254780276

254780276

dihydrodipicolinate synthase

GeneID in NCBI database:8209258Locus tag:CLIBASIA_00805
Protein GI in NCBI database:254780276Protein Accession:YP_003064689.1
Gene range:-(160523, 161401)Protein Length:292aa
Gene description:dihydrodipicolinate synthase
COG prediction:[E] [M] Dihydrodipicolinate synthase/N-acetylneuraminate lyase
KEGG prediction:dihydrodipicolinate synthase (EC:4.2.1.52); K01714 dihydrodipicolinate synthase [EC:4.2.1.52]
SEED prediction:Dihydrodipicolinate synthase (EC 4.2.1.52)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Subsystem involved in SEED:Lysine Biosynthesis DAP Pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTTGESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALERLG
ccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHccHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcc
cccEEEEEccccEcccccEcHHHHHHHHHHHHHHcccEEEEccHHHcHHHccHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHHHHcccccEEEEEcHHHHcccccHHHHHHHccccccEEEEEEccccccHHHHHHcccccccEEEEccHHHHHHHHHccccEEEEcHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcc
mfrgsipalitpftkgnlidedAFVEHIEWQitegsgglvpagttgesstlsheEHCRIIELCVKTVASrvpvmagigsnntrESVELAQYAHSIGADALLVVIpyynkpnrrgllahfgeiattvsspiyiynnpsrtviEMDVDTMAELAAtypnivgvkdatgkIELVSEQRLscgfdfiqlsgedssalgfnahggvgcisVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLgrnvslavrspmvstleKDTMIAIDQALERLG
mfrgsipalitpftkgnLIDEDAFVEHIEWQItegsgglvpAGTTGESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIattvsspiyiynNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLgrnvslavrspmvstlekdtMIAIDQALERLG
MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTTGESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALERLG
MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTTGESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALERL*
MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPA************EHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALERLG
MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTTGESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALE***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTTGESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALERLG
MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTTGESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALERLG
MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTTGESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALERLG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target292 dihydrodipicolinate synthase [Candidatus Liberibacter a
315122835296 dihydrodipicolinate synthase [Candidatus Liberibacter s 1 1e-141
241203880294 dihydrodipicolinate synthase [Rhizobium leguminosarum b 1 1e-114
116251268294 dihydrodipicolinate synthase [Rhizobium leguminosarum b 1 1e-114
209548592294 dihydrodipicolinate synthase [Rhizobium leguminosarum b 1 1e-114
86357019294 dihydrodipicolinate synthase [Rhizobium etli CFN 42] Le 1 1e-114
190891064294 dihydrodipicolinate synthase [Rhizobium etli CIAT 652] 1 1e-114
327191315294 dihydrodipicolinate synthase protein [Rhizobium etli CN 1 1e-113
15964812294 dihydrodipicolinate synthase [Sinorhizobium meliloti 10 1 1e-113
227821394399 dihydrodipicolinate synthase [Sinorhizobium fredii NGR2 1 1e-112
150395897294 dihydrodipicolinate synthase [Sinorhizobium medicae WSM 1 1e-112
>gi|315122835|ref|YP_004063324.1| dihydrodipicolinate synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 296 Back     alignment and organism information
 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 237/292 (81%), Positives = 264/292 (90%)

Query: 1   MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTTGESSTLSHEEHCRII 60
           MF+GSIPALITPFTK NLIDED+FV+HIEWQI+EGS GLVPAGTTGESSTLS+EEHCR++
Sbjct: 1   MFQGSIPALITPFTKDNLIDEDSFVDHIEWQISEGSSGLVPAGTTGESSTLSYEEHCRVV 60

Query: 61  ELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPNRRGLLAHFG 120
           ELCVKT A RVPVMAG GSNNT+ES+ELAQYA + GADALLVV+PYYNKPN++GLLAHFG
Sbjct: 61  ELCVKTAAGRVPVMAGAGSNNTKESIELAQYAQNTGADALLVVVPYYNKPNKKGLLAHFG 120

Query: 121 EIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKDATGKIELVSEQRLSCGF 180
            IA  VS PIYIYNNPSRTVIEMDVDTMAEL  TY NIVGVKDATG+IEL S QR++CG 
Sbjct: 121 SIANAVSLPIYIYNNPSRTVIEMDVDTMAELVKTYSNIVGVKDATGRIELASGQRIACGP 180

Query: 181 DFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAMIRGDYRQALLYQDKLMPL 240
           DFIQLSG+DSSALGFNAHGGVGCISVTANV PRICAEFQ+A+  G+YRQAL YQDKL PL
Sbjct: 181 DFIQLSGDDSSALGFNAHGGVGCISVTANVAPRICAEFQKAISEGNYRQALEYQDKLFPL 240

Query: 241 HQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTMIAIDQALERLG 292
           HQALF+EP++  VKYALSRLGRNVSL VR+PMVS LEK+TM AIDQAL+ +G
Sbjct: 241 HQALFIEPSISSVKYALSRLGRNVSLLVRAPMVSILEKETMFAIDQALDHIG 292


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203880|ref|YP_002974976.1| dihydrodipicolinate synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 294 Back     alignment and organism information
>gi|116251268|ref|YP_767106.1| dihydrodipicolinate synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 294 Back     alignment and organism information
>gi|209548592|ref|YP_002280509.1| dihydrodipicolinate synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 294 Back     alignment and organism information
>gi|86357019|ref|YP_468911.1| dihydrodipicolinate synthase [Rhizobium etli CFN 42] Length = 294 Back     alignment and organism information
>gi|190891064|ref|YP_001977606.1| dihydrodipicolinate synthase [Rhizobium etli CIAT 652] Length = 294 Back     alignment and organism information
>gi|327191315|gb|EGE58348.1| dihydrodipicolinate synthase protein [Rhizobium etli CNPAF512] Length = 294 Back     alignment and organism information
>gi|15964812|ref|NP_385165.1| dihydrodipicolinate synthase [Sinorhizobium meliloti 1021] Length = 294 Back     alignment and organism information
>gi|227821394|ref|YP_002825364.1| dihydrodipicolinate synthase [Sinorhizobium fredii NGR234] Length = 399 Back     alignment and organism information
>gi|150395897|ref|YP_001326364.1| dihydrodipicolinate synthase [Sinorhizobium medicae WSM419] Length = 294 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target292 dihydrodipicolinate synthase [Candidatus Liberibacter a
PRK03170292 PRK03170, PRK03170, dihydrodipicolinate synthase; Provi 1e-115
COG0329299 COG0329, DapA, Dihydrodipicolinate synthase/N-acetylneu 8e-87
pfam00701289 pfam00701, DHDPS, Dihydrodipicolinate synthetase family 3e-81
cd00408281 cd00408, DHDPS-like, Dihydrodipicolinate synthase famil 9e-79
TIGR00674285 TIGR00674, dapA, dihydrodipicolinate synthase 5e-78
TIGR02313294 TIGR02313, HpaI-NOT-DapA, 2,4-dihydroxyhept-2-ene-1,7-d 7e-59
PLN02417280 PLN02417, PLN02417, dihydrodipicolinate synthase 2e-49
cd00954288 cd00954, NAL, N-Acetylneuraminic acid aldolase, also ca 1e-37
PRK03620303 PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate dehydrat 3e-37
cd00951289 cd00951, KDGDH, 5-dehydro-4-deoxyglucarate dehydratase, 2e-36
TIGR03249296 TIGR03249, KdgD, 5-dehydro-4-deoxyglucarate dehydratase 5e-33
TIGR00683290 TIGR00683, nanA, N-acetylneuraminate lyase 2e-21
cd00950284 cd00950, DHDPS, Dihydrodipicolinate synthase (DHDPS) is 4e-94
PRK04147293 PRK04147, PRK04147, N-acetylneuraminate lyase; Provisio 4e-28
cd00953279 cd00953, KDG_aldolase, KDG (2-keto-3-deoxygluconate) al 2e-21
cd00952309 cd00952, CHBPH_aldolase, Trans-o-hydroxybenzylidenepyru 2e-20
>gnl|CDD|179547 PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|30677 COG0329, DapA, Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144341 pfam00701, DHDPS, Dihydrodipicolinate synthetase family Back     alignment and domain information
>gnl|CDD|29936 cd00408, DHDPS-like, Dihydrodipicolinate synthase family Back     alignment and domain information
>gnl|CDD|129757 TIGR00674, dapA, dihydrodipicolinate synthase Back     alignment and domain information
>gnl|CDD|131366 TIGR02313, HpaI-NOT-DapA, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>gnl|CDD|178038 PLN02417, PLN02417, dihydrodipicolinate synthase Back     alignment and domain information
>gnl|CDD|29947 cd00954, NAL, N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>gnl|CDD|179610 PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|29944 cd00951, KDGDH, 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>gnl|CDD|132293 TIGR03249, KdgD, 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>gnl|CDD|129766 TIGR00683, nanA, N-acetylneuraminate lyase Back     alignment and domain information
>gnl|CDD|29943 cd00950, DHDPS, Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>gnl|CDD|179749 PRK04147, PRK04147, N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>gnl|CDD|29946 cd00953, KDG_aldolase, KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>gnl|CDD|29945 cd00952, CHBPH_aldolase, Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 292 dihydrodipicolinate synthase [Candidatus Liberibacter a
TIGR00674288 dapA dihydrodipicolinate synthase; InterPro: IPR005263 100.0
PRK03170292 dihydrodipicolinate synthase; Provisional 100.0
pfam00701289 DHDPS Dihydrodipicolinate synthetase family. This famil 100.0
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enz 100.0
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuraminate l 100.0
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called N-ace 100.0
PRK04147294 N-acetylneuraminate lyase; Provisional 100.0
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A membe 100.0
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro- 100.0
PRK03620296 5-dehydro-4-deoxyglucarate dehydratase; Provisional 100.0
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydra 100.0
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid al 100.0
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also call 100.0
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases fo 100.0
TIGR00683294 nanA N-acetylneuraminate lyase; InterPro: IPR005264 N-a 100.0
PRK09490 1229 metH B12-dependent methionine synthase; Provisional 97.79
TIGR02082 1265 metH methionine synthase; InterPro: IPR011822 Vitamin B 96.47
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 96.25
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 96.03
TIGR00737336 nifR3_yhdG putative TIM-barrel protein, nifR3 family; I 95.89
cd00945201 Aldolase_Class_I Class I aldolases. The class I aldolas 98.53
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases 97.24
PRK07226266 fructose-bisphosphate aldolase; Provisional 96.99
pfam01791231 DeoC DeoC/LacD family aldolase. This family includes di 96.72
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and r 96.6
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 96.01
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FM 95.82
PRK13127262 consensus 95.55
PRK13140257 consensus 95.51
PRK13111256 trpA tryptophan synthase subunit alpha; Provisional 94.94
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) a 94.92
pfam00682237 HMGL-like HMGL-like. This family contains a diverse set 94.91
CHL00200263 trpA tryptophan synthase alpha subunit; Provisional 94.89
PRK13132246 consensus 94.84
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 94.38
pfam01070301 FMN_dh FMN-dependent dehydrogenase. 94.22
PRK13120285 consensus 94.05
PRK13129267 consensus 93.82
PRK08195337 4-hydroxy-2-ketovalerate aldolase; Validated 93.6
PRK13123256 consensus 93.5
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 93.31
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; Revie 93.3
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding domain of 93.22
PRK13137266 consensus 93.18
CHL00162267 thiG thiamin biosynthesis protein G; Validated 93.15
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 93.1
PRK11197381 lldD L-lactate dehydrogenase; Provisional 93.01
PRK07709285 fructose-bisphosphate aldolase; Provisional 92.96
PRK00208256 thiG thiazole synthase; Reviewed 92.91
PRK13138264 consensus 92.89
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Membe 92.85
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldola 92.83
PRK06801286 hypothetical protein; Provisional 92.77
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 92.68
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 92.64
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synthase) 92.62
PRK06852303 aldolase; Validated 92.54
pfam01116283 F_bP_aldolase Fructose-bisphosphate aldolase class-II. 92.52
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a transcr 92.16
PRK13113263 consensus 91.52
PRK13133267 consensus 91.51
cd02812219 PcrB_like PcrB_like proteins. One member of this family 91.34
PRK13114266 consensus 91.14
pfam03437254 BtpA BtpA family. The BtpA protein is tightly associate 91.12
PRK00043210 thiE thiamine-phosphate pyrophosphorylase; Reviewed 91.07
pfam01884231 PcrB PcrB family. This family contains proteins that ar 90.99
PRK13134257 consensus 90.98
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 90.91
PRK08185283 hypothetical protein; Provisional 90.72
PRK13117268 consensus 90.34
pfam06187382 DUF993 Protein of unknown function (DUF993). This famil 98.44
PRK06857209 consensus 96.78
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.69
PRK08782219 consensus 96.58
PRK07114223 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 95.22
PRK13135267 consensus 94.13
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohy 93.46
PRK13125247 trpA tryptophan synthase subunit alpha; Provisional 92.83
PRK13118269 consensus 91.27
PRK13119261 consensus 90.7
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze 97.52
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 97.44
PRK09549411 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; 96.52
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D 96.1
PRK05437351 isopentenyl pyrophosphate isomerase; Provisional 96.1
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 96.1
TIGR03332407 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate 95.98
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, type III 95.83
TIGR02320272 PEP_mutase phosphoenolpyruvate phosphomutase; InterPro: 95.63
pfam00016309 RuBisCO_large Ribulose bisphosphate carboxylase large c 95.55
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding domai 95.51
PRK04208467 rbcL ribulose bisophosphate carboxylase; Reviewed 95.33
pfam10566643 Glyco_hydro_97 Glycoside hydrolase 97. This is the 97th 94.97
PRK09485308 mmuM homocysteine methyltransferase; Provisional 94.66
PRK09389 487 (R)-citramalate synthase; Provisional 94.38
CHL00040477 rbcL ribulose-1,5-bisphosphate carboxylase/oxygenase la 94.2
COG2159293 Predicted metal-dependent hydrolase of the TIM-barrel f 93.97
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy produ 93.74
TIGR02090371 LEU1_arch isopropylmalate/citramalate/homocitrate synth 92.59
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain of t 92.38
cd06275269 PBP1_PurR Ligand-binding domain of purine repressor, Pu 92.27
PRK04452322 acetyl-CoA decarbonylase/synthase complex subunit delta 92.25
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 92.21
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharacteriz 91.39
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosp 91.08
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide transport 90.23
PRK08645 608 bifunctional homocysteine S-methyltransferase/5,10-meth 96.62
TIGR02151349 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, typ 95.72
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding doma 96.59
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain 94.8
COG3142241 CutC Uncharacterized protein involved in copper resista 94.55
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 94.29
pfam01791231 DeoC DeoC/LacD family aldolase. This family includes di 94.27
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D 94.25
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot 93.59
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. 93.31
pfam03932202 CutC CutC family. Copper transport in Escherichia coli 92.54
pfam01702238 TGT Queuine tRNA-ribosyltransferase. This is a family o 92.37
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Membe 92.16
PRK00115347 hemE uroporphyrinogen decarboxylase; Validated 92.06
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 91.45
PRK01008372 queuine tRNA-ribosyltransferase; Provisional 91.44
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PB 90.07
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carbohydr 96.55
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN bi 96.24
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 95.61
PRK13523337 NADPH dehydrogenase NamA; Provisional 94.89
pfam02581180 TMP-TENI Thiamine monophosphate synthase/TENI. Thiamine 93.81
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind 93.77
PRK06806281 fructose-bisphosphate aldolase; Provisional 93.44
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 93.03
PRK12857284 putative aldolase; Reviewed 92.78
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind 92.21
PRK08610286 fructose-bisphosphate aldolase; Reviewed 92.16
pfam03060330 NPD 2-nitropropane dioxygenase. Members of this family 91.99
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 96.46
PRK13127262 consensus 95.45
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot 95.39
PRK08318413 dihydropyrimidine dehydrogenase; Validated 94.62
pfam01208337 URO-D Uroporphyrinogen decarboxylase (URO-D). 94.14
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 93.99
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 92.83
CHL00200263 trpA tryptophan synthase alpha subunit; Provisional 92.67
PRK13129267 consensus 92.42
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chor 91.97
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-bin 91.96
pfam01180290 DHO_dh Dihydroorotate dehydrogenase. 90.82
PRK08104212 consensus 96.32
pfam01081196 Aldolase KDPG and KHG aldolase. This family includes th 96.23
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.07
PRK06552209 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 95.95
PRK08904207 consensus 95.9
TIGR01182205 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydrox 95.52
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 95.16
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family belong 94.71
PRK13122242 consensus 93.17
PRK13115269 consensus 90.84
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.13
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosomal st 95.63
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 91.72
TIGR01769212 GGGP geranylgeranylglyceryl phosphate synthase; InterPr 91.67
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN bind 96.03
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN bind 95.67
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding d 95.32
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-bindin 94.23
PRK08999312 hypothetical protein; Provisional 93.59
PRK08318 413 dihydropyrimidine dehydrogenase; Validated 92.98
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 92.96
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN bind 90.99
PRK10653295 D-ribose transporter subunit RbsB; Provisional 90.34
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-bindin 90.2
PRK09701311 D-allose transporter subunit; Provisional 90.02
PRK05286336 dihydroorotate dehydrogenase 2; Reviewed 94.49
TIGR01037308 pyrD_sub1_fam dihydroorotate dehydrogenase family prote 94.23
cd03465330 URO-D_like The URO-D _like protein superfamily includes 94.0
cd03307326 Mta_CmuA_like MtaA_CmuA_like family. MtaA/CmuA, also Mt 93.73
PRK06252339 methylcobalamin:coenzyme M methyltransferase; Validated 93.55
PRK13135267 consensus 93.98
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 93.72
PRK13111256 trpA tryptophan synthase subunit alpha; Provisional 92.93
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) a 92.63
TIGR01361262 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldo 90.87
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthesis [N 90.63
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of the e 90.03
cd03465330 URO-D_like The URO-D _like protein superfamily includes 93.33
PRK06252339 methylcobalamin:coenzyme M methyltransferase; Validated 93.16
PRK08195337 4-hydroxy-2-ketovalerate aldolase; Validated 92.64
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) reduc 91.19
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom 93.06
PRK00112366 tgt queuine tRNA-ribosyltransferase; Provisional 92.16
>TIGR00674 dapA dihydrodipicolinate synthase; InterPro: IPR005263 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>pfam00701 DHDPS Dihydrodipicolinate synthetase family Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; InterPro: IPR012691 This entry represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase; InterPro: IPR005264 N-acetylneuraminate lyase catalyzes the cleavage of N-acetylneuraminic acid (sialic acid) to form pyruvate and N-acetyl-D-mannosamine Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>TIGR02082 metH methionine synthase; InterPro: IPR011822 Vitamin B12 dependent methionine synthase 2 Back     alignment and domain information
>pfam01207 Dus Dihydrouridine synthase (Dus) Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family; InterPro: IPR004652 This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) and includes NifR3 itself, from Rhodobacter capsulatus Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>pfam01791 DeoC DeoC/LacD family aldolase Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK13127 consensus Back     alignment and domain information
>PRK13140 consensus Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>pfam00682 HMGL-like HMGL-like Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK13132 consensus Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>pfam01070 FMN_dh FMN-dependent dehydrogenase Back     alignment and domain information
>PRK13120 consensus Back     alignment and domain information
>PRK13129 consensus Back     alignment and domain information
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated Back     alignment and domain information
>PRK13123 consensus Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>PRK13137 consensus Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK13138 consensus Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>pfam05690 ThiG Thiazole biosynthesis protein ThiG Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>pfam01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>PRK13113 consensus Back     alignment and domain information
>PRK13133 consensus Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK13114 consensus Back     alignment and domain information
>pfam03437 BtpA BtpA family Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>pfam01884 PcrB PcrB family Back     alignment and domain information
>PRK13134 consensus Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK13117 consensus Back     alignment and domain information
>pfam06187 DUF993 Protein of unknown function (DUF993) Back     alignment and domain information
>PRK06857 consensus Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08782 consensus Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13135 consensus Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13118 consensus Back     alignment and domain information
>PRK13119 consensus Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK09549 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>pfam01207 Dus Dihydrouridine synthase (Dus) Back     alignment and domain information
>TIGR03332 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase; InterPro: IPR012698 Phosphonates are a class of organophosphorus compounds, characterised by a stable C-P bond, which are found in a variety of biologically produced molecules including antiobiotics, lipids, proteins and polysaccharides Back     alignment and domain information
>pfam00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>PRK04208 rbcL ribulose bisophosphate carboxylase; Reviewed Back     alignment and domain information
>pfam10566 Glyco_hydro_97 Glycoside hydrolase 97 Back     alignment and domain information
>PRK09485 mmuM homocysteine methyltransferase; Provisional Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>CHL00040 rbcL ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases; InterPro: IPR011830 Methanogenic archaea contain three closely related homologs of the 2-isopropylmalate synthases (LeuA) represented by IPR005671 from INTERPRO Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2; InterPro: IPR011179 This group represents the bacterial and archaeal isopentenyl-diphosphate delta-isomerase (IPP isomerase) Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>pfam01791 DeoC DeoC/LacD family aldolase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>pfam03932 CutC CutC family Back     alignment and domain information
>pfam01702 TGT Queuine tRNA-ribosyltransferase Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK00115 hemE uroporphyrinogen decarboxylase; Validated Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK01008 queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>pfam02581 TMP-TENI Thiamine monophosphate synthase/TENI Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12857 putative aldolase; Reviewed Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>pfam03060 NPD 2-nitropropane dioxygenase Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK13127 consensus Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>pfam01208 URO-D Uroporphyrinogen decarboxylase (URO-D) Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK13129 consensus Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>pfam01180 DHO_dh Dihydroorotate dehydrogenase Back     alignment and domain information
>PRK08104 consensus Back     alignment and domain information
>pfam01081 Aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08904 consensus Back     alignment and domain information
>TIGR01182 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK13122 consensus Back     alignment and domain information
>PRK13115 consensus Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase; InterPro: IPR010946 This entry represents geranylgeranylglyceryl phosphate synthase which catalyses the first committed step in the synthesis of ether-linked membrane lipids in archaea Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase family protein; InterPro: IPR005720 Dihydroorotate dehydrogenase (1 Back     alignment and domain information
>cd03465 URO-D_like The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases Back     alignment and domain information
>cd03307 Mta_CmuA_like MtaA_CmuA_like family Back     alignment and domain information
>PRK06252 methylcobalamin:coenzyme M methyltransferase; Validated Back     alignment and domain information
>PRK13135 consensus Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268 These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase) Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd03465 URO-D_like The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases Back     alignment and domain information
>PRK06252 methylcobalamin:coenzyme M methyltransferase; Validated Back     alignment and domain information
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK00112 tgt queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target292 dihydrodipicolinate synthase [Candidatus Liberibacter a
2yxg_A289 Crystal Structure Of Dihyrodipicolinate Synthase (D 6e-49
3flu_A297 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-46
2ehh_A294 Crystal Structure Of Dihydrodipicolinate Synthase F 4e-46
2vc6_A292