254780274

254780274

lysophospholipase protein

GeneID in NCBI database:8209255Locus tag:CLIBASIA_00795
Protein GI in NCBI database:254780274Protein Accession:YP_003064687.1
Gene range:+(158391, 159344)Protein Length:317aa
Gene description:lysophospholipase protein
COG prediction:[I] Lysophospholipase
KEGG prediction:lysophospholipase protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYLPKVIPLISQHKK
ccccEEEEEccccccEEEEEEcccccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHccHHHcEEEEEcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHccccccccEEEEcccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccEEEEEccccEEEEEEccccccccHEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHccccccEEEEEccccccccccHHHHHHHHHHHHHHccccccccHHHHcccHHcccccccccHHcccccHHHHHHHHccccccccHHHHHHHHHHHHHHHcHHHHHcccccccEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
msqktfltedetIHKSVhsynqthktpRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSdylrdypkntsdttivCDVMKLRTLIsekhgntsvLLFGYSLGTIIALSTLLkypqkfsgIALWNLDLCFEKYSCMLMTLLLKIEKffkgsdtpsRLMRHLTTDLWNRNNQNWKNFLKDhsvkknsqnyildsnhipISVWLEFMSMAtdissrgsfnplsrfipfcligggnvsskiEDLTQTYKLTTRlqneefydislmslpptmhsndphnvfpppaikkLRNWIVnsylpkviplisqhkk
msqktfltedetihksvhsynqthktpRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTtsdylrdypkntsdttivCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYlpkviplisqhkk
MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYLPKVIPLISQHKK
****TFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYLPKVIPL******
*********DETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYLPKVIPLISQHKK
***KTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYLPKVIPLISQHKK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYLPKVIPLISQHKK
MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYLPKVIPLISQHKK
MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWIVNSYLPKVIPLISQHKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target317 lysophospholipase protein [Candidatus Liberibacter asia
315122833320 lysophospholipase protein [Candidatus Liberibacter sola 1 1e-117
222086471310 lysophospholipase protein [Agrobacterium radiobacter K8 1 1e-20
116253076309 lipase [Rhizobium leguminosarum bv. viciae 3841] Length 1 4e-19
222149166316 hypothetical protein Avi_2931 [Agrobacterium vitis S4] 1 9e-19
325293490323 lysophospholipase protein [Agrobacterium sp. H13-3] Len 1 1e-18
241205585309 alpha/beta hydrolase [Rhizobium leguminosarum bv. trifo 1 2e-18
159185060325 hypothetical protein Atu2126 [Agrobacterium tumefaciens 1 4e-18
209550202314 alpha/beta hydrolase fold [Rhizobium leguminosarum bv. 1 8e-18
239832335323 lysophospholipase L2 [Ochrobactrum intermedium LMG 3301 1 1e-17
190892612309 lysophospholipase [Rhizobium etli CIAT 652] Length = 30 1 2e-17
>gi|315122833|ref|YP_004063322.1| lysophospholipase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 320 Back     alignment and organism information
 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/321 (65%), Positives = 254/321 (79%), Gaps = 5/321 (1%)

Query: 1   MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYI 60
           M Q+T   ED T +K  +  NQT KTPRA IL CQSIEENIEDYNDF  Y AEEN+A YI
Sbjct: 1   MPQETLQIEDATKNKIAYPCNQTRKTPRAAILVCQSIEENIEDYNDFCTYLAEENIAAYI 60

Query: 61  YSYRNTIKTTSDYLRDYP-KNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIAL 119
           YS+RNTIKT ++ L  Y  K  + T I+ +VMKLR+LI+E HGNT VLLFGYSLGT+IAL
Sbjct: 61  YSHRNTIKTANNSLPGYSEKENNSTPIIQEVMKLRSLIAENHGNTPVLLFGYSLGTVIAL 120

Query: 120 STLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNR 179
           STL+KYP+KFSGIALWNLDLCFEKY+C++M   LKIEKFFKGSDTPSR MR++T ++W R
Sbjct: 121 STLIKYPKKFSGIALWNLDLCFEKYNCLIMDSFLKIEKFFKGSDTPSRFMRYMTENIWIR 180

Query: 180 NNQNWKNFLKDHSVKKNSQNYILDSNH---IPISVWLEFMSMATDISSRGSFNPLSRFIP 236
           NN+NWK+ L + ++  +S+++I+++N+    PISVWLE MSMATDI+++GSFN LSR IP
Sbjct: 181 NNKNWKHLLGNLTLNIDSKDHIINNNYSLNTPISVWLELMSMATDINAQGSFNTLSRSIP 240

Query: 237 FCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKL 296
           FCL+ GGN   KIED +Q YKL  RL NEEFYDISLM+ PP +  NDP N  PP AIKKL
Sbjct: 241 FCLVSGGNPLIKIEDHSQIYKLAERLHNEEFYDISLMTFPP-IFPNDPRNTTPPQAIKKL 299

Query: 297 RNWIVNSYLPKVIPLISQHKK 317
           RNWIV SYLPKV PLISQ++K
Sbjct: 300 RNWIVKSYLPKVTPLISQYQK 320


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086471|ref|YP_002545005.1| lysophospholipase protein [Agrobacterium radiobacter K84] Length = 310 Back     alignment and organism information
>gi|116253076|ref|YP_768914.1| lipase [Rhizobium leguminosarum bv. viciae 3841] Length = 309 Back     alignment and organism information
>gi|222149166|ref|YP_002550123.1| hypothetical protein Avi_2931 [Agrobacterium vitis S4] Length = 316 Back     alignment and organism information
>gi|325293490|ref|YP_004279354.1| lysophospholipase protein [Agrobacterium sp. H13-3] Length = 323 Back     alignment and organism information
>gi|241205585|ref|YP_002976681.1| alpha/beta hydrolase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 309 Back     alignment and organism information
>gi|159185060|ref|NP_355088.2| hypothetical protein Atu2126 [Agrobacterium tumefaciens str. C58] Length = 325 Back     alignment and organism information
>gi|209550202|ref|YP_002282119.1| alpha/beta hydrolase fold [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 314 Back     alignment and organism information
>gi|239832335|ref|ZP_04680664.1| lysophospholipase L2 [Ochrobactrum intermedium LMG 3301] Length = 323 Back     alignment and organism information
>gi|190892612|ref|YP_001979154.1| lysophospholipase [Rhizobium etli CIAT 652] Length = 309 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target317 lysophospholipase protein [Candidatus Liberibacter asia
KOG1455313 KOG1455, KOG1455, KOG1455, Lysophospholipase [Lipid tra 2e-04
COG2267298 COG2267, PldB, Lysophospholipase [Lipid metabolism] 3e-08
>gnl|CDD|36668 KOG1455, KOG1455, KOG1455, Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|32448 COG2267, PldB, Lysophospholipase [Lipid metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 317 lysophospholipase protein [Candidatus Liberibacter asia
COG2267298 PldB Lysophospholipase [Lipid metabolism] 100.0
PRK10749330 lysophospholipase L2; Provisional 100.0
KOG1455313 consensus 100.0
PRK00870302 haloalkane dehalogenase; Provisional 100.0
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase accessory 99.98
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate 99.97
PRK03592294 haloalkane dehalogenase; Provisional 99.97
TIGR03611257 RutD pyrimidine utilization protein D. This protein is 99.97
PRK03204286 haloalkane dehalogenase; Provisional 99.97
PRK10673255 hypothetical protein; Provisional 99.97
PRK10349256 carboxylesterase BioH; Provisional 99.97
KOG4178322 consensus 99.96
TIGR02427256 protocat_pcaD 3-oxoadipate enol-lactonase; InterPro: IP 99.95
PRK11126242 acyl-CoA thioester hydrolase YfbB; Provisional 99.95
KOG4409365 consensus 99.94
KOG1454326 consensus 99.93
TIGR01250302 pro_imino_pep_2 proline-specific peptidases; InterPro: 99.92
pfam03096285 Ndr Ndr family. This family consists of proteins from d 99.92
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system type 99.91
TIGR01607379 PST-A Plasmodium subtelomeric family (PST-A); InterPro: 99.89
PRK10566249 esterase; Provisional 99.87
PRK05855 582 short chain dehydrogenase; Validated 99.86
PRK10985325 putative hydrolase; Provisional 99.84
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidase 99.83
KOG2382315 consensus 99.82
pfam01738216 DLH Dienelactone hydrolase family. 99.76
KOG1838409 consensus 99.74
KOG1552258 consensus 99.7
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fold [G 99.7
pfam02230213 Abhydrolase_2 Phospholipase/Carboxylesterase. This fami 99.67
KOG2564343 consensus 99.65
COG0412236 Dienelactone hydrolase and related enzymes [Secondary m 99.62
pfam05448320 AXE1 Acetyl xylan esterase (AXE1). This family consists 99.62
TIGR01836367 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, 99.62
KOG2624403 consensus 99.62
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.59
KOG2984277 consensus 99.59
KOG4667269 consensus 99.58
KOG4391300 consensus 99.57
PRK11460230 esterase YpfH; Provisional 99.56
PRK06489358 hypothetical protein; Provisional 99.56
PRK06765387 homoserine O-acetyltransferase; Provisional 99.55
PRK10162319 acetyl esterase; Provisional 99.51
COG4757281 Predicted alpha/beta hydrolase [General function predic 99.5
COG2021368 MET2 Homoserine acetyltransferase [Amino acid transport 99.48
PRK07581340 hypothetical protein; Validated 99.43
PRK08775343 homoserine O-acetyltransferase; Provisional 99.42
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.41
COG2945210 Predicted hydrolase of the alpha/beta superfamily [Gene 99.39
KOG2931326 consensus 99.38
KOG1515336 consensus 99.35
COG0400207 Predicted esterase [General function prediction only] 99.33
pfam08538303 DUF1749 Protein of unknown function (DUF1749). This is 99.3
COG3208244 GrsT Predicted thioesterase involved in non-ribosomal p 99.3
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolites bi 99.27
PRK102521293 entF enterobactin synthase subunit F; Provisional 99.27
TIGR01392395 homoserO_Ac_trn homoserine O-acetyltransferase; InterPr 99.19
KOG2100755 consensus 99.16
PRK05077414 frsA fermentation/respiration switch protein; Reviewed 99.14
pfam06500411 DUF1100 Alpha/beta hydrolase of unknown function (DUF11 99.12
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabol 99.11
KOG3043242 consensus 99.08
KOG2281867 consensus 98.9
pfam12048294 DUF3530 Protein of unknown function (DUF3530). This fam 98.87
PRK13604305 luxD acyl transferase; Provisional 98.58
KOG2112206 consensus 98.57
KOG4627270 consensus 98.54
pfam02273294 Acyl_transf_2 Acyl transferase. This bacterial family o 98.5
COG1505648 Serine proteases of the peptidase family S9A [Amino aci 98.5
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fold [G 98.49
COG4814288 Uncharacterized protein with an alpha/beta hydrolase fo 98.46
PRK10115686 protease 2; Provisional 98.45
COG0627316 Predicted esterase [General function prediction only] 98.43
KOG3253 784 consensus 98.43
COG1073299 Hydrolases of the alpha/beta superfamily [General funct 98.31
COG1770682 PtrB Protease II [Amino acid transport and metabolism] 98.15
KOG2551230 consensus 98.02
TIGR01849414 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intr 97.18
KOG2521350 consensus 91.02
pfam00561225 Abhydrolase_1 alpha/beta hydrolase fold. This catalytic 99.9
pfam00326212 Peptidase_S9 Prolyl oligopeptidase family. 99.78
pfam00975224 Thioesterase Thioesterase domain. Peptide synthetases a 99.61
pfam07859209 Abhydrolase_3 alpha/beta hydrolase fold. This catalytic 99.51
smart00824212 PKS_TE Thioesterase. Peptide synthetases are involved i 99.43
pfam03583291 LIP Secretory lipase. These lipases are expressed and s 99.26
pfam06028249 DUF915 Alpha/beta hydrolase of unknown function (DUF915 99.19
pfam05728187 UPF0227 Uncharacterized protein family (UPF0227). Despi 98.87
pfam06821171 DUF1234 Alpha/Beta hydrolase family of unknown function 98.82
PRK05371 769 x-prolyl-dipeptidyl aminopeptidase; Provisional 97.8
COG1647243 Esterase/lipase [General function prediction only] 99.89
TIGR01738248 bioH putative pimeloyl-BioC--CoA transferase BioH; Inte 99.89
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system type 99.55
PRK11071190 esterase YqiA; Provisional 98.89
pfam05705239 DUF829 Eukaryotic protein of unknown function (DUF829). 97.81
TIGR01249310 pro_imino_pep_1 proline iminopeptidase; InterPro: IPR00 99.75
COG0596282 MhpC Predicted hydrolases or acyltransferases (alpha/be 99.71
pfam06342297 DUF1057 Alpha/beta hydrolase of unknown function (DUF10 99.64
pfam10230260 DUF2305 Uncharacterized conserved protein (DUF2305). Th 99.44
pfam02129265 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family). 99.23
pfam03403372 PAF-AH_p_II isoform II. Platelet-activating factor acet 99.22
KOG2565469 consensus 99.16
pfam10503226 Esterase_phd Esterase PHB depolymerase. This family of 99.05
COG4188365 Predicted dienelactone hydrolase [General function pred 99.02
COG3319257 Thioesterase domains of type I polyketide synthases or 99.0
KOG3975301 consensus 98.93
pfam09752337 DUF2048 Uncharacterized conserved protein (DUF2048). Th 98.88
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzymes. Li 98.86
pfam07819225 PGAP1 PGAP1-like protein. The sequences found in this f 98.78
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef family. 98.77
pfam06057192 VirJ Bacterial virulence protein (VirJ). This family co 98.77
pfam01674218 Lipase_2 Lipase (class 2). This family consists of hypo 98.77
pfam00756243 Esterase Putative esterase. This family contains Estera 98.74
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this protein 98.73
PRK124673951 peptide synthase; Provisional 98.69
pfam00151329 Lipase Lipase. 98.68
pfam07224307 Chlorophyllase Chlorophyllase. This family consists of 98.67
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary me 98.63
COG2936 563 Predicted acyl esterases [General function prediction o 98.63
pfam05990230 DUF900 Alpha/beta hydrolase of unknown function (DUF900 98.62
pfam05577 433 Peptidase_S28 Serine carboxypeptidase S28. These serine 98.61
COG4099387 Predicted peptidase [General function prediction only] 98.59
pfam07082250 DUF1350 Protein of unknown function (DUF1350). This fam 98.57
COG2272491 PnbA Carboxylesterase type B [Lipid metabolism] 98.53
TIGR02821279 fghA_ester_D S-formylglutathione hydrolase; InterPro: I 98.51
PRK07868 990 acyl-CoA synthetase; Validated 98.45
pfam03959210 FSH1 Serine hydrolase (FSH1). This is a family of serin 98.43
KOG3724 973 consensus 98.42
COG1075336 LipA Predicted acetyltransferases and hydrolases with t 98.39
KOG3847399 consensus 98.32
pfam05057212 DUF676 Putative serine esterase (DUF676). This family o 98.29
pfam11144403 DUF2920 Protein of unknown function (DUF2920). This bac 98.29
TIGR01838541 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, clas 98.18
COG4782377 Uncharacterized protein conserved in bacteria [Function 98.13
TIGR01840231 esterase_phb esterase, PHB depolymerase family; InterPr 98.12
KOG2237712 consensus 98.12
pfam02089279 Palm_thioest Palmitoyl protein thioesterase. 98.1
KOG4840299 consensus 98.09
KOG1553517 consensus 98.06
cd00312 493 Esterase_lipase Esterases and lipases (includes fungal 98.04
pfam00135 517 COesterase Carboxylesterase. 98.04
pfam05576 448 Peptidase_S37 PS-10 peptidase S37. These serine proteas 97.95
pfam00450415 Peptidase_S10 Serine carboxypeptidase. 97.93
KOG2369473 consensus 97.88
PRK10439398 enterobactin/ferric enterobactin esterase; Provisional 97.87
KOG2183 492 consensus 97.84
COG3946456 VirJ Type IV secretory pathway, VirJ component [Intrace 97.83
COG2819264 Predicted hydrolase of the alpha/beta superfamily [Gene 97.76
KOG3101283 consensus 97.7
COG3545181 Predicted esterase of the alpha/beta hydrolase fold [Ge 97.52
COG2382299 Fes Enterochelin esterase and related enzymes [Inorgani 97.5
KOG2182 514 consensus 97.5
KOG2541296 consensus 97.49
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases that c 97.33
PRK04940179 hypothetical protein; Provisional 97.32
KOG1516 545 consensus 97.29
KOG1551371 consensus 97.06
pfam06259177 DUF1023 Alpha/beta hydrolase of unknown function (DUF10 97.03
pfam11339 581 DUF3141 Protein of unknown function (DUF3141). This fam 97.03
KOG3967297 consensus 96.95
pfam10340374 DUF2424 Protein of unknown function (DUF2424). This is 96.86
COG3150191 Predicted esterase [General function prediction only] 96.78
KOG12022376 consensus 96.59
KOG4388 880 consensus 96.12
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid transport 96.08
KOG4372405 consensus 95.92
KOG4569336 consensus 95.3
COG4947227 Uncharacterized protein conserved in bacteria [Function 94.06
pfam04301213 DUF452 Protein of unknown function (DUF452). 93.4
pfam01083179 Cutinase Cutinase. 93.34
pfam05677364 DUF818 Chlamydia CHLPS protein (DUF818). This family co 91.12
pfam09994261 DUF2235 Uncharacterized conserved protein (DUF2235). Th 90.6
pfam1214679 Hydrolase_4 Putative lysophospholipase. This domain is 99.42
pfam08840211 BAAT_C BAAT / Acyl-CoA thioester hydrolase C terminal. 99.03
pfam10142360 PhoPQ_related PhoPQ-activated pathogenicity-related pro 94.82
pfam07519451 Tannase Tannase and feruloyl esterase. This family incl 98.06
pfam08386103 Abhydrolase_4 TAP-like protein. This is a family of put 95.34
pfam02450382 LACT Lecithin:cholesterol acyltransferase. Lecithin:cho 98.05
pfam11288201 DUF3089 Protein of unknown function (DUF3089). This fam 96.39
cd00741153 Lipase Lipase. Lipases are esterases that can hydrolyze 96.9
pfam01764141 Lipase_3 Lipase (class 3). 96.77
pfam11187224 DUF2974 Protein of unknown function (DUF2974). This bac 94.48
COG5153425 CVT17 Putative lipase essential for disintegration of a 93.77
KOG4540425 consensus 93.77
KOG2029697 consensus 93.49
pfam05277343 DUF726 Protein of unknown function (DUF726). This famil 92.8
pfam06850203 PHB_depo_C PHB de-polymerase C-terminus. This family re 96.42
pfam06441108 EHN Epoxide hydrolase N terminus. This family represent 91.35
pfam0408362 Abhydro_lipase ab-hydrolase associated lipase region. 90.34
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>KOG1455 consensus Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10673 hypothetical protein; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG4178 consensus Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase; InterPro: IPR012790 These proteins are 3-oxoadipate enol-lactonases (also called beta-ketoadipate enol-lactone hydrolase), which catalyse the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA Back     alignment and domain information
>PRK11126 acyl-CoA thioester hydrolase YfbB; Provisional Back     alignment and domain information
>KOG4409 consensus Back     alignment and domain information
>KOG1454 consensus Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases; InterPro: IPR005945 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>pfam03096 Ndr Ndr family Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A); InterPro: IPR006494 These proteins represent a paralogous family of genes found in Plasmodium falciparum and Plasmodium yoelii that are closely related to various phospholipases and lysophospholipases of plants as well as generally being related to the alpha/beta-fold superfamily of hydrolases Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2382 consensus Back     alignment and domain information
>pfam01738 DLH Dienelactone hydrolase family Back     alignment and domain information
>KOG1838 consensus Back     alignment and domain information
>KOG1552 consensus Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>pfam02230 Abhydrolase_2 Phospholipase/Carboxylesterase Back     alignment and domain information
>KOG2564 consensus Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam05448 AXE1 Acetyl xylan esterase (AXE1) Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit; InterPro: IPR010125 This entry represents the PhaC subunit of a heterodimeric form of polyhydroxyalkanoic acid (PHA) synthase Back     alignment and domain information
>KOG2624 consensus Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG2984 consensus Back     alignment and domain information
>KOG4667 consensus Back     alignment and domain information
>KOG4391 consensus Back     alignment and domain information
>PRK11460 esterase YpfH; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG2931 consensus Back     alignment and domain information
>KOG1515 consensus Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>pfam08538 DUF1749 Protein of unknown function (DUF1749) Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase; InterPro: IPR006296 This family describes homoserine-O-acetyltransferase, an enzyme of methionine biosynthesis Back     alignment and domain information
>KOG2100 consensus Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>pfam06500 DUF1100 Alpha/beta hydrolase of unknown function (DUF1100) Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>KOG3043 consensus Back     alignment and domain information
>KOG2281 consensus Back     alignment and domain information
>pfam12048 DUF3530 Protein of unknown function (DUF3530) Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>KOG2112 consensus Back     alignment and domain information
>KOG4627 consensus Back     alignment and domain information
>pfam02273 Acyl_transf_2 Acyl transferase Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG3253 consensus Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2551 consensus Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular; InterPro: IPR010915 This entry represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting Back     alignment and domain information
>KOG2521 consensus Back     alignment and domain information
>pfam00561 Abhydrolase_1 alpha/beta hydrolase fold Back     alignment and domain information
>pfam00326 Peptidase_S9 Prolyl oligopeptidase family Back     alignment and domain information
>pfam00975 Thioesterase Thioesterase domain Back     alignment and domain information
>pfam07859 Abhydrolase_3 alpha/beta hydrolase fold Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>pfam03583 LIP Secretory lipase Back     alignment and domain information
>pfam06028 DUF915 Alpha/beta hydrolase of unknown function (DUF915) Back     alignment and domain information
>pfam05728 UPF0227 Uncharacterized protein family (UPF0227) Back     alignment and domain information
>pfam06821 DUF1234 Alpha/Beta hydrolase family of unknown function (DUF1234) Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH; InterPro: IPR010076 This CoA-binding enzyme is required for the production of pimeloyl-coenzyme A, the substrate of the BioF protein early in the biosynthesis of biotin Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>pfam05705 DUF829 Eukaryotic protein of unknown function (DUF829) Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase; InterPro: IPR005944 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>pfam06342 DUF1057 Alpha/beta hydrolase of unknown function (DUF1057) Back     alignment and domain information
>pfam10230 DUF2305 Uncharacterized conserved protein (DUF2305) Back     alignment and domain information
>pfam02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family) Back     alignment and domain information
>pfam03403 PAF-AH_p_II isoform II Back     alignment and domain information
>KOG2565 consensus Back     alignment and domain information
>pfam10503 Esterase_phd Esterase PHB depolymerase Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3975 consensus Back     alignment and domain information
>pfam09752 DUF2048 Uncharacterized conserved protein (DUF2048) Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>pfam07819 PGAP1 PGAP1-like protein Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>pfam06057 VirJ Bacterial virulence protein (VirJ) Back     alignment and domain information
>pfam01674 Lipase_2 Lipase (class 2) Back     alignment and domain information
>pfam00756 Esterase Putative esterase Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>pfam00151 Lipase Lipase Back     alignment and domain information
>pfam07224 Chlorophyllase Chlorophyllase Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>pfam05990 DUF900 Alpha/beta hydrolase of unknown function (DUF900) Back     alignment and domain information
>pfam05577 Peptidase_S28 Serine carboxypeptidase S28 Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>pfam07082 DUF1350 Protein of unknown function (DUF1350) Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase; InterPro: IPR014186 This entry describes proteins from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (3 Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>pfam03959 FSH1 Serine hydrolase (FSH1) Back     alignment and domain information
>KOG3724 consensus Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3847 consensus Back     alignment and domain information
>pfam05057 DUF676 Putative serine esterase (DUF676) Back     alignment and domain information
>pfam11144 DUF2920 Protein of unknown function (DUF2920) Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I; InterPro: IPR010963 This entry represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerises hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family; InterPro: IPR010126 This entry describes a group of lipases of the ab-hydrolase family Back     alignment and domain information
>KOG2237 consensus Back     alignment and domain information
>pfam02089 Palm_thioest Palmitoyl protein thioesterase Back     alignment and domain information
>KOG4840 consensus Back     alignment and domain information
>KOG1553 consensus Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>pfam00135 COesterase Carboxylesterase Back     alignment and domain information
>pfam05576 Peptidase_S37 PS-10 peptidase S37 Back     alignment and domain information
>pfam00450 Peptidase_S10 Serine carboxypeptidase Back     alignment and domain information
>KOG2369 consensus Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>KOG2183 consensus Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG3101 consensus Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2182 consensus Back     alignment and domain information
>KOG2541 consensus Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG1516 consensus Back     alignment and domain information
>KOG1551 consensus Back     alignment and domain information
>pfam06259 DUF1023 Alpha/beta hydrolase of unknown function (DUF1023) Back     alignment and domain information
>pfam11339 DUF3141 Protein of unknown function (DUF3141) Back     alignment and domain information
>KOG3967 consensus Back     alignment and domain information
>pfam10340 DUF2424 Protein of unknown function (DUF2424) Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG1202 consensus Back     alignment and domain information
>KOG4388 consensus Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4372 consensus Back     alignment and domain information
>KOG4569 consensus Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04301 DUF452 Protein of unknown function (DUF452) Back     alignment and domain information
>pfam01083 Cutinase Cutinase Back     alignment and domain information
>pfam05677 DUF818 Chlamydia CHLPS protein (DUF818) Back     alignment and domain information
>pfam09994 DUF2235 Uncharacterized conserved protein (DUF2235) Back     alignment and domain information
>pfam12146 Hydrolase_4 Putative lysophospholipase Back     alignment and domain information
>pfam08840 BAAT_C BAAT / Acyl-CoA thioester hydrolase C terminal Back     alignment and domain information
>pfam10142 PhoPQ_related PhoPQ-activated pathogenicity-related protein Back     alignment and domain information
>pfam07519 Tannase Tannase and feruloyl esterase Back     alignment and domain information
>pfam08386 Abhydrolase_4 TAP-like protein Back     alignment and domain information
>pfam02450 LACT Lecithin:cholesterol acyltransferase Back     alignment and domain information
>pfam11288 DUF3089 Protein of unknown function (DUF3089) Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>pfam01764 Lipase_3 Lipase (class 3) Back     alignment and domain information
>pfam11187 DUF2974 Protein of unknown function (DUF2974) Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Back     alignment and domain information
>KOG2029 consensus Back     alignment and domain information
>pfam05277 DUF726 Protein of unknown function (DUF726) Back     alignment and domain information