254780272

254780272

ATP-dependent Clp protease proteolytic subunit

GeneID in NCBI database:8209253Locus tag:CLIBASIA_00785
Protein GI in NCBI database:254780272Protein Accession:YP_003064685.1
Gene range:-(155338, 155988)Protein Length:216aa
Gene description:ATP-dependent Clp protease proteolytic subunit
COG prediction:[O] [U] Protease subunit of ATP-dependent Clp proteases
KEGG prediction:clpP; ATP-dependent Clp protease proteolytic subunit (EC:3.4.21.92); K01358 ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
SEED prediction:ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteasome bacterial;
Proteolysis in bacteria, ATP-dependent
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK
ccccccccccccHHHHccccEEEEccccccccccHHHHHHccEEEEEEEccccHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHcccccccEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHccccHHHHHcccccccccc
ccccccccccccHHHHcccccEEEEcccccccccHHHHHHcccEEEEEccEcHHHHHHHHHHHHHHHHHcccccEEEEEEEccEcHHHHHHHHHHHHHccccEEEEEEEEEEcHHHHHHHccccccEEEccccEEEEcccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEEHHHHHHHccccEEccccHHHHHccc
msfegcakkdsedvFLGLVPMVVEqtnrgersYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFleaenpqkeislyinspggvvtAGMAIYdtmqfikppistfcmgqAASMGSLLLSAGEKGmrfalpnarillhqpsggfsgqasDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK
msfegcakkdsedvflGLVPMvveqtnrgersydIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIkrrlneiyvkncgKTYEEVEKTLDRDHIMsaseacdwgvvdKVLMSridieeksk
MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK
**************FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDK*************
********KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK
*******KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSR********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK
MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK
MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target216 ATP-dependent Clp protease proteolytic subunit [Candida
254780747293 putative protease IV transmembrane protein [Candid 0.017
>gi|254780747|ref|YP_003065160.1| putative protease IV transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 293 Back     alignment
 Score = 30.8 bits (68), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 16/109 (14%)

Query: 45  VFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIK--PP 102
           + + GQIED     +  ++  +  ++    + + ++SPGG   AG AI+  +Q +K   P
Sbjct: 41  IAIRGQIEDSQE--LIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKP 98

Query: 103 ISTFCMGQAASMGSLLLSA------------GEKGMRFALPNARILLHQ 139
           + T     AAS G L+  A            G  G+ F  P  +  L +
Sbjct: 99  VITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDK 147

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target216 ATP-dependent Clp protease proteolytic subunit [Candida
315122830216 ATP-dependent Clp protease proteolytic subunit [Candida 1 1e-103
222085564210 ATP-dependent Clp protease, proteolytic subunit ClpP [A 1 7e-97
241204073209 ATP-dependent Clp protease proteolytic subunit [Rhizobi 1 9e-96
161501794209 ATP-dependent Clp protease proteolytic subunit [Rhizobi 1 1e-95
15965008208 ATP-dependent Clp protease proteolytic subunit [Sinorhi 1 1e-95
227821606210 ATP-dependent Clp protease proteolytic subunit [Sinorhi 1 2e-95
150396095208 ATP-dependent Clp protease proteolytic subunit [Sinorhi 1 2e-95
86357224209 ATP-dependent Clp protease proteolytic subunit [Rhizobi 1 2e-95
116243118201 RecName: Full=ATP-dependent Clp protease proteolytic su 1 4e-95
218514228201 ATP-dependent Clp protease proteolytic subunit [Rhizobi 1 7e-95
>gi|315122830|ref|YP_004063319.1| ATP-dependent Clp protease proteolytic subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 216 Back     alignment and organism information
 Score =  377 bits (969), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/216 (82%), Positives = 196/216 (90%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M FE  A++   D  LGLVPMVVEQTNRGERSYDIYSRLLKERIVF+TGQIEDHMA LIC
Sbjct: 1   MIFEEYAREGFNDTSLGLVPMVVEQTNRGERSYDIYSRLLKERIVFITGQIEDHMAALIC 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPP+ST C+GQAASMGSLLL+
Sbjct: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPVSTLCIGQAASMGSLLLA 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG+KGMRFALPNARI+LHQPSGGFSGQASDIERHA+DI+KIK RLN IYVK+CG+ YEEV
Sbjct: 121 AGKKGMRFALPNARIMLHQPSGGFSGQASDIERHARDIIKIKHRLNNIYVKHCGRVYEEV 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           E+TLDRD  MSA +A  WG++DKVLMSR+DIEE  K
Sbjct: 181 EQTLDRDCFMSAEDAHAWGLIDKVLMSRVDIEEGGK 216


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085564|ref|YP_002544094.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Agrobacterium radiobacter K84] Length = 210 Back     alignment and organism information
>gi|241204073|ref|YP_002975169.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 209 Back     alignment and organism information
>gi|161501794|ref|YP_767292.2| ATP-dependent Clp protease proteolytic subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 209 Back     alignment and organism information
>gi|15965008|ref|NP_385361.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium meliloti 1021] Length = 208 Back     alignment and organism information
>gi|227821606|ref|YP_002825576.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium fredii NGR234] Length = 210 Back     alignment and organism information
>gi|150396095|ref|YP_001326562.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium medicae WSM419] Length = 208 Back     alignment and organism information
>gi|86357224|ref|YP_469116.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli CFN 42] Length = 209 Back     alignment and organism information
>gi|116243118|sp|Q1MIM7|CLPP2_RHIL3 RecName: Full=ATP-dependent Clp protease proteolytic subunit 2; AltName: Full=Endopeptidase Clp 2 Length = 201 Back     alignment and organism information
>gi|218514228|ref|ZP_03511068.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli 8C-3] Length = 201 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target216 ATP-dependent Clp protease proteolytic subunit [Candida
PRK00277200 PRK00277, clpP, ATP-dependent Clp protease proteolytic 1e-112
COG0740200 COG0740, ClpP, Protease subunit of ATP-dependent Clp pr 1e-84
cd07017171 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an 2e-84
TIGR00493191 TIGR00493, clpP, ATP-dependent Clp protease, proteolyti 1e-83
PRK12553207 PRK12553, PRK12553, ATP-dependent Clp protease proteoly 1e-76
KOG0840275 KOG0840, KOG0840, KOG0840, ATP-dependent Clp protease, 3e-73
CHL00028200 CHL00028, clpP, ATP-dependent Clp protease proteolytic 2e-61
PRK12551196 PRK12551, PRK12551, ATP-dependent Clp protease proteoly 5e-60
PRK14513201 PRK14513, PRK14513, ATP-dependent Clp protease proteoly 7e-60
PRK14514221 PRK14514, PRK14514, ATP-dependent Clp protease proteoly 4e-55
cd07013162 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an A 7e-55
PRK12552222 PRK12552, PRK12552, ATP-dependent Clp protease-like pro 6e-50
PRK14512197 PRK14512, PRK14512, ATP-dependent Clp protease proteoly 7e-42
cd00394161 cd00394, Clp_protease_like, Caseinolytic protease (ClpP 1e-38
cd07023208 cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA 3e-04
pfam00574182 pfam00574, CLP_protease, Clp protease 1e-87
cd07016160 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an 4e-25
COG0616317 COG0616, SppA, Periplasmic serine proteases (ClpP class 6e-06
TIGR00705584 TIGR00705, SppA_67K, signal peptide peptidase SppA, 67K 7e-04
>gnl|CDD|178955 PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|31083 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|132928 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|129584 TIGR00493, clpP, ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>gnl|CDD|183589 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|36058 KOG0840, KOG0840, KOG0840, ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|176969 CHL00028, clpP, ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>gnl|CDD|139060 PRK12551, PRK12551, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|184721 PRK14513, PRK14513, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|184722 PRK14514, PRK14514, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132924 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|183588 PRK12552, PRK12552, ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|184720 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>gnl|CDD|132934 cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>gnl|CDD|144241 pfam00574, CLP_protease, Clp protease Back     alignment and domain information
>gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|30961 COG0616, SppA, Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162004 TIGR00705, SppA_67K, signal peptide peptidase SppA, 67K type Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 216 ATP-dependent Clp protease proteolytic subunit [Candida
PRK00277197 clpP ATP-dependent Clp protease proteolytic subunit; Re 100.0
PRK12553204 ATP-dependent Clp protease proteolytic subunit; Reviewe 100.0
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Reviewe 100.0
KOG0840275 consensus 100.0
CHL00028201 clpP ATP-dependent Clp protease proteolytic subunit 100.0
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 100.0
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteases [P 100.0
pfam00574182 CLP_protease Clp protease. The Clp protease has an acti 100.0
TIGR00493192 clpP ATP-dependent Clp protease, proteolytic subunit Cl 100.0
COG3904245 Predicted periplasmic protein [Function unknown] 97.84
PRK08321302 naphthoate synthase; Validated 96.77
PRK10949 618 protease 4; Provisional 94.41
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-depende 100.0
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-depen 100.0
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is an AT 100.0
cd07021178 Clp_protease_NfeD_like Nodulation formation efficiency 99.89
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficiency D ( 99.75
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serin 99.63
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptide pep 99.59
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K 99.52
cd07015172 Clp_protease_NfeD Nodulation formation efficiency D (Nf 99.51
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Posttra 99.48
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a serine 99.44
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [Postt 99.25
PRK10949618 protease 4; Provisional 99.1
TIGR00706224 SppA_dom signal peptide peptidase SppA, 36K type; Inter 99.07
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K 98.97
pfam01972286 SDH_sah Serine dehydrogenase proteinase. This family of 98.93
TIGR00705614 SppA_67K signal peptide peptidase SppA, 67K type; Inter 98.57
PRK11778317 putative periplasmic protease; Provisional 98.38
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydrata 98.13
PRK06142271 enoyl-CoA hydratase; Provisional 98.11
pfam00378169 ECH Enoyl-CoA hydratase/isomerase family. This family c 98.06
PRK05869225 enoyl-CoA hydratase; Validated 98.04
PRK06210272 enoyl-CoA hydratase; Provisional 97.97
PRK05981266 enoyl-CoA hydratase; Provisional 97.96
PRK07510266 consensus 97.95
PRK08139265 enoyl-CoA hydratase; Validated 97.94
PRK05995261 enoyl-CoA hydratase; Provisional 97.94
PRK06494259 enoyl-CoA hydratase; Provisional 97.88
PRK06495257 enoyl-CoA hydratase; Provisional 97.88
PRK05870254 enoyl-CoA hydratase; Provisional 97.86
PRK07938249 enoyl-CoA hydratase; Provisional 97.86
PRK06688263 enoyl-CoA hydratase; Provisional 97.86
PRK07658257 enoyl-CoA hydratase; Provisional 97.85
PRK06951254 consensus 97.85
PRK06143260 enoyl-CoA hydratase; Provisional 97.83
PRK08138260 enoyl-CoA hydratase; Provisional 97.82
PRK07830267 consensus 97.82
PRK05862257 enoyl-CoA hydratase; Provisional 97.82
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 97.81
PRK09674257 enoyl-CoA hydratase-isomerase; Provisional 97.8
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 97.79
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase alpha s 97.78
PRK08258270 enoyl-CoA hydratase; Provisional 97.77
PRK05724318 acetyl-CoA carboxylase carboxyltransferase subunit alph 97.77
PRK08290284 enoyl-CoA hydratase; Provisional 97.77
PRK07657261 enoyl-CoA hydratase; Provisional 97.76
PRK06023248 enoyl-CoA hydratase; Provisional 97.74
PRK07511259 enoyl-CoA hydratase; Provisional 97.74
PRK07110257 polyketide biosynthesis enoyl-CoA hydratase; Validated 97.72
PRK09076258 enoyl-CoA hydratase; Provisional 97.72
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 97.71
PRK07629261 consensus 97.7
PRK07468262 enoyl-CoA hydratase; Provisional 97.7
PRK06127269 enoyl-CoA hydratase; Provisional 97.7
PRK07659260 enoyl-CoA hydratase; Provisional 97.69
PRK06144262 enoyl-CoA hydratase; Provisional 97.69
pfam01039487 Carboxyl_trans Carboxyl transferase domain. All of the 97.65
PRK06213229 enoyl-CoA hydratase; Provisional 97.62
PRK05980260 enoyl-CoA hydratase; Provisional 97.58
PRK07509262 enoyl-CoA hydratase; Provisional 97.58
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Members o 97.57
PRK06563255 enoyl-CoA hydratase; Provisional 97.55
PRK07260260 enoyl-CoA hydratase; Provisional 97.55
PRK09120277 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 97.54
PRK03580262 carnitinyl-CoA dehydratase; Provisional 97.54
PRK08272308 enoyl-CoA hydratase; Provisional 97.52
PRK07854243 enoyl-CoA hydratase; Provisional 97.49
PRK06190258 enoyl-CoA hydratase; Provisional 97.49
PRK08252254 enoyl-CoA hydratase; Provisional 97.47
PRK09245266 enoyl-CoA hydratase; Provisional 97.47
PRK08140262 enoyl-CoA hydratase; Provisional 97.47
PRK07112251 polyketide biosynthesis enoyl-CoA hydratase; Validated 97.44
PRK07827255 enoyl-CoA hydratase; Provisional 97.44
PRK07396273 naphthoate synthase; Validated 97.42
PRK05674271 gamma-carboxygeranoyl-CoA hydratase; Validated 97.42
PRK07327271 enoyl-CoA hydratase; Provisional 97.42
PRK07799263 enoyl-CoA hydratase; Provisional 97.4
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydrata 97.39
KOG1680290 consensus 97.38
PRK08259254 enoyl-CoA hydratase; Provisional 97.38
PRK05864269 enoyl-CoA hydratase; Provisional 97.37
PRK08260293 enoyl-CoA hydratase; Provisional 97.37
PRK08150264 enoyl-CoA hydratase; Provisional 97.36
PRK12478298 enoyl-CoA hydratase; Provisional 97.28
PRK11154 706 fadJ multifunctional fatty acid oxidation complex subun 97.25
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid met 96.99
PRK11730 715 fadB multifunctional fatty acid oxidation complex subun 96.91
PRK05617 356 enoyl-CoA hydratase; Provisional 96.71
). It catalyzes the first step in the synthesis of long-chain fatty acids which involves the carboxylation of acetyl-CoA to malonyl-CoA. The acetyl-CoA carboxylase complex () is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase and two non-identical carboxyl transferase subunits (alpha and beta) in a 2:2 association . The reaction involves two steps: Biotin carrier protein + ATP + HCO_3^- -> Carboxybiotin carrier protein + ADP + P_i Carboxybiotin carrier protein + Acetyl-CoA -> Malonyl-CoA + Biotin carrier protein ; GO: 0003989 acetyl-CoA carboxylase activity, 0006633 fatty acid biosynthetic process, 0009317 acetyl-CoA carboxylase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00513">TIGR00513329 accA acetyl-CoA carboxylase, carboxyl transferase, alph 96.66
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabo 96.64
PRK08788286 enoyl-CoA hydratase; Validated 96.61
PRK06072240 enoyl-CoA hydratase; Provisional 96.53
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase component ( 96.05
KOG1682287 consensus 95.28
TIGR02441 740 fa_ox_alpha_mit fatty acid oxidation complex, alpha sub 93.12
PRK05654288 acetyl-CoA carboxylase subunit beta; Validated 92.91
pfam01343154 Peptidase_S49 Peptidase family S49. 97.96
KOG1681292 consensus 94.9
, MenB or dihydroxynaphthoic acid synthetase), which is involved in the fifth step of the menaquinone biosynthesis pathway. Menaquinone (vitamin K2), is an essential quinone used in electron-transfer pathways serving as the major electron carrier during anaerobic growth. In the bacterium, the biosynthetic pathway in bacteria typically comprises 6-7 steps . Together with o-succinylbenzoate-CoA ligase (menE IPR010192 from INTERPRO),MenB takes 2-succinylbenzoate and converts it into 1,4-di-hydroxy-2-naphthoic acid (DHNA) , , , . The conversion of o-succinylbenzoate-CoA ligase to DHNA is mediated by the enzyme DHNA synthase, which is encoded by menB . The protein structure of naphthoate synthase has been expressed in Escherichia coli, purified and crystallized, and found to have fold characteristics of the crotonase family of enzymes, which is notable for the presence of several highly flexible regions around the active site. The C-terminal region of the protein may play a critical role both in completion of the binding pocket and in stabilisation of the hexamer, suggesting a link between oligomerization and catalytic activity . Included in this entry are two enzymes from Arabidopsis thaliana and one from Staphylococcus aureus, which are identified as putative enoyl-CoA hydratase/isomerases. These enzymes group with the naphthoate synthases when building a tree and when doing BLAST searches.; GO: 0008935 naphthoate synthase activity, 0009234 menaquinone biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01929">TIGR01929278 menB naphthoate synthase; InterPro: IPR010198 This entr 94.64
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabol 90.06
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>KOG0840 consensus Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam00574 CLP_protease Clp protease Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP; InterPro: IPR001907 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>COG3904 Predicted periplasmic protein [Function unknown] Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type; InterPro: IPR004635 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>pfam01972 SDH_sah Serine dehydrogenase proteinase Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type; InterPro: IPR004634 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>PRK11778 putative periplasmic protease; Provisional Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>pfam00378 ECH Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07510 consensus Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06951 consensus Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07830 consensus Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK07629 consensus Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>pfam01039 Carboxyl_trans Carboxyl transferase domain Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 naphthoate synthase; Validated Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>KOG1680 consensus Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK05617 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit; InterPro: IPR001095 This entry contains the alpha subunit the acetyl coenzyme A carboxylase complex (Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>KOG1682 consensus Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial; InterPro: IPR012803 Members of this family represent the alpha subunit of the mitochondrial multifunctional fatty acid degradation enzyme complex Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>pfam01343 Peptidase_S49 Peptidase family S49 Back     alignment and domain information
>KOG1681 consensus Back     alignment and domain information
>TIGR01929 menB naphthoate synthase; InterPro: IPR010198 This entry represents an enzyme, naphthoate synthase Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target216 ATP-dependent Clp protease proteolytic subunit [Candida
3mt6_R207 Structure Of Clpp From Escherichia Coli In Complex 3e-64
1tyf_A193 The Structure Of Clpp At 2.3 Angstrom Resolution Su 5e-62
1yg8_A193 The Structure Of A V6a Variant Of Clpp. Length = 19 2e-61
3hln_A193 Crystal Structure Of Clpp A153c Mutant With Inter-H 2e-61
3kti_A199 Structure Of Clpp In Complex With Adep1 Length = 19 8e-60
3p2l_A201 Crystal Structure Of Atp-Dependent Clp Protease Sub 2e-59
3ktg_A199 Structure Of Clpp From Bacillus Subtilis In Monocli 2e-59
1tg6_A277 Crystallography And Mutagenesis Point To An Essenti 3e-59
2zl0_A196 Crystal Structure Of H.Pylori Clpp Length = 196 3e-59
2zl3_A196 Crystal Structure Of H.Pylori Clpp S99a Length = 19 8e-59
3q7h_A195 Structure Of The Clpp Subunit Of The Atp-Dependent 5e-56
1y7o_A218 The Structure Of Streptococcus Pneumoniae A153p Clp 1e-50
2c8t_A206 The 3.0 A Resolution Structure Of Caseinolytic Clp 9e-44
2ce3_A200 Crystal Structure Of The Atp-Dependent Clp Protease 1e-43
2cby_A208 Crystal Structure Of The Atp-Dependent Clp Protease 1e-43
2f6i_A215 Crystal Structure Of The Clpp Protease Catalytic Do 2e-33
gi|310942734|pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207 Back     alignment and structure
 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHRN 207


>gi|3318853|pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Length = 193 Back     alignment and structure
>gi|93278470|pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp. Length = 193 Back     alignment and structure
>gi|301598440|pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193 Back     alignment and structure
>gi|291463572|pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1 Length = 199 Back     alignment and structure
>gi|309320723|pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P From Francisella Tularensis Length = 201 Back     alignment and structure
>gi|291463558|pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199 Back     alignment and structure
gi|62738031|pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N-Terminus Of Human Mitochondrial Clpp Length = 277 Back     alignment and structure
gi|185177747|pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp Length = 196 Back     alignment and structure
>gi|185177785|pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196 Back     alignment and structure
>gi|317455555|pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp Protease From Coxiella Burnetii Length = 195 Back     alignment and structure
>gi|61680536|pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 Back     alignment and structure
>gi|126030155|pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp Protease 1 From Mycobacterium Tuberculosis Length = 206 Back     alignment and structure
gi|90109123|pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 200 Back     alignment and structure
>gi|88192658|pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208 Back     alignment and structure
>gi|85544605|pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain From Plasmodium Falciparum Length = 215 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target216 ATP-dependent Clp protease proteolytic subunit [Candida
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; structu 7e-76
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; endopep 1e-75
1tg6_A277 Putative ATP-dependent CLP protease proteolytic subunit 1e-73
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hydrola 1e-58
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; serin 6e-58
2f6i_A215 ATP-dependent CLP protease, putative; structural genomi 2e-50
3bpp_A230 1510-N membrane protease; specific for A stomatin homol 2e-23
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 Back     alignment and structure
 Score =  278 bits (712), Expect = 7e-76
 Identities = 115/191 (60%), Positives = 152/191 (79%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+E+T  GER++DIYSRLLKERIVF+ G++ DH A L+ AQLLFLE+E+P K+I  
Sbjct: 6   LVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDKDIYF 65

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VTAGM +YDTMQFIKP +ST C+G AASMGSLLL+ G KG R++LP+++I++
Sbjct: 66  YINSPGGMVTAGMGVYDTMQFIKPDVSTICIGLAASMGSLLLAGGAKGKRYSLPSSQIMI 125

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQASDIE HA++I++IK RLN++   + G+  E + K  DRD+ M A EA  
Sbjct: 126 HQPLGGFRGQASDIEIHAKNILRIKDRLNKVLAHHTGQDLETIVKDTDRDNFMMADEAKA 185

Query: 198 WGVVDKVLMSR 208
           +G++D V+ SR
Sbjct: 186 YGLIDHVIESR 196


>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 1yg8_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A Length = 193 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic subunit; mitochondrial CLPP, CLP/HSP 100, X-RAY crystallography, ATP- dependent protease; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopeptidase, ATP-dependent protease, hydrolase; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics consortium, SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Length = 215 Back     alignment and structure
>3bpp_A 1510-N membrane protease; specific for A stomatin homolog, archaea, thermostable, catalytic DYAD, hydrolase; 2.30A {Pyrococcus horikoshii} PDB: 2deo_A Length = 230 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target216 ATP-dependent Clp protease proteolytic subunit [Candida
1tg6_A277 Putative ATP-dependent CLP protease proteolytic subunit 100.0
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; structu 100.0
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hydrola 100.0
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; endopep 100.0
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; serin 100.0
2f6i_A215 ATP-dependent CLP protease, putative; structural genomi 100.0
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural geno 98.08
1q52_A314 MENB; lyase, structural genomics, PSI, protein structur 97.78
3bpp_A230 1510-N membrane protease; specific for A stomatin homol 99.93
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, membr 99.44
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, structural 98.2
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, struct 98.18
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-bindin 98.14
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha chain 98.11
3h02_A288 Naphthoate synthase; IDP00995, lyase, structural genomi 98.02
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; doma 98.02
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomics, GK 97.97
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fold, th 97.97
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, 97.96
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid 97.95
2iex_A272 Dihydroxynapthoic acid synthetase; crotonase-like famil 97.95
2fbm_A291 Y chromosome chromodomain protein 1, telomeric isoform 97.94
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, structural 97.93
3iav_A530 Propionyl-COA carboxylase complex B subunit; accase, pc 97.93
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynthetic 97.93
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; 97.92
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural geno 97.92
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectious di 97.91
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, membr 97.9
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein comple 97.89
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION tran 97.86
3pea_A261 Enoyl-COA hydratase/isomerase family protein; structura 97.86
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrolase, 97.86
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, 97.85
3ome_A282 Enoyl-COA hydratase; ssgcid, structural genomics, struc 97.84
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seattle s 97.84
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase 97.84
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid bios 97.83
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dependen 97.83
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, st 97.82
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; isomer 97.8
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, structu 97.78
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} 97.76
2gtr_A261 CDY-like, chromodomain Y-like protein; structural genom 97.76
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP02329, 97.75
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle structura 97.72
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HET: CA 97.72
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 hete 97.71
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldol 97.7
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hyd 97.69
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydratase ho 97.69
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, isom 97.68
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structural g 97.67
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cl 97.67
3ff6_A 760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 97.65
3p85_A270 Enoyl-COA hydratase; ssgcid, mycobacerium avium, struct 97.65
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, unkn 97.65
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula 19L} P 97.61
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase alpha subu 97.61
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural genom 97.58
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; structura 97.55
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structural g 97.53
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure, str 97.53
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid metabol 97.53
2x58_A 727 Peroxisomal bifunctional enzyme; beta oxidation pathway 97.53
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich, str 97.52
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics center 97.43
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Escheric 97.43
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; 97.43
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold 97.35
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crotonase 97.24
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alpha-bet 97.18
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xantho 97.11
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; HET: Y 96.97
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); oxid 96.95
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltransferas 96.37
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase subu 93.0
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase subu 98.24
>1tg6_A Putative ATP-dependent CLP protease proteolytic subunit; mitochondrial CLPP, CLP/HSP 100, X-RAY crystallography, ATP- dependent protease; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=489.21  Aligned_cols=203  Identities=57%  Similarity=0.928  Sum_probs=196.7

Q ss_pred             HHHHHCCCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHH
Q ss_conf             36664245757976659984012200345146779987831898999999999997411576976999936876146789
Q gi|254780272|r   11 SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGM   90 (216)
Q Consensus        11 ~~~~~~~~~p~~~e~~~~~~~~~Di~s~L~~~Riifl~g~I~~~~a~~iia~Ll~L~~~~~~k~I~l~INSpGG~v~~gl   90 (216)
                      +....||++|+|+|+|++||+++||||+||++|||||+|+|||+++++|++||+||+++|+++||+||||||||+|++|+
T Consensus        51 ~~~~~~~~~p~v~e~~~~ge~~~Di~srLl~~RIIfl~g~Idd~~a~~iiaqLl~Le~ed~~k~I~lyINSpGGsv~~Gl  130 (277)
T 1tg6_A           51 TATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGL  130 (277)
T ss_dssp             ------CCCCBCC---------CBHHHHHHTTTEEEEESSBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHH
T ss_pred             CCCCCCCCCCEEEEECCCCCCHHHHHHHHHCCCEEEECCEECHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHH
T ss_conf             57677887676987679874102366787626889989877589999999999998665999878999979995687899


Q ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999864487348998315566520000246777145544156644125666655541289999999999999999999
Q gi|254780272|r   91 AIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYV  170 (216)
Q Consensus        91 aIyD~i~~i~~~V~Ti~~G~aaS~aslIl~aG~~g~R~~~pns~iMiHqps~~~~G~~~di~~~a~el~~~~~~l~~i~a  170 (216)
                      +|||+|+++++||+|+|.|+|+|||++||++|++|+|+++|||++|||||+++++|+++|++++++|++++++++.++|+
T Consensus       131 aIyD~m~~i~~~V~Tv~~G~AaSmaslIlaaG~kgkR~a~pns~iMIHqp~~~~~G~a~di~~~a~el~~~~~~l~~iya  210 (277)
T 1tg6_A          131 AIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYA  210 (277)
T ss_dssp             HHHHHHHHSCSCEEEEEEEEEETHHHHHHHTSCTTCEEECTTCEEEECCCCCCCCSSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCEEEEEEEECCHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999985488856998632230567898726777103389987887258657775899999999999999999999999


Q ss_pred             HHCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCC
Q ss_conf             8719998999997245858888999975886446045422510
Q gi|254780272|r  171 KNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEE  213 (216)
Q Consensus       171 ~~Tg~~~e~i~~~~~rD~~lsa~EA~eyGliD~Ii~~~~e~~~  213 (216)
                      ++||++.++|+++|+||+||+|+||++|||||+|++++.+..+
T Consensus       211 ~~TG~~~e~I~~~m~rD~~msa~EA~eyGliD~Ii~~~~~~~~  253 (277)
T 1tg6_A          211 KHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGE  253 (277)
T ss_dssp             HHHCCCHHHHHHHHSSCEEECHHHHHHHTSCSEECSSCC----
T ss_pred             HHHCCCHHHHHHHHCCCCCCCHHHHHHCCCCCEEECCCCCCCC
T ss_conf             9879399999987506840659999983998789337876676



>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 1yg8_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopeptidase, ATP-dependent protease, hydrolase; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics consortium, SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative; 1.76A {Bordetella parapertussis} Back     alignment and structure
>1q52_A MENB; lyase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.14.1.3 PDB: 1q51_A 1rjm_A* 1rjn_A* Back     alignment and structure
>3bpp_A 1510-N membrane protease; specific for A stomatin homolog, archaea, thermostable, catalytic DYAD, hydrolase; 2.30A {Pyrococcus horikoshii} PDB: 2deo_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Thermotoga maritima MSB8} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha chain; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>3h02_A Naphthoate synthase; IDP00995, lyase, structural genomics, center for structural genomics of infectious diseases, csgid; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on protein structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, structural genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2iex_A Dihydroxynapthoic acid synthetase; crotonase-like family, beta-BETA-alpha, coenzyme biosyntheses, naphthoate synthase; 2.20A {Geobacillus kaustophilus HTA426} PDB: 2uzf_A* Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric isoform B; acetyltransferase, structural genomics, structural genomics consortium, SGC; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure