254780273

254780273

putative ABC transporter ATP-binding protein

GeneID in NCBI database:8209254Locus tag:CLIBASIA_00790
Protein GI in NCBI database:254780273Protein Accession:YP_003064686.1
Gene range:-(156624, 158243)Protein Length:539aa
Gene description:putative ABC transporter ATP-binding protein
COG prediction:none
KEGG prediction:putative ABC transporter ATP-binding protein
SEED prediction:ABC transporter, ATP-binding protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------54
MARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAKRMAQENREEISRQKAIERERDWIVSSPKARQSKSKARIRSYEELVESAAHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKLSRSSRVLSGA
cccccEEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEcccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHccccccccccEEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEcHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccccHHHHHccHHHHHHHHHccc
ccccEEEEEEcccccccccEEEEEEEEEEccccEEEEEccccccHHHHHHHHHccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccEEEEEccccccccccEEEEccEEEcccccEEEEEccccccHHHHHHHHHccccccccEEEEcccEEEEEEccccHHccccccHHHHHcccHHHHHHHHHHccHHHHHHHHcccccHHHccHccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHcc
MARKFIYHMAGLskvfgskkvlddinlsfypdakigilgpngagkSTILRIMAGIdkeyngeawlatgftvgylpqepqldlsKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLhcpadglnitslsgGEKRRVALCKLLLsspdlllldeptnhldAETIAWMEKYLREYSGAVLMVThdryfldnvtnwilevdrgkgipyqgnYSAYLQMKAKRMAQENREEISRQKAIERErdwivsspkarqsksKARIRSYEELVESAahrhpgnaqiiipvgkrlgHVVIEAKgisksyndrllidnlsfklppggivgvigpngagkTTLFRMltgdespdsgtihvGETVCLSYVDQSRDSLEAEKTVwedisggddivklngheinsraycsafnfkggdqqqrigslsggqrgRVHLAKILKSGgnvilldeptndldtETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFegnghvewfeGNFEEYEKDklsrssrvlsga
MARKFIYHMAGLSKVFGSKKVLDDINLSFYPdakigilgpngagkSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAKRMAQENREEIsrqkaiererdwivsspkarqskskarIRSYEELVEsaahrhpgnaqiiipvgkRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTvwedisggDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEeyekdklsrssrvlsga
MARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKlllsspdlllldEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAKRMAQENREEISRQKAIERERDWIVSSPKARQSKSKARIRSYEELVESAAHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLppggivgvigpngagKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKLSRSSRVLSGA
*ARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQ*************************************************************IIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQR****SGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKL***S******
MARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMK*************RQKAIERERDWIV***************SYEELVESAAHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEY***************
**RKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAKRMAQENREEISRQKAIERERDWIVSSPKARQSKSKARIRSYEELVESAAHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKLSRSSRVL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAxxxxxxxxxxxxxxxxxxxxxDWIVSSPKARQSKSKARIRSYEELVESAAHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKLSRSSRVLSGA
MARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAKRMAQENREEISRQKAIERERDWIVSSPKARQSKSKARIRSYEELVESAAHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKLSRSSRVLSGA
MARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAKRMAQENREEISRQKAIERERDWIVSSPKARQSKSKARIRSYEELVESAAHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKLSRSSRVLSGA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target539 putative ABC transporter ATP-binding protein [Candidatu
254781123 610 putative ABC transporter, ATP-binding protein [Can 2e-71
254781123 610 putative ABC transporter, ATP-binding protein [Can 1e-19
254781123610 putative ABC transporter, ATP-binding protein [Can 7e-16
254780718240 putative high-affinity zinc uptake system ATP-bind 1e-16
254780718240 putative high-affinity zinc uptake system ATP-bind 2e-11
254780744262 ABC transporter nucleotide binding/ATPase protein 9e-15
254780744262 ABC transporter nucleotide binding/ATPase protein 2e-12
254780871227 lipoprotein-releasing system ATP-binding protein l 3e-12
254780871227 lipoprotein-releasing system ATP-binding protein l 3e-10
254780538280 ABC transporter, nucleotide binding/ATPase protein 3e-12
254780538280 ABC transporter, nucleotide binding/ATPase protein 2e-05
254780704254 ABC transporter, nucleotide binding/ATPase protein 8e-12
254780704254 ABC transporter, nucleotide binding/ATPase protein 1e-10
254780596438 ABC transporter nucleotide binding/ATPase protein 2e-11
254780596 438 ABC transporter nucleotide binding/ATPase protein 1e-10
254780139257 putative ATP-binding component of ABC transporter 6e-11
254780139257 putative ATP-binding component of ABC transporter 2e-05
254780559234 thiamine transporter ATP-binding subunit [Candidat 6e-11
254780559234 thiamine transporter ATP-binding subunit [Candidat 2e-09
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 9e-10
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 6e-05
254780917596 ABC transporter, nucleotide binding/ATPase protein 6e-09
254780917596 ABC transporter, nucleotide binding/ATPase protein 3e-08
254780173257 ABC transporter related protein [Candidatus Liberi 2e-08
254780173257 ABC transporter related protein [Candidatus Liberi 4e-04
254781060249 ABC transporter, nucleotide binding/ATPase protein 5e-08
254781060249 ABC transporter, nucleotide binding/ATPase protein 3e-04
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 2e-06
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 4e-06
254780576597 ABC transporter related protein [Candidatus Liberi 2e-06
254780576597 ABC transporter related protein [Candidatus Liberi 9e-06
254780193528 lipid A ABC exporter family, fused ATPase and inne 5e-06
254780193528 lipid A ABC exporter family, fused ATPase and inne 4e-05
254780184959 excinuclease ABC subunit A [Candidatus Liberibacte 0.002
254780184959 excinuclease ABC subunit A [Candidatus Liberibacte 0.006
254780709321 cell division protein [Candidatus Liberibacter asi 0.002
>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score =  261 bits (668), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 160/513 (31%), Positives = 262/513 (51%), Gaps = 53/513 (10%)

Query: 6   IYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWL 65
           I  +  +S   G   +L D+ LS  P  +I ++G NG+GKST+L+I AGI +  +G  +L
Sbjct: 5   ILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFL 64

Query: 66  ATGFTVGYLPQEPQLDLSKTVKENI-------IEGVAHKQAILDRYNELMMNYSEKTEEE 118
            +   +GYL Q P L    T+ + I       IE      ++L ++N             
Sbjct: 65  HSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFN------------- 111

Query: 119 IAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLL 178
             + QD                             I +LS G+ R VAL K+L+S PD+L
Sbjct: 112 -LREQD----------------------------RIENLSVGQTRCVALMKMLISRPDIL 142

Query: 179 LLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNY 238
           +LDEPTNHLD  TI WME+ L + + A++ V+HDR FL+ ++   + +DRG        +
Sbjct: 143 ILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGF 202

Query: 239 SAYLQMKAKRMAQENREEISRQKAIERERDWI---VSSPKARQSKSKARIRSYEELVESA 295
           + +   K   + QE     + +K  E E++W+   V++ + R  +    +   ++ ++  
Sbjct: 203 AYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQ 262

Query: 296 AHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAG 355
                   Q  +   +  G +V+EA  I+K Y+DRL++ + S ++  G  +G++GPNGAG
Sbjct: 263 KKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAG 322

Query: 356 KTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGD-DIVKLNGH 414
           KTTL ++LTG   PD G I +G  + ++ +DQ R+ ++ +K++   ++G   D + + G 
Sbjct: 323 KTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGE 382

Query: 415 EINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETL 474
             +   Y   F F        +  LSGG++ R  +A++L    N +++DEPTNDLD ETL
Sbjct: 383 SRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETL 442

Query: 475 SALEDALENFAGCAVIISHDRMFLDRLATHILA 507
             LE  +    G  +I+SHDR FLDR  T  +A
Sbjct: 443 DFLERTITQLQGTILIVSHDRDFLDRTVTSTIA 475

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 112/224 (50%), Gaps = 19/224 (8%)

Query: 312 RLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDS 371
           RL H+     GI        L+ ++   + P   + ++G NG+GK+TL ++  G   P S
Sbjct: 7   RLDHISATIGGID-------LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQS 59

Query: 372 GTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYC--SAFNFKG 429
           G + +  +  L Y++Q+ D L    T+ + I   DD +K +  E     Y     FN + 
Sbjct: 60  GNVFLHSSSRLGYLEQNPD-LSHFSTISQYI---DDTIK-DTIEAPYSPYSLLKKFNLR- 113

Query: 430 GDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAV 489
             +Q RI +LS GQ   V L K+L S  ++++LDEPTN LD  T+  +E  L       +
Sbjct: 114 --EQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALI 171

Query: 490 IISHDRMFLDRLATHILAFEGNG--HVEWFEGNFEEYEKDKLSR 531
            +SHDR FL+ L+T  +  +     H++     FE ++K+ L +
Sbjct: 172 FVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQ 215

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 77.0 bits (188), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 114/250 (45%), Gaps = 35/250 (14%)

Query: 4   KFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEA 63
           K +     ++K +  + V+ D +L  +    IGI+GPNGAGK+T+L+++ G  K   G  
Sbjct: 282 KLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFI 341

Query: 64  WLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQ 123
            L T   +  + Q+         +E+I    +    +     + +M   E +      ++
Sbjct: 342 TLGTNLKIATIDQK---------REDIDPDKSLASYLTGSSGDSLMVRGE-SRHVAGYIK 391

Query: 124 DIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSP-DLLLLDE 182
           D                    L  P    ++     G ++  A+   +L+ P + L++DE
Sbjct: 392 DF-------------------LFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDE 432

Query: 183 PTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLD-NVTNWI----LEVDRGKGIPYQGN 237
           PTN LD ET+ ++E+ + +  G +L+V+HDR FLD  VT+ I    +E   G  I Y G 
Sbjct: 433 PTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGG 492

Query: 238 YSAYLQMKAK 247
           YS  L  + K
Sbjct: 493 YSDMLVQQKK 502

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 107/221 (48%), Gaps = 40/221 (18%)

Query: 20  KVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQ 79
           K+L DIN +  P+  + ++GPNG+GKSTI +++ GI K   G         VGY+PQ   
Sbjct: 24  KILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSVKRHPQLIVGYVPQ--- 80

Query: 80  LDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQ 139
               K   EN +         L R+  L M     + +++ ++ D ++  G ++      
Sbjct: 81  ----KVTIENTLP------LSLMRFMTLSM---PSSRDDVLQILDRVNLIGKYNR----- 122

Query: 140 VAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAE---TIAWME 196
                        NI  LSGGE +R  L K LL  P+LL+LDEP   +D     ++  + 
Sbjct: 123 -------------NIKDLSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELI 169

Query: 197 KYLREYSGA-VLMVTHDRYFLDNVTNWILEVDRGKGIPYQG 236
             +R+ +G  +L+++H+ + +   T+ ++ ++    I YQG
Sbjct: 170 TSVRQSTGCGILLISHNLHMVMASTDTVICLN--NRICYQG 208

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 85/173 (49%), Gaps = 21/173 (12%)

Query: 332 LIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQS--- 388
           ++ +++F + P  IV +IGPNG+GK+T+ +++TG   P  G++     + + YV Q    
Sbjct: 25  ILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSVKRHPQLIVGYVPQKVTI 84

Query: 389 RDSLEAEKTVWEDI---SGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRG 445
            ++L      +  +   S  DD++++              N   G   + I  LSGG+  
Sbjct: 85  ENTLPLSLMRFMTLSMPSSRDDVLQI----------LDRVNLI-GKYNRNIKDLSGGEFQ 133

Query: 446 RVHLAKILKSGGNVILLDEPTNDLDTE---TLSALEDALENFAGCAV-IISHD 494
           R  LAK L    N+++LDEP   +D     +L  L  ++    GC + +ISH+
Sbjct: 134 RALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSVRQSTGCGILLISHN 186

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 73.2 bits (178), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 96/191 (50%), Gaps = 16/191 (8%)

Query: 317 VIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHV 376
           ++ A  ++K YN   ++  +   + PG IVG++GPNGAGKTT F M+TG    DSG+I +
Sbjct: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84

Query: 377 -GETVC-----------LSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSA 424
            G  +            +SY+ Q   S+    TV E+I    ++ + +  + + +     
Sbjct: 85  DGNDITKMPMYRRARLGISYLPQEA-SIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143

Query: 425 FNFKGGDQQQRIGS-LSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALEN 483
             F     +  +   LSGGQR R+ +A+ L S  + ILLDEP   +D   +S +   + +
Sbjct: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203

Query: 484 FA--GCAVIIS 492
            A  G  ++I+
Sbjct: 204 LASRGIGILIT 214

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 65.5 bits (158), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 104/235 (44%), Gaps = 50/235 (21%)

Query: 10  AGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGE------- 62
             L+K + S  V+  ++L   P   +G+LGPNGAGK+T   +M G+    +G        
Sbjct: 29  CSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGND 88

Query: 63  -----AWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEE 117
                 +      + YLPQE  +    TV+ENI+       A+L+ Y           E+
Sbjct: 89  ITKMPMYRRARLGISYLPQEASIFRGLTVEENIL-------AVLEVY-----------EK 130

Query: 118 EIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDL 177
           +  K  + +DS     L  E  +  +  H  A       LSGG++RR+ + + L+S P  
Sbjct: 131 DKKKRHEKLDS-----LLKEFNIT-KWRHVLA-----PLLSGGQRRRLEIARSLVSFPSY 179

Query: 178 LLLDEPTNHLDAETIAWMEKYLREYSG---AVLMVTHDRYFLDNVTNWILEVDRG 229
           +LLDEP   +D   I+ +   +R+ +     +L+  H      NV   +  +DR 
Sbjct: 180 ILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDH------NVHEILTLIDRA 228

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 97/218 (44%), Gaps = 62/218 (28%)

Query: 21  VLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFT---------- 70
           VL++++LS      + ++ P+G GKSTIL I   ++    G   +A              
Sbjct: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84

Query: 71  -----VGYLPQEPQLDLSKTVKENII-----EGVAHKQAILDRYNELM--MNYSEKTEEE 118
                +G++ QE +L +  +V ENII      G+ HK A    Y   M  ++Y + ++  
Sbjct: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTA----YQRAMDLLSYMDMSQYA 140

Query: 119 IAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLL 178
             +  DI                                SGGE++RVA+C+ + + P ++
Sbjct: 141 NRRSSDI--------------------------------SGGEQQRVAICRAIANKPLII 168

Query: 179 LLDEPTNHLD---AETIAWMEKYLREYSG-AVLMVTHD 212
           L DEPT +LD   A+ +  + KYL   SG A L+ TH+
Sbjct: 169 LADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHN 206

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 71/158 (44%), Gaps = 17/158 (10%)

Query: 332 LIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDS 391
           +++N+   L  G IV ++ P+G GK+T+  +    E PD G + +   +C    D  +  
Sbjct: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84

Query: 392 LEAEK--------------TVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQ--QQR 435
           L   K              +V E+I     I  +N      RA     ++    Q   +R
Sbjct: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAM-DLLSYMDMSQYANRR 143

Query: 436 IGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTET 473
              +SGG++ RV + + + +   +IL DEPT +LD +T
Sbjct: 144 SSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKT 181

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 89/177 (50%), Gaps = 27/177 (15%)

Query: 318 IEAKGISKSY-NDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHV 376
           +E K IS +Y N    +++++  +P   I  +IG NGAGK+TLF+ + G    D G+I +
Sbjct: 12  LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71

Query: 377 -GETV-------CLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHE-INSRAYCSAFNF 427
             +TV        ++Y+ Q+      E   W      +D+V +  ++ +N R   S  ++
Sbjct: 72  FNQTVENALKADLIAYIPQT------ESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDY 125

Query: 428 K-----------GGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTET 473
           +              +Q++IG LS GQ+ RV LA+ L     VI++DEP   +D +T
Sbjct: 126 RIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 91/205 (44%), Gaps = 40/205 (19%)

Query: 22  LDDINLSFYPDAKI-GILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFT--------VG 72
           L+D+NL F P+  I  ++G NGAGKST+ + + G+     G   +             + 
Sbjct: 28  LEDVNL-FIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIA 86

Query: 73  YLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLW 132
           Y+PQ   +D +  +   ++E V     ++ RY    MN+              + S   +
Sbjct: 87  YIPQTESIDWTFPI---LVEDV----VMMGRYKH--MNWRR------------VASNNDY 125

Query: 133 DLETEV--QVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAE 190
            + TE    V + S+     G     LS G+++RV L + L     ++++DEP   +D +
Sbjct: 126 RIVTEALENVGMSSMRQRQIG----ELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181

Query: 191 T---IAWMEKYLREYSGAVLMVTHD 212
           T   + ++ K L      +L+ TH+
Sbjct: 182 TEREMIFLLKSLLNEDIMILVSTHN 206

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 63.5 bits (153), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 104/233 (44%), Gaps = 56/233 (24%)

Query: 6   IYHMAG--LSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKE----- 58
           IY M    +S  +G K+ L DINL    ++   ++GP+G GKST LR +  +++      
Sbjct: 4   IYKMISNKVSVCYGEKRALFDINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCV 63

Query: 59  YNGEAWL-------------ATGFTVGYLPQEPQLDLSKTVKENI-----IEGVAHKQAI 100
           + GE  L                  VG + Q P     K++ +N+     I G+ + +A 
Sbjct: 64  FTGEIILDGKNIYQSSVDVVRLRARVGMVFQRPN-PFPKSIYDNVAYGPRIHGLGNNKAD 122

Query: 101 LDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGG 160
           +D+  E+ +  +    E   +L                       H      + + LSGG
Sbjct: 123 IDQIVEMSLKKASLFNEVKDRL----------------------FH------DASLLSGG 154

Query: 161 EKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREY--SGAVLMVTH 211
           +++RV + + L  +P+++L+DEP + LD    A +E+ + E   S  +++VTH
Sbjct: 155 QQQRVCIARALAVNPEVILMDEPCSALDPIATASVEELIHELRESLTIVIVTH 207

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 105/234 (44%), Gaps = 36/234 (15%)

Query: 323 ISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRML-----TGDESPDSGTIHV- 376
           +S  Y ++  + +++ K+P   +  +IGP+G GK+T  R L     T D    +G I + 
Sbjct: 12  VSVCYGEKRALFDINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEIILD 71

Query: 377 GETVCLSYVDQSRDSLEAE------------KTVWEDISGGDDIVKLNGHEIN------- 417
           G+ +  S VD  R  L A             K+++++++ G  I  L  ++ +       
Sbjct: 72  GKNIYQSSVDVVR--LRARVGMVFQRPNPFPKSIYDNVAYGPRIHGLGNNKADIDQIVEM 129

Query: 418 SRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSAL 477
           S    S FN            LSGGQ+ RV +A+ L     VIL+DEP + LD    +++
Sbjct: 130 SLKKASLFNEVKDRLFHDASLLSGGQQQRVCIARALAVNPEVILMDEPCSALDPIATASV 189

Query: 478 EDALENF--AGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKL 529
           E+ +     +   VI++H      R++     F   GH+       EE + DK+
Sbjct: 190 EELIHELRESLTIVIVTHSMQQAARVSQRAAMFHM-GHL------VEEDDTDKM 236

>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 104/243 (42%), Gaps = 62/243 (25%)

Query: 6   IYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWL 65
           I     L K+ G+  VLD +N +      +G+LG +G+GKST+LRI+AG+    +G+   
Sbjct: 17  ICQSFSLKKISGNLLVLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLF 76

Query: 66  ATGFTVGYLPQEPQLDLSK-----------TVKENIIEGVAHKQAILDRYNELMMNYSEK 114
                 G   ++P  D+S            TV EN+  G+  K           ++  E+
Sbjct: 77  K-----GKKIKDPPKDISVVFQTFALFPWLTVLENVELGLKAKG----------IDKEER 121

Query: 115 TEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSS 174
            +  ++ + D+I   G            ES H        T +SGG  +RV   +  +  
Sbjct: 122 RKRALSAI-DLIGLDGF-----------ESAHT-------TEISGGMLQRVGFARAFVVF 162

Query: 175 PDLLLLDEPTNHLDAETI---------AWMEKYLREYSGAVLMVTHDRYFLDNVTNWILE 225
           P LLL+DEP + LD  T           W+E  L   S  +LMVTH      N+   +L 
Sbjct: 163 PSLLLMDEPFSALDVLTAENLRTDLIDLWIEGRLPIES--MLMVTH------NIEEAVLM 214

Query: 226 VDR 228
            DR
Sbjct: 215 CDR 217

>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 89/171 (52%), Gaps = 16/171 (9%)

Query: 317 VIEAKGISKSYN------DRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPD 370
           ++E + I +S++      + L++D ++F +  G IVG++G +G+GK+TL R++ G  SP 
Sbjct: 11  LLEIQDICQSFSLKKISGNLLVLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPS 70

Query: 371 SGTIHV-GETVC-----LSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYCSA 424
           SG +   G+ +      +S V Q+  +L    TV E++  G     ++  E   RA  SA
Sbjct: 71  SGQVLFKGKKIKDPPKDISVVFQTF-ALFPWLTVLENVELGLKAKGIDKEERRKRA-LSA 128

Query: 425 FNFKG--GDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTET 473
            +  G  G +      +SGG   RV  A+      +++L+DEP + LD  T
Sbjct: 129 IDLIGLDGFESAHTTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLT 179

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 60.5 bits (145), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 98/223 (43%), Gaps = 46/223 (20%)

Query: 35  IGILGPNGAGKSTILRIMAGIDKEYNGEAW-------LATG-----FT--VGYLPQEPQL 80
           +G++G +G GKS ++R + G+    +GE         LA G     F+  +G L Q   L
Sbjct: 42  LGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNFAFSAKLGVLFQHGAL 101

Query: 81  DLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQV 140
             S TV+ENI                     S   +E +    D+I+           ++
Sbjct: 102 FSSMTVQENI---------------------SMPIKEHLNLPADLIEHI------VHTKI 134

Query: 141 AIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLD---AETIAWMEK 197
           AI  L      L    LSGG  +RV+L + L   PDLL LDEPT+ LD   AE    +  
Sbjct: 135 AIVGLPPETANLMPFQLSGGMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLI 194

Query: 198 YLREYSG-AVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYS 239
            LR   G +V M+THD   L +  N +  + + KGI  +G  S
Sbjct: 195 KLRHSLGLSVYMITHDLNNLISTCNRVAVIQK-KGIMKEGTIS 236

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 80/177 (45%), Gaps = 30/177 (16%)

Query: 343 GGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHV-GETVCLSYVDQS------------R 389
           G I+GVIG +G GK+ L R + G     SG + V GE + L+   Q+             
Sbjct: 39  GEILGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNFAFSAKLGVLFQH 98

Query: 390 DSLEAEKTVWEDISG--------GDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSG 441
            +L +  TV E+IS           D+++   H ++++        +  +       LSG
Sbjct: 99  GALFSSMTVQENISMPIKEHLNLPADLIE---HIVHTKIAIVGLPPETANLMPF--QLSG 153

Query: 442 GQRGRVHLAKILKSGGNVILLDEPTNDLD---TETLSALEDALENFAGCAV-IISHD 494
           G   RV LA+ L    +++ LDEPT+ LD    E    L   L +  G +V +I+HD
Sbjct: 154 GMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMITHD 210

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 60.5 bits (145), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 84/192 (43%), Gaps = 42/192 (21%)

Query: 34  KIGILGPNGAGKSTILRIMAGIDKEYNGEAWL---------ATGFTVGYLPQEPQLDLSK 84
           +I ILGP+GAGKST+L +MAG      G  +L          +   +  L QE  L    
Sbjct: 27  RIVILGPSGAGKSTLLSLMAGFKYPTRGSIFLNGQNHTRSSPSKRPLSILFQENNLFSHL 86

Query: 85  TVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIES 144
           TV +NI  G+A     LD Y               A+++ +++   L D           
Sbjct: 87  TVWQNIALGIA-PNLRLDHYQH-------------AQVKQMLEKVFLEDFFNRFP----- 127

Query: 145 LHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDA----ETIAWMEKYLR 200
                     + +SGG+++RVAL + L+    +LLLDEP    D     E +  +++   
Sbjct: 128 ----------SQMSGGQRQRVALARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQVCD 177

Query: 201 EYSGAVLMVTHD 212
           E    +LM++H+
Sbjct: 178 ERQLTLLMISHN 189

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 83/185 (44%), Gaps = 27/185 (14%)

Query: 346 VGVIGPNGAGKTTLFRMLTGDESPDSGTIHVG---------ETVCLSYVDQSRDSLEAEK 396
           + ++GP+GAGK+TL  ++ G + P  G+I +              LS + Q  ++L +  
Sbjct: 28  IVILGPSGAGKSTLLSLMAGFKYPTRGSIFLNGQNHTRSSPSKRPLSILFQE-NNLFSHL 86

Query: 397 TVWEDISGG-------DDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHL 449
           TVW++I+ G       D        ++  + +   F  +   Q      +SGGQR RV L
Sbjct: 87  TVWQNIALGIAPNLRLDHYQHAQVKQMLEKVFLEDFFNRFPSQ------MSGGQRQRVAL 140

Query: 450 AKILKSGGNVILLDEPTNDLDT----ETLSALEDALENFAGCAVIISHDRMFLDRLATHI 505
           A+ L     ++LLDEP    D     E L  L+   +      ++ISH+     ++AT  
Sbjct: 141 ARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQVCDERQLTLLMISHNLEDSMQIATRF 200

Query: 506 LAFEG 510
           +   G
Sbjct: 201 IVIAG 205

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 56.6 bits (135), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 89/221 (40%), Gaps = 50/221 (22%)

Query: 308 PVGKRLGHVVIEAKGI--SKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTG 365
           P+  RL +  I AK I        RL+  NLSF +P G    + GP+G GK+     + G
Sbjct: 321 PISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLG 380

Query: 366 DESPDSGTIHVGE-----------TVCLSYVDQ-----------------SRDSLEAEKT 397
             + + GTI  G+           +  + Y+ Q                  ++SL   + 
Sbjct: 381 LLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQK 440

Query: 398 VWEDISGGDDIVKL-NGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSG 456
             + +   +DI+ L NG++     YCS               +      ++ L++I+ + 
Sbjct: 441 TAKIVGCHEDILSLKNGYQ---TTYCS-------------DEIPYNIVQKIRLSRIIANN 484

Query: 457 GNVILLDEPTNDLDTETLSALEDALENF---AGCAVIISHD 494
             ++L+DEP   LD E  +     L+ F       VIISHD
Sbjct: 485 PAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHD 525

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 40.8 bits (94), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 98/216 (45%), Gaps = 45/216 (20%)

Query: 15  VFGSKKVLDDI--NLSF-YPDAKIGIL-GPNGAGKSTILRIMAGI-----------DKEY 59
           VF  KK    I  NLSF  P+    I+ GP+G GKS  L  M G+           D++ 
Sbjct: 337 VFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQI 396

Query: 60  NGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEI 119
           + +        +GYL Q   L    ++ ENII  ++H Q      N L +  ++KT + +
Sbjct: 397 SRDFIEKFSAQIGYLSQHCSL-FPISITENII--LSHDQ------NSLHI--AQKTAKIV 445

Query: 120 AKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLL 179
              +DI+  K  +          ++ +C  +      +     +++ L +++ ++P +LL
Sbjct: 446 GCHEDILSLKNGY----------QTTYCSDE------IPYNIVQKIRLSRIIANNPAILL 489

Query: 180 LDEPTNHLDAET---IAWMEKYLREYSGAVLMVTHD 212
           +DEP  HLD E       + K  +E    +++++HD
Sbjct: 490 MDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHD 525

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 94/197 (47%), Gaps = 30/197 (15%)

Query: 335 NLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHV-GETVC----------LS 383
           NL FK   G +  ++GP+G+GK+T+  +L     P SG+I + G  +           +S
Sbjct: 373 NLCFK--SGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERIS 430

Query: 384 YVDQSRDSLEAEKTVWEDISGG------DDIVKL----NGHEINSRAYCSAFNFKGGDQQ 433
           YV Q  D      TV  +I  G      ++++++    N H+    +    ++   G+  
Sbjct: 431 YVGQ--DVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDF-IMSLPQGYDTYVGENG 487

Query: 434 QRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFA-GCAVIIS 492
               +LSGGQ+ R+ +A+ +   G++++LDE T+ LDT T + +  AL     G   I+ 
Sbjct: 488 ---SNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVI 544

Query: 493 HDRMFLDRLATHILAFE 509
             R+     A HI+  E
Sbjct: 545 AHRISTIIEADHIIFIE 561

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 87/195 (44%), Gaps = 46/195 (23%)

Query: 15  VFGSKK----VLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGI------DKEYNGEAW 64
           VF S K    VL  INL F       ++GP+G+GKSTI+ ++  +        E +G   
Sbjct: 358 VFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINI 417

Query: 65  LATGFT-----VGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEI 119
               F+     + Y+ Q+  L  S TV+ NI+ G                     TEEE+
Sbjct: 418 RDITFSSLRERISYVGQDVFL-FSNTVRYNILIG-----------------RPMATEEEM 459

Query: 120 AKLQDIIDSKGLWDLETEVQVAIESLHCPAD---GLNITSLSGGEKRRVALCKLLLSSPD 176
               +I  S    D        I SL    D   G N ++LSGG+K+R+A+ + +L    
Sbjct: 460 I---EIAKSANAHDF-------IMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGH 509

Query: 177 LLLLDEPTNHLDAET 191
           +L+LDE T+ LD  T
Sbjct: 510 ILVLDEATSALDTHT 524

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 109/244 (44%), Gaps = 48/244 (19%)

Query: 5   FIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAW 64
           F   +  L+K +G+   L DINL+     ++ I GP+G+GKST++R +  I+K   GE  
Sbjct: 16  FAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEI- 74

Query: 65  LATGFT--------------VGYLPQEPQLDLSKTVKENIIEGVAHKQAILDR-YNELMM 109
           +  G                VG + Q   L  + +V EN   G    + +  +   EL M
Sbjct: 75  IINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAM 134

Query: 110 NYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCK 169
           +Y  K                       V++A +S        + + LSGGE +R A+ +
Sbjct: 135 HYLNK-----------------------VKIADKSHR------SSSLLSGGESQRAAIAR 165

Query: 170 LLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSG---AVLMVTHDRYFLDNVTNWILEV 226
            L   P ++L DEPT+ LD E +  +   + E +     ++ VTH+  F   V + ++ +
Sbjct: 166 SLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFM 225

Query: 227 DRGK 230
           D+G+
Sbjct: 226 DQGQ 229

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 37.7 bits (86), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 99/240 (41%), Gaps = 29/240 (12%)

Query: 318 IEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVG 377
           +E K ++K Y +   + +++  +  G  V + GP+G+GK+TL R +   E   +G I + 
Sbjct: 18  VEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIIN 77

Query: 378 ETVCLSYVDQSRDSLEAEK---------------TVWEDISGGDDIV-KLNGHEINSRAY 421
               +   D  R+  E  +               +V E+ + G   V K+   +    A 
Sbjct: 78  G---IPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAM 134

Query: 422 CSAFNFKGGDQQQRIGSLSGGQRG-RVHLAKILKSGGNVILLDEPTNDLDTETLSALEDA 480
                 K  D+  R  SL  G    R  +A+ L     ++L DEPT+ LD E +  + D 
Sbjct: 135 HYLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDI 194

Query: 481 LENFAG---CAVIISHDRMFLDRLATHILAF------EGNGHVEWFEGNFEEYEKDKLSR 531
           +   A      V ++H+  F  ++A  ++        E N   E+F     E  +  LS+
Sbjct: 195 MIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQ 254

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 50.8 bits (120), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 114/248 (45%), Gaps = 27/248 (10%)

Query: 20  KVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQ 79
           +++  +NL   P   + I+GPNG+GKST+  +++G  K+Y          T G +  + +
Sbjct: 17  EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG-HKDYE--------ITAGDILYKGE 67

Query: 80  LDLSKTVKENIIEG--------VAHKQAILDRYNELMMNYSEKTEEEIAKLQDIID-SKG 130
             L  ++ E   +G        V     I+ ++ ++ +N   K   E   L  I D ++ 
Sbjct: 68  SILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELL--IPDFTRK 125

Query: 131 LWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAE 190
           +  +  E+ + ++ L  P   LN+   SGGEK+   + ++ L  P L +LDE  + LD +
Sbjct: 126 VRKITAELGINMDMLKRP---LNL-GFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181

Query: 191 TI---AWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAK 247
            +   A     LR    + L++TH +  L+ +    + V     I   G+YS  L ++  
Sbjct: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241

Query: 248 RMAQENRE 255
             A+  +E
Sbjct: 242 GYAELIKE 249

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 38.5 bits (88), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 328 NDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTG 365
            D  +I  L+ K+ P  +V ++GPNG+GK+TL  +L+G
Sbjct: 14  TDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG 51

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 83/202 (41%), Gaps = 33/202 (16%)

Query: 337 SFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVG------------------- 377
           + ++  G I+ ++G +GAGK+TL R + G      G + V                    
Sbjct: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108

Query: 378 --ETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRA--YCSAFNF-KGGDQ 432
              TV + +    + +L   +TV  ++  G + + +   E  SR   +    N  K  D 
Sbjct: 109 RMHTVSMVF---QQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADC 165

Query: 433 QQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDAL----ENFAGCA 488
             +I  LSGG + RV  A+   +G  ++L+DEP + LD      L+D L           
Sbjct: 166 --KINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTI 223

Query: 489 VIISHDRMFLDRLATHILAFEG 510
           V +SHD     RL   I   EG
Sbjct: 224 VFVSHDINEAFRLGNRIAIMEG 245

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 44.3 bits (103), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 86/191 (45%), Gaps = 36/191 (18%)

Query: 37  ILGPNGAGKSTILRIMAGIDKEYNGEAWLAT--GFTVGYLPQEPQLDLSKTVKENIIEGV 94
           ++G +GAGKST+LR + G+     GE  + T  GF     P     ++ + ++ + +  V
Sbjct: 60  LMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVN---PYAADANVLRKLRMHTVSMV 116

Query: 95  AHKQAILD-----RYNELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVA----IESL 145
             + A+L      R  EL + + +                 + D+E + +VA    I +L
Sbjct: 117 FQQFALLPWRTVARNVELGLEFLD-----------------IPDVERKSRVAEHLEIVNL 159

Query: 146 HCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYL----RE 201
              AD   I  LSGG K+RV   +   +   +LL+DEP + LD      ++  L    R+
Sbjct: 160 TKWAD-CKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRK 218

Query: 202 YSGAVLMVTHD 212
               ++ V+HD
Sbjct: 219 LKKTIVFVSHD 229

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 85/182 (46%), Gaps = 36/182 (19%)

Query: 21  VLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQL 80
           +   I+    P  K  ++G +G GKST+ +++    + Y+ +         G +  + Q 
Sbjct: 372 IFKGISFEIAPSKKTALIGESGVGKSTVAKLLY---RLYDIKG--------GIITIDGQ- 419

Query: 81  DLSKTVKENIIE--GVAHKQAILD----RYNELMMNYSEKTEE-----EIAKLQDIIDSK 129
           D+ K  KE++ +  G+  +  IL     RYN L  N +   +E     E+A+L+  I   
Sbjct: 420 DIKKITKESLRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFI--- 476

Query: 130 GLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDA 189
                     + + + +    G     LSGGEK+RV++ + +L +P +++ DE T+ LD 
Sbjct: 477 ----------MKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDI 526

Query: 190 ET 191
            T
Sbjct: 527 IT 528

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 43.5 bits (101), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 102/224 (45%), Gaps = 29/224 (12%)

Query: 314 GHVVIEAKGISKSYNDR-LLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSG 372
           GH+V     +S SYN    +   +SF++ P     +IG +G GK+T+ ++L        G
Sbjct: 355 GHIVFN--NVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGG 412

Query: 373 TIHV-GETVCLSYVDQSRDSL-EAEKTVWEDISGGDDIVKLNGHEINSRA----YCSA-- 424
            I + G+ +       +++SL +    + +D    +D ++ N    N  A     C+A  
Sbjct: 413 IITIDGQDIK----KITKESLRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVE 468

Query: 425 ------FNFK---GGDQQ--QRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTET 473
                 F  K   G D    +R   LSGG++ RV +A+ +     +I+ DE T+ LD  T
Sbjct: 469 VAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIIT 528

Query: 474 LSALEDALENFAG--CAVIISHDRMFLDRLATHILAFEGNGHVE 515
              ++ AL   +     ++I+H R+     A +I+ F+    VE
Sbjct: 529 ERHIQTALATLSKNRTTLVIAH-RLSTITDADNIIVFDQGTVVE 571

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 44.3 bits (103), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 77/165 (46%), Gaps = 25/165 (15%)

Query: 328 NDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHV-GETVCLSYVD 386
           + R ++ N++F + PG  + ++G +GAGKT++F ++     P SG++ + G  + L  ++
Sbjct: 301 SKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLE 360

Query: 387 QSR--------DSLEAEKTVWEDISGGDDIVKLNGHEI-NSRAYCSAFNFKG-------- 429
           + R          +    +V+++I+ G         EI N+     A  F G        
Sbjct: 361 EIRRFIAWVPQHPIMIAASVYDNIAIGCP--HATRKEIQNAAMLAQAHEFIGCLENGYDT 418

Query: 430 --GDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTE 472
             GD       LS GQ  R+ +A+ +     ++LLDE  + LD E
Sbjct: 419 ILGDGAVH---LSTGQIQRIAIARAILKDSPILLLDEMGSALDIE 460

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 80/194 (41%), Gaps = 36/194 (18%)

Query: 19  KKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLA-----------T 67
           + +L ++N +  P   I ++G +GAGK++I  ++       +G   +             
Sbjct: 303 RSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEI 362

Query: 68  GFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIID 127
              + ++PQ P + ++ +V +NI  G  H                  T +EI        
Sbjct: 363 RRFIAWVPQHPIM-IAASVYDNIAIGCPHA-----------------TRKEI-------Q 397

Query: 128 SKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHL 187
           +  +     E    +E+ +    G     LS G+ +R+A+ + +L    +LLLDE  + L
Sbjct: 398 NAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSAL 457

Query: 188 DAETIAWMEKYLRE 201
           D E    + K LRE
Sbjct: 458 DIENEQKIWKVLRE 471

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 35.8 bits (81), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 434 QRIGSLSGGQRGRVHLAKILK---SGGNVILLDEPTNDLDTETLSALEDALENFA--GCA 488
           Q   +LSGG+  RV LAK L    +G  + +LDEPT  L    ++ L + L      G +
Sbjct: 841 QSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNS 900

Query: 489 VIISHDRMFLDRLATHILAF 508
           +I+    + + + A  IL F
Sbjct: 901 IIVIEHNLEVIKTADWILDF 920

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 34.3 bits (77), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 151 GLNITSLSGGEKRRVALCKLL---LSSPDLLLLDEPTNHLDAETIAWMEKYLR---EYSG 204
           G +  +LSGGE +RV L K L    +   L +LDEPT  L    IA +   L    +   
Sbjct: 840 GQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGN 899

Query: 205 AVLMVTHDRYFLDNVTNWILE 225
           +++++ H+   +    +WIL+
Sbjct: 900 SIIVIEHNLEVI-KTADWILD 919

>gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Back     alignment
 Score = 35.4 bits (80), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 10/112 (8%)

Query: 345 IVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISG 404
           ++ V+G NG GKTT+   L+   S        G  V L+  D  R +   +  +W D + 
Sbjct: 113 VILVVGVNGVGKTTVIGKLSKKMS------DAGLKVMLAAGDTFRSAAIDQLKIWADRTS 166

Query: 405 GDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSG 456
            D +      EI S A   A+      Q +++  L     GR+H   IL +G
Sbjct: 167 ADFVCS----EIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAG 214

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target539 putative ABC transporter ATP-binding protein [Candidatu
315122832531 putative ABC transporter ATP-binding protein [Candidatu 1 0.0
163761112549 putative atp-binding abc transporter protein [Hoeflea p 1 0.0
15965954549 putative ABC transporter ATP-binding protein [Sinorhizo 1 0.0
227822676549 putative ABC transporter ATP-binding protein [Sinorhizo 1 0.0
222086469549 ABC transporter [Agrobacterium radiobacter K84] Length 1 0.0
150397318549 putative ABC transporter ATP-binding protein [Sinorhizo 1 0.0
110634383549 putative ABC transporter ATP-binding protein [Mesorhizo 1 0.0
86358476549 putative ABC transporter ATP-binding protein [Rhizobium 1 0.0
297248734584 phosphate-transporting ATPase [Brucella abortus bv. 5 s 1 0.0
62290348549 putative ABC transporter ATP-binding protein [Brucella 1 0.0
>gi|315122832|ref|YP_004063321.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 531 Back     alignment and organism information
 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/531 (90%), Positives = 508/531 (95%)

Query: 1   MARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYN 60
           MARKFIYHM+GL KVFG+KK+LDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYN
Sbjct: 1   MARKFIYHMSGLDKVFGNKKILDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYN 60

Query: 61  GEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIA 120
           GEAWLA GFTVGYLPQEPQLD SKTV+ENI+EG+AHKQ ILDRYN+L+MNYSE+T EEIA
Sbjct: 61  GEAWLAAGFTVGYLPQEPQLDPSKTVRENIVEGIAHKQCILDRYNDLIMNYSEETAEEIA 120

Query: 121 KLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLL 180
           KLQDIIDSKGLW+L+TE++VAIESL CP    N+ SLSGGEKRRVALC+LLLS PDLLLL
Sbjct: 121 KLQDIIDSKGLWNLDTELKVAIESLRCPDGDSNVVSLSGGEKRRVALCRLLLSRPDLLLL 180

Query: 181 DEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSA 240
           DEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSA
Sbjct: 181 DEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSA 240

Query: 241 YLQMKAKRMAQENREEISRQKAIERERDWIVSSPKARQSKSKARIRSYEELVESAAHRHP 300
           YLQMKAKRM Q++REEISRQKAIERER+WIVSSPKARQSKSKARIRSYEELVESA++RHP
Sbjct: 241 YLQMKAKRMEQDSREEISRQKAIEREREWIVSSPKARQSKSKARIRSYEELVESASNRHP 300

Query: 301 GNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLF 360
           GNAQIIIPVG+RLG+VVIEAK ISKSYN   LI+NLSFKLPPGGIVGVIGPNGAGKTTLF
Sbjct: 301 GNAQIIIPVGRRLGNVVIEAKNISKSYNGCPLINNLSFKLPPGGIVGVIGPNGAGKTTLF 360

Query: 361 RMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRA 420
           R+LTG E  DSG IH+GETVCLSYVDQSRDSL+AEKTVWE+ISGGDDIVKLNGHEINSRA
Sbjct: 361 RILTGAEPLDSGEIHIGETVCLSYVDQSRDSLDAEKTVWEEISGGDDIVKLNGHEINSRA 420

Query: 421 YCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDA 480
           YC AFNFKGGDQQQRIG LSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLS+LEDA
Sbjct: 421 YCGAFNFKGGDQQQRIGLLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSSLEDA 480

Query: 481 LENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEEYEKDKLSR 531
           LENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFE+YEKDKLSR
Sbjct: 481 LENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWFEGNFEDYEKDKLSR 531


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163761112|ref|ZP_02168189.1| putative atp-binding abc transporter protein [Hoeflea phototrophica DFL-43] Length = 549 Back     alignment and organism information
>gi|15965954|ref|NP_386307.1| putative ABC transporter ATP-binding protein [Sinorhizobium meliloti 1021] Length = 549 Back     alignment and organism information
>gi|227822676|ref|YP_002826648.1| putative ABC transporter ATP-binding protein [Sinorhizobium fredii NGR234] Length = 549 Back     alignment and organism information
>gi|222086469|ref|YP_002545003.1| ABC transporter [Agrobacterium radiobacter K84] Length = 549 Back     alignment and organism information
>gi|150397318|ref|YP_001327785.1| putative ABC transporter ATP-binding protein [Sinorhizobium medicae WSM419] Length = 549 Back     alignment and organism information
>gi|110634383|ref|YP_674591.1| putative ABC transporter ATP-binding protein [Mesorhizobium sp. BNC1] Length = 549 Back     alignment and organism information
>gi|86358476|ref|YP_470368.1| putative ABC transporter ATP-binding protein [Rhizobium etli CFN 42] Length = 549 Back     alignment and organism information
>gi|297248734|ref|ZP_06932452.1| phosphate-transporting ATPase [Brucella abortus bv. 5 str. B3196] Length = 584 Back     alignment and organism information
>gi|62290348|ref|YP_222141.1| putative ABC transporter ATP-binding protein [Brucella abortus bv. 1 str. 9-941] Length = 549 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target539 putative ABC transporter ATP-binding protein [Candidatu
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 0.0
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 0.0
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase component; R 1e-103
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 7e-68
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 5e-65
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 6e-63
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 5e-61
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 3e-51
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 2e-40
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 9e-36
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 2e-35
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 3e-27
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 7e-21
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 1e-162
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 1e-39
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 6e-28
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 2e-27
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 4e-26
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 9e-26
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 1e-25
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 1e-25
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 1e-25
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 8e-25
KOG0927 614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 1e-24
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 2e-24
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, ATPase 5e-24
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 2e-23
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 4e-23
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 4e-23
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 5e-23
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 5e-23
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 7e-23
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 9e-23
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 2e-22
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine transport 2e-22
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 2e-22
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 3e-22
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 5e-22
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 7e-22
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 8e-22
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 3e-21
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 5e-21
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 5e-21
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 6e-21
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 1e-20
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 1e-20
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 2e-20
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 4e-20
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 4e-20
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 5e-20
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 7e-20
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 9e-20
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 1e-19
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 2e-19
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 2e-19
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 2e-19
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 3e-19
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 6e-19
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 8e-19
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 1e-18
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 1e-18
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 2e-18
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 2e-18
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 2e-18
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 2e-18
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 3e-18
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 3e-18
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 4e-18
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 5e-18
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 6e-18
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 7e-18
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 9e-18
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 1e-17
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 1e-17
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 2e-17
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 2e-17
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 5e-17
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 5e-17
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 1e-16
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 1e-16
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 1e-16
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 1e-16
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 2e-16
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 2e-16
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 3e-16
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 3e-16
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 3e-16
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 3e-16
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 3e-16
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding subu 3e-16
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 4e-16
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 8e-16
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 8e-16
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 1e-15
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 1e-15
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 1e-15
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-binding pro 1e-15
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 2e-15
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 2e-15
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 3e-15
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 3e-15
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 3e-15
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 5e-15
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 6e-15
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 6e-15
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 8e-15
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 8e-15
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 9e-15
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 1e-14
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 1e-14
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 1e-14
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 1e-14
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 1e-14
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 2e-14
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 2e-14
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 3e-14
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 3e-14
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 4e-14
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 5e-14
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 7e-14
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 7e-14
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 9e-14
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 1e-13
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 1e-13
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 1e-13
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 2e-13
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 2e-13
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 2e-13
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 3e-13
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 4e-13
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 4e-13
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 5e-13
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 5e-13
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 5e-13
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 6e-13
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 6e-13
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 7e-13
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 9e-13
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 2e-12
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 2e-12
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 2e-12
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 2e-12
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 2e-12
PLN03073 718 PLN03073, PLN03073, ABC transporter F family; Provision 3e-12
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 3e-12
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 4e-12
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 4e-12
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 4e-12
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 5e-12
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 5e-12
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 6e-12
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 6e-12
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 8e-12
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 9e-12
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 1e-11
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 1e-11
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 1e-11
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 1e-11
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 1e-11
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 2e-11
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 2e-11
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 2e-11
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 3e-11
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 3e-11
COG4148 352 COG4148, ModC, ABC-type molybdate transport system, ATP 4e-11
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 5e-11
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 5e-11
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 6e-11
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine transpo 7e-11
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 9e-11
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 9e-11
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 1e-10
cd03240204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 1e-10
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 1e-10
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 1e-10
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 1e-10
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 1e-10
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 1e-10
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 2e-10
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding subu 2e-10
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transport AT 2e-10
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 6e-10
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 7e-10
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 8e-10
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 9e-10
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 9e-10
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 9e-10
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 1e-09
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 1e-09
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 2e-09
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 2e-09
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 2e-09
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 3e-09
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 3e-09
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 4e-09
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 4e-09
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 5e-09
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 6e-09
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 6e-09
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 6e-09
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 9e-09
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 1e-08
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 1e-08
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 1e-08
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 1e-08
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 1e-08
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 2e-08
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 2e-08
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family member; Pr 2e-08
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 2e-08
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 2e-08
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC transp 2e-08
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 3e-08
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 3e-08
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 3e-08
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 4e-08
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 6e-08
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 7e-08
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 9e-08
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 1e-07
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 1e-07
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 1e-07
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 1e-07
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 1e-07
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 2e-07
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 3e-07
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 4e-07
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 4e-07
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 6e-07
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 7e-07
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 9e-07
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 9e-07
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 9e-07
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 9e-07
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 1e-06
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 1e-06
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 1e-06
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 1e-06
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 1e-06
smart00382148 smart00382, AAA, ATPases associated with a variety of c 1e-06
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 2e-06
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 2e-06
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 2e-06
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 3e-06
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 4e-06
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding prote 4e-06
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 5e-06
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 5e-06
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protein Ccm 6e-06
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 1e-05
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 1e-05
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 1e-05
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 1e-05
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 2e-05
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 2e-05
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 2e-05
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 2e-05
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 2e-05
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 5e-05
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 6e-05
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane comp 6e-05
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 7e-05
cd03279213 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) co 9e-05
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 1e-04
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 1e-04
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 2e-04
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 2e-04
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 3e-04
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 3e-04
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 5e-04
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 0.001
KOG0063 592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 0.002
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 0.002
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 0.002
cd03278197 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction 0.003
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 3e-31
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 5e-30
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 3e-29
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 3e-29
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 6e-27
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 6e-27
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 1e-26
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 4e-25
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 2e-24
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 3e-24
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 1e-23
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 3e-23
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 1e-22
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 2e-22
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 6e-22
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 9e-22
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 2e-21
COG3839338 COG3839, MalK, ABC-type sugar transport systems, ATPase 4e-21
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 1e-20
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 1e-20
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 1e-20
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 3e-20
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 3e-20
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 4e-20
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 8e-20
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 1e-19
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 1e-19
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 2e-19
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 4e-19
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 4e-19
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 4e-19
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 7e-19
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 8e-19
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 2e-18
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 2e-18
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 3e-18
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 4e-18
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 6e-18
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 1e-17
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 2e-17
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 6e-17
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 9e-17
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 1e-16
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 2e-16
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 2e-16
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 2e-16
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 2e-16
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 3e-16
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 4e-16
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 1e-15
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 1e-15
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 2e-15
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 3e-15
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 4e-15
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 6e-15
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 1e-14
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 2e-14
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 2e-14
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding subu 3e-14
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 4e-14
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 5e-14
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 5e-14
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 6e-14
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 7e-14
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 8e-14
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 1e-13
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 1e-13
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 1e-13
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 2e-13
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 3e-13
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 3e-13
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 4e-13
COG4148352 COG4148, ModC, ABC-type molybdate transport system, ATP 5e-13
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 1e-12
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 1e-12
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 1e-12
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 2e-12
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 2e-12
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 2e-12
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 5e-12
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 6e-12
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 1e-11
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 1e-11
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 2e-11
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 2e-11
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 2e-11
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 4e-11
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 6e-11
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 7e-11
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 1e-10
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 1e-10
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 2e-10
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 3e-10
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 4e-10
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 4e-10
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 6e-10
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 8e-10
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 2e-09
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 2e-09
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 3e-09
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 4e-09
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 5e-09
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 7e-09
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 9e-09
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 1e-08
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 1e-08
PLN031301622 PLN03130, PLN03130, ABC transporter C family member; Pr 2e-08
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 4e-08
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 6e-08
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 7e-08
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 7e-08
cd03240204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 2e-07
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 2e-07
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 3e-07
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 4e-07
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 6e-07
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 8e-07
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 1e-06
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 1e-06
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 2e-06
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 6e-06
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide transport 7e-06
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 7e-06
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 8e-06
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 7e-04
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 5e-30
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 1e-27
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 1e-28
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 2e-27
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 6e-26
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 2e-25
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine transport 8e-25
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 1e-24
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 1e-24
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 1e-22
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 2e-22
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 5e-22
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 2e-21
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 2e-21
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 6e-20
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 7e-20
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 7e-19
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 1e-18
KOG0061613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 2e-18
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 7e-18
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 1e-17
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 2e-17
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 2e-17
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 2e-17
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 2e-17
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 4e-17
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 6e-17
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 7e-17
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 9e-17
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 1e-16
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 1e-16
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 2e-16
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 3e-16
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 3e-16
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 4e-16
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 6e-16
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 7e-16
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 7e-16
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 1e-15
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 2e-15
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 2e-15
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 3e-15
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 3e-15
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 2e-14
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 2e-14
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transporter A 2e-14
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 3e-14
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 4e-14
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 5e-14
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 5e-14
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 6e-14
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 8e-14
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 1e-13
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 1e-13
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 1e-13
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 1e-13
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 1e-13
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 1e-13
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 2e-13
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 2e-13
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 3e-13
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 3e-13
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 4e-13
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 5e-13
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 5e-13
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 6e-13
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 6e-13
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 6e-13
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 7e-13
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 9e-13
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 1e-12
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 2e-12
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 3e-12
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 4e-12
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 6e-12
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 6e-12
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 6e-12
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 1e-11
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 1e-11
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 1e-11
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 2e-11
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 2e-11
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 2e-11
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 2e-11
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 2e-11
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 3e-11
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 4e-11
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 8e-11
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 1e-10
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transporter 1e-10
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 1e-10
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 1e-10
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 1e-10
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 2e-10
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-binding s 2e-10
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 2e-10
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 2e-10
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 2e-10
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 3e-10
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 5e-10
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 5e-10
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 5e-10
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 5e-10
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 6e-10
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 6e-10
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 6e-10
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 7e-10
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 7e-10
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 7e-10
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 1e-09
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 1e-09
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 2e-09
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 2e-09
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 2e-09
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protein Ccm 3e-09
KOG00651391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 5e-09
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 5e-09
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 6e-09
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 7e-09
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 8e-09
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 8e-09
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 8e-09
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 1e-08
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 1e-08
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 1e-08
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 1e-08
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 1e-08
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 1e-08
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 2e-08
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 2e-08
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 2e-08
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 2e-08
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 3e-08
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 3e-08
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 3e-08
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 3e-08
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 5e-08
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 5e-08
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 5e-08
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 5e-08
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 6e-08
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 7e-08
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family member; Pr 7e-08
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisional 7e-08
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 8e-08
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC transp 1e-07
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 1e-07
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 2e-07
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 2e-07
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 2e-07
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 2e-07
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 2e-07
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 2e-07
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase component; 2e-07
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 2e-07
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transport AT 3e-07
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 3e-07
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 4e-07
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 4e-07
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP-bindi 4e-07
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 5e-07
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 6e-07
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 1e-06
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 1e-06
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 1e-06
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 2e-06
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 2e-06
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 3e-06
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 3e-06
PRK10938490 PRK10938, PRK10938, putative molybdenum transport ATP-b 4e-06
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 4e-06
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine transpo 5e-06
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 5e-06
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 7e-06
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 7e-06
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 9e-06
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 2e-05
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 2e-05
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 2e-05
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding subun 2e-05
PLN031401470 PLN03140, PLN03140, ABC transporter G family member; Pr 5e-05
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 6e-05
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 9e-05
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 2e-04
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 6e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 9e-04
PRK10070400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 0.001
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter ATP-bi 0.001
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 0.002
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC transport 0.002
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 4e-28
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 1e-18
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 1e-14
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 4e-13
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 3e-12
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 1e-11
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 2e-11
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding prote 6e-10
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 1e-09
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 1e-07
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 2e-07
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 4e-07
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-binding co 1e-06
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 2e-06
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 4e-06
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 5e-06
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 1e-05
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 2e-05
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 3e-05
PRK01156895 PRK01156, PRK01156, chromosome segregation protein; Pro 3e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein; Pro 7e-05
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 1e-04
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 3e-04
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 7e-04
smart00382148 smart00382, AAA, ATPases associated with a variety of c 8e-04
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding subun 0.003
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding protein 0.004
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase component; R 7e-28
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 6e-25
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 6e-25
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 4e-20
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 8e-19
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 1e-26
KOG0066 807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 3e-14
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 4e-20
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 1e-19
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 2e-19
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 4e-19
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 4e-19
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 9e-19
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 2e-18
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 1e-15
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 1e-15
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 2e-15
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 4e-15
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 4e-15
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 5e-15
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 8e-15
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transporter A 8e-15
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 1e-13
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 5e-13
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-binding s 2e-12
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 8e-12
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 8e-12
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 1e-11
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 1e-11
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 1e-11
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 2e-11
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 6e-11
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 1e-10
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 1e-09
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 7e-09
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 2e-07
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 3e-07
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 6e-07
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 9e-07
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 1e-06
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 2e-06
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 2e-06
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 3e-06
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 4e-06
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 2e-05
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 4e-05
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 2e-04
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 6e-04
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 7e-18
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 4e-17
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 2e-16
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 4e-16
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 2e-14
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 2e-12
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 9e-06
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 4e-17
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 1e-16
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 2e-09
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 7e-09
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 2e-08
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 2e-06
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP-bindi 4e-06
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 1e-05
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC system AT 3e-05
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 8e-05
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding subun 9e-05
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 2e-04
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding protein 3e-04
PRK13546264 PRK13546, PRK13546, teichoic acids export protein ATP-b 5e-04
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 0.003
pfam00005119 pfam00005, ABC_tran, ABC transporter 6e-16
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 2e-15
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 1e-10
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 3e-15
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 2e-14
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 1e-11
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 6e-11
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 1e-10
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 6e-10
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 9e-10
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 2e-09
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 9e-07
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 4e-06
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 2e-05
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 4e-04
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 0.001
PRK10938490 PRK10938, PRK10938, putative molybdenum transport ATP-b 6e-15
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 3e-08
pfam00005119 pfam00005, ABC_tran, ABC transporter 4e-14
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transporter 1e-11
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 2e-10
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 6e-09
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 1e-06
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 2e-06
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 4e-06
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 1e-04
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 2e-08
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 1e-06
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 1e-06
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 2e-05
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 6e-05
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 8e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 2e-04
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 4e-04
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 0.001
KOG09621294 KOG0962, KOG0962, KOG0962, DNA repair protein RAD50, AB 0.003
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 0.004
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 0.004
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 4e-06
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 1e-05
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 7e-05
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 5e-04
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 2e-05
COG0178 935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 3e-04
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 0.003
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 4e-05
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 1e-04
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 2e-04
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 3e-04
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; Valid 0.003
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 0.002
>gnl|CDD|183324 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|182996 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|36145 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information