
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.89
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.88
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.86
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 96.81
PRK13851343 type IV secretion system protein VirB11; Provisional 96.69
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 96.68
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 96.49
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 96.42
PRK06921265 hypothetical protein; Provisional 96.42
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.34
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.32
PRK13833323 conjugal transfer protein TrbB; Provisional 96.29
PRK13894320 conjugal transfer ATPase TrbB; Provisional 96.18
PRK11784333 tRNA 2-selenouridine synthase; Provisional 96.17
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 95.99
COG3839338 MalK ABC-type sugar transport systems, ATPase component 95.79
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 95.73
pfam03266168 DUF265 Protein of unknown function, DUF265. 95.72
PRK13542224 consensus 95.39
COG4178604 ABC-type uncharacterized transport system, permease and 95.34
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.3
KOG0060659 consensus 95.13
PTZ00301210 uridine kinase; Provisional 95.12
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.1
pfam04851103 ResIII Type III restriction enzyme, res subunit. 95.08
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 95.08
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 94.99
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 94.98
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 94.97
PRK10790593 putative multidrug transporter membrane\ATP-binding com 94.95
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 94.88
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 94.84
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 94.84
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 94.79
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 94.78
PRK10744257 phosphate transporter subunit; Provisional 94.73
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 94.69
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 94.68
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 94.67
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 94.61
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 94.55
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 94.52
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 94.5
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 94.48
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 94.48
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 94.45
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 94.44
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 94.41
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 94.35
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 94.33
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 94.31
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 94.31
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 94.31
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 94.3
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 94.29
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 94.29
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.24
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 94.22
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 94.22
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 94.21
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 94.2
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 94.17
KOG0354 746 consensus 94.13
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 94.13
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 94.11
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 94.11
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 94.11
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.06
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 94.01
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 93.99
PRK08233182 hypothetical protein; Provisional 93.95
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 93.94
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 93.92
PRK09401 1176 reverse gyrase; Reviewed 93.91
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 93.91
cd03246173 ABCC_Protease_Secretion This family represents the ABC 93.78
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 93.77
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 93.77
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 93.76
PRK13830818 conjugal transfer protein TrbE; Provisional 93.75
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 93.75
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 93.73
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 93.72
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 93.69
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 93.67
PRK10636638 putative ABC transporter ATP-binding protein; Provision 93.65
PRK10908222 cell division protein FtsE; Provisional 93.61
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 93.58
cd03234226 ABCG_White The White subfamily represents ABC transport 93.53
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 93.46
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 93.46
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 93.44
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 93.43
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 93.43
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 93.41
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 93.41
PRK13898800 type IV secretion system ATPase VirB4; Provisional 93.41
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.39
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 93.31
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 93.31
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 93.31
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 93.29
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.27
PRK13853789 type IV secretion system protein VirB4; Provisional 93.25
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 93.25
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 93.25
PRK13544208 consensus 93.2
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 93.19
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 93.17
PRK13873815 conjugal transfer ATPase TrbE; Provisional 93.17
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 93.15
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 97.05
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.63
PRK09302501 circadian clock protein KaiC; Reviewed 94.07
PRK00300208 gmk guanylate kinase; Provisional 95.94
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, LssB fa 94.23
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 93.94
>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487 ClpX is a member of the HSP (heat-shock protein) 100 family Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745 consensus Back     alignment and domain information
>TIGR00390 hslU heat shock protein HslVU, ATPase subunit HslU; InterPro: IPR004491 This family of proteins represent HslU, a bacterial clpX homolog, which is an ATPase and chaperone belonging to the AAA Clp/Hsp100 family and a component of the eubacterial proteasome Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information