254780277

254780277

DNA polymerase I

GeneID in NCBI database:8209259Locus tag:CLIBASIA_00810
Protein GI in NCBI database:254780277Protein Accession:YP_003064690.1
Gene range:+(161960, 164890)Protein Length:976aa
Gene description:DNA polymerase I
COG prediction:[L] 5'-3' exonuclease (including N-terminal domain of PolI)
KEGG prediction:DNA polymerase I; K02335 DNA polymerase I [EC:2.7.7.7]
SEED prediction:DNA polymerase I (EC 2.7.7.7)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Pyrimidine metabolism [PATH:las00240]
DNA replication [PATH:las03030]
Base excision repair [PATH:las03410]
Nucleotide excision repair [PATH:las03420]
Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA Repair Base Excision;
DNA-replication
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970------
MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIEPVVLDINTTENKGIAIETEIDRDTTIKTSQFSSLSDQTSKINSEQTPQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNWQEEN
cccccEEEEEEccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHccccEEEEcccccHHHHccccEEEEEccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHcccccccccHHHcccccccHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccEEEccHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHccccHHHccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccEEEEcccccccccccccHHHHHHHHEEcccccEEEEEEccHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccEEcccccEEEccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEccHHHcc
ccccccEEEEcccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccEEcccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHccccEEEEcccccccccHHHHHHHHcccHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccHHHHHHcHHHcccccHHHHHHHHHHHccHHHHHEEEcccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcHcHHHccccccccccccccccccHcccccccccHccccccHHHHHHHHHHHHccccccHHHcEEEccHHHHHHHHHHHHHcccEEEEcccccccHHHHHEEEEEEEEcccccEEEEEcccccccccHHccccccHccccHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHcccEEccccHHHHHHHHHHHccccccHHHHHHHHHcccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHcEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccEccccccEcccHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHcEcccccEEccEEEcccccccccEEEcccccccccccHHHHHHHHcEEccccEEEEEEEEccHHHHHHHHHHccHHHHHHHHccccHHHHcHHHHcccccccccccHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcEEEcccccEEEcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEEEEHHHHHHHHHHHHHHHHHcccccccccEcEEEEEcccccHHHcc
mqkenhlflvdgssfIYRAfyatpllsrkhdglpvnaIAGFCNMLWKLLQNSRKESIASHFAVIfdypavtfrneiypdykanrpkipemllpqlplvrlatqafgipaieiqgfeadDIIATYTYIAEKEGFAVTIISTdkdlmqlvspttclydtvkeEKIDIEHVIkkwgippekMVCLQALtgdsidnipgipgiGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTdvpitiplehliledcngpRLISFLKALEFTKLINRVAttydcdaaniepvvldinttenkgiaieteidrdttiktsqfsslsdqtskinseqtPQKLFLERLQKLsqypinndsytkiVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAIStldqkddtsfKVETIFIDLsvhtsqdstgkntLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVldsgrsshdIASIAQKWLSYTRKEILKSrkssipidkisdsqVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDlsgekfnlsspkqlgdilftklkfpsgaktktgqwktTAQDleqincgdnpiiKNILEWRQLSKIKstyadslpnhinkrTQRVHTFYSLASTMtgrlaslepnlqnipiktdlGQKIRrafispptkklisADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGvniekvspqmrrHAKTINFSIIYgispfrlatqlriprsEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYvetifgrrihydeinspkssiRNINeraainapiqgsaaDITRRAMISVHKSLEDHKLATKMLLQIHDELvfevpeeeitTASQIIVHSMEKaclpkinlrvplkvnikvsnnwqeen
MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHvikkwgippeKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILInasrikqkkrrENILEYAetarlsrklvMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIepvvldinttenkgiaieteidrdttiktsqfsslsdqtskinseqtPQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAIstldqkddtSFKVETIFIDlsvhtsqdstgkntLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILksrkssipidkISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKStyadslpnhinkrTQRVHTFYSLASTMTGRlaslepnlqnipiktdlgqKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLpkinlrvplkvnikvsnnwqeen
MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIEPVVLDINTTENKGIAIETEIDRDTTIKTSQFSSLSDQTSKINSEQTPQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILksrkssipidkisdsQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNWQEEN
***ENHL*LVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYD******************************************************************QYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSP*******NERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNWQ*E*
MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIEPVVLDINTTENKGIAIETEIDRDTTIKTSQ***************TPQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSG*********TTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNWQEEN
***ENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIEPVVLDI*T***K**********************************PQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNW****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIEPVVLDINTTENKGIAIETEIDRDTTIKTSQFSSLSDQTSKINSEQTPQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNWQEEN
MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIEPVVLDINTTENKGIAIETEIDRDTTIKTSQFSSLSDQTSKINSEQTPQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNWQEEN
MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNMLWKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINASRIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIEPVVLDINTTENKGIAIETEIDRDTTIKTSQFSSLSDQTSKINSEQTPQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKEILKSRKSSIPIDKISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNWQEEN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target976 DNA polymerase I [Candidatus Liberibacter asiaticus str
254780127675 putative DNA polymerase from bacteriophage origin 7e-07
254781193675 putative DNA polymerase from bacteriophage origin 2e-04
>gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Back     alignment
 Score = 48.1 bits (113), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%)

Query: 733 IRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEK 792
           +R   I+   KKL+ AD + IE R+LA IA      + F N  DI+    A+ F   I+K
Sbjct: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423

Query: 793 VSPQMRRHAKTINFSIIY 810
           VS + R   K +  ++ Y
Sbjct: 424 VSKEQRAIGKVMELALGY 441

>gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Back     alignment
 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%)

Query: 733 IRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEK 792
           +R   I+   KKL+ AD + IE R+LA +A      + FE   D++    A  F V   +
Sbjct: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423

Query: 793 VSPQMRRHAKTINFSIIY 810
           V+   R   K +  ++ Y
Sbjct: 424 VTKDQRAIGKVMELALGY 441

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target976 DNA polymerase I [Candidatus Liberibacter asiaticus str
315122837727 DNA polymerase I [Candidatus Liberibacter solanacearum 1 0.0
159184162998 DNA polymerase I [Agrobacterium tumefaciens str. C58] L 1 0.0
222147240992 DNA polymerase I [Agrobacterium vitis S4] Length = 992 1 0.0
325291553995 DNA polymerase I [Agrobacterium sp. H13-3] Length = 995 1 0.0
254694920978 DNA polymerase I [Brucella abortus bv. 3 str. Tulya] Le 1 0.0
254718343978 DNA polymerase I [Brucella sp. 83/13] Length = 978 1 0.0
306844396978 DNA polymerase I [Brucella sp. BO1] Length = 978 1 0.0
265983303994 DNA polymerase I [Brucella sp. 83/13] Length = 994 1 0.0
1503985701004 DNA polymerase I [Sinorhizobium medicae WSM419] Length 1 0.0
62289104978 DNA polymerase I [Brucella abortus bv. 1 str. 9-941] Le 1 0.0
>gi|315122837|ref|YP_004063326.1| DNA polymerase I [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 727 Back     alignment and organism information
 Score = 1076 bits (2783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/733 (73%), Positives = 613/733 (83%), Gaps = 19/733 (2%)

Query: 249 LRTDVPITIPLEHLILEDCNGPRLISFLKALEFTKLINRVATTYDCDAANIEPVVLDINT 308
           LRTDVPITIPL+HLILEDCNGP+LI+FLKALEFT+L  RVA   +CDA NIE   LD   
Sbjct: 3   LRTDVPITIPLDHLILEDCNGPQLITFLKALEFTRLTKRVAAFCNCDAENIESADLDSK- 61

Query: 309 TENKGIAIETEIDRDTTIKTSQFSSLSDQTSKINSEQTPQKLFLERLQKLSQYPINNDSY 368
                  I+ E  +  + K +Q ++LS+    I S+ +PQ  FLER + L+Q  I N SY
Sbjct: 62  -------IDIETSQPKSPKENQSATLSEN---IISKNSPQHFFLERTKLLTQSQIKNHSY 111

Query: 369 TKIVNTKDIQQWVQKLETIGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIF 428
            +I N KD+++W+Q LE  GSASF IITDT+DAF+SKPI IA S L+Q+D +  K+ETI 
Sbjct: 112 IRIRNIKDLKKWLQILENTGSASFTIITDTVDAFNSKPIGIAFSILNQEDASLLKIETIV 171

Query: 429 IDL-----SVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIGHNIKYDKLVLHRYGISM 483
           IDL     S      S  K+  T+EILSYLKK FENEH LKIGHNIKYDKLVL RYGI +
Sbjct: 172 IDLPLIIDSSLEENMSPEKSISTEEILSYLKKIFENEHLLKIGHNIKYDKLVLQRYGIII 231

Query: 484 RGFEDIMLMSYVLDSGRSSHDIASIAQKWLSY---TRKEILKSRKSSIPIDKISDSQVQE 540
           RGFEDIMLMSYVLDSGR SHDIA+IA+KWL Y   TRKE+LK+ K SI ID+IS+S++QE
Sbjct: 232 RGFEDIMLMSYVLDSGRYSHDIANIAKKWLFYDLITRKEMLKTGKRSISIDQISNSRIQE 291

Query: 541 HAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPMIDVVSQMEITGIQIDQDLLKQVSA 600
           + +E SNVILQLWLLLR KLI EKLLHVYERLDKPMID+V+QME TGIQID+ LL QVS+
Sbjct: 292 YVVEKSNVILQLWLLLRAKLIAEKLLHVYERLDKPMIDIVAQMETTGIQIDRQLLAQVSS 351

Query: 601 EISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFTKLKFPSGAKTKTGQWKTTAQDLEQI 660
           EISK+LL LEE I++L+GEKFN+SSPKQLGDILFTKLKFP G KTK GQWKTTAQDLEQI
Sbjct: 352 EISKDLLCLEEKIHNLAGEKFNISSPKQLGDILFTKLKFPGGTKTKKGQWKTTAQDLEQI 411

Query: 661 NCGDNPIIKNILEWRQLSKIKSTYADSLPNHINKRTQRVHTFYSLASTMTGRLASLEPNL 720
           NC DN +I++ILEWR+ SKIKSTYADSLPNHIN+RTQRVHTFYSLASTMTGRLASLEPNL
Sbjct: 412 NCQDNILIEHILEWRRFSKIKSTYADSLPNHINQRTQRVHTFYSLASTMTGRLASLEPNL 471

Query: 721 QNIPIKTDLGQKIRRAFISPPTKKLISADYSQIELRILAHIAKITPLYQVFENSLDIHRM 780
           QNIP+KT+LG+KIRRAFI+PPTKKLISADYSQIELRILAH+A+I PLYQ F+NSLDIH +
Sbjct: 472 QNIPVKTNLGKKIRRAFIAPPTKKLISADYSQIELRILAHVAQINPLYQAFKNSLDIHTL 531

Query: 781 VAAEIFGVNIEKVSPQMRRHAKTINFSIIYGISPFRLATQLRIPRSEAADYIKRYFHRFP 840
           VA+EIFGV IE+VS  MR+HAKTINFSIIYGISPFRLA QL+I RSEA DYI+RYF RFP
Sbjct: 532 VASEIFGVKIEEVSSHMRQHAKTINFSIIYGISPFRLANQLKIKRSEATDYIQRYFDRFP 591

Query: 841 GIHEYIEKTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNINERAAINAPIQGSAADIT 900
           GIHEYIEKTKNF R+N YVETIFGRRI+YDEINSPK SIRN+NERAAINAPIQGSAADIT
Sbjct: 592 GIHEYIEKTKNFARKNSYVETIFGRRIYYDEINSPKVSIRNLNERAAINAPIQGSAADIT 651

Query: 901 RRAMISVHKSLEDHKLATKMLLQIHDELVFEVPEEEITTASQIIVHSMEKACLPKINLRV 960
           RRAMI VHKS+E HKL+TKMLLQIHDELVFE PEEEI   + II  SME ACLPKINLRV
Sbjct: 652 RRAMILVHKSIECHKLSTKMLLQIHDELVFEAPEEEIEQVTNIITESMENACLPKINLRV 711

Query: 961 PLKVNIKVSNNWQ 973
           PLKV+IKVS+NW+
Sbjct: 712 PLKVDIKVSDNWE 724


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184162|ref|NP_353146.2| DNA polymerase I [Agrobacterium tumefaciens str. C58] Length = 998 Back     alignment and organism information
>gi|222147240|ref|YP_002548197.1| DNA polymerase I [Agrobacterium vitis S4] Length = 992 Back     alignment and organism information
>gi|325291553|ref|YP_004277417.1| DNA polymerase I [Agrobacterium sp. H13-3] Length = 995 Back     alignment and organism information
>gi|254694920|ref|ZP_05156748.1| DNA polymerase I [Brucella abortus bv. 3 str. Tulya] Length = 978 Back     alignment and organism information
>gi|254718343|ref|ZP_05180154.1| DNA polymerase I [Brucella sp. 83/13] Length = 978 Back     alignment and organism information
>gi|306844396|ref|ZP_07476986.1| DNA polymerase I [Brucella sp. BO1] Length = 978 Back     alignment and organism information
>gi|265983303|ref|ZP_06096038.1| DNA polymerase I [Brucella sp. 83/13] Length = 994 Back     alignment and organism information
>gi|150398570|ref|YP_001329037.1| DNA polymerase I [Sinorhizobium medicae WSM419] Length = 1004 Back     alignment and organism information
>gi|62289104|ref|YP_220897.1| DNA polymerase I [Brucella abortus bv. 1 str. 9-941] Length = 978 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target976 DNA polymerase I [Candidatus Liberibacter asiaticus str
PRK05755880 PRK05755, PRK05755, DNA polymerase I; Provisional 0.0
TIGR00593887 TIGR00593, pola, DNA polymerase I 0.0
COG0749593 COG0749, PolA, DNA polymerase I - 3'-5' exonuclease and 1e-171
pfam00476383 pfam00476, DNA_pol_A, DNA polymerase family A 1e-110
cd08637377 cd08637, DNA_pol_A_pol_I_C, Polymerase I functions prim 1e-172
cd08638373 cd08638, DNA_pol_A_theta, DNA polymerase theta is a low 6e-90
cd06444347 cd06444, DNA_pol_A, Family A polymerase primarily fills 3e-70
cd08640371 cd08640, DNA_pol_A_plastid_like, DNA polymerase A type 2e-68
cd08639324 cd08639, DNA_pol_A_Aquificae_like, Phylum Aquificae Pol 1e-62
cd08643429 cd08643, DNA_pol_A_pol_I_B, Polymerase I functions prim 5e-22
smart00475259 smart00475, 53EXOc, 5'-3' exonuclease 4e-86
cd00008240 cd00008, 53EXOc, 5'-3' exonuclease; T5 type 5'-3' exonu 6e-75
COG0258310 COG0258, Exo, 5'-3' exonuclease (including N-terminal d 3e-64
PRK14976281 PRK14976, PRK14976, 5'-3' exonuclease; Provisional 4e-58
PRK09482256 PRK09482, PRK09482, flap endonuclease-like protein; Pro 2e-48
smart00482206 smart00482, POLAc, DNA polymerase A domain 8e-80
PRK14975553 PRK14975, PRK14975, bifunctional 3'-5' exonuclease/DNA 2e-73
pfam02739169 pfam02739, 5_3_exonuc_N, 5'-3' exonuclease, N-terminal 3e-50
cd06139193 cd06139, DNA_polA_I_Ecoli_like_exo, DEDDy 3'-5' exonucl 2e-27
smart00474172 smart00474, 35EXOc, 3'-5' exonuclease 2e-15
cd00007155 cd00007, 35EXOc, 3'-5' exonuclease 3e-15
pfam01367100 pfam01367, 5_3_exonuc, 5'-3' exonuclease, C-terminal SA 4e-24
cd0008075 cd00080, HhH2_motif, Helix-hairpin-helix class 2 (Pol1 8e-15
TIGR03674338 TIGR03674, fen_arch, flap structure-specific endonuclea 5e-06
PRK03980292 PRK03980, PRK03980, flap endonuclease-1; Provisional 1e-05
cd06140178 cd06140, DNA_polA_I_Bacillus_like_exo, inactive DEDDy 3 8e-20
pfam01612172 pfam01612, 3_5_exonuc, 3'-5' exonuclease 2e-11
cd06128151 cd06128, DNA_polA_exo, DEDDy 3'-5' exonuclease domain o 8e-11
cd09018150 cd09018, DEDDy_polA_RNaseD_like_exo, DEDDy 3'-5' exonuc 4e-09
cd08642378 cd08642, DNA_pol_A_pol_I_A, Polymerase I functions prim 4e-10
cd00128316 cd00128, XPG, Xeroderma pigmentosum G N- and I-regions 1e-06
KOG2519449 KOG2519, KOG2519, KOG2519, 5'-3' exonuclease [Replicati 2e-04
PHA00439286 PHA00439, PHA00439, exonuclease 1e-06
smart0027936 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol1 fam 1e-06
PHA02567304 PHA02567, rnh, RnaseH; Provisional 1e-04
>gnl|CDD|180237 PRK05755, PRK05755, DNA polymerase I; Provisional Back     alignment and domain information
>gnl|CDD|161944 TIGR00593, pola, DNA polymerase I Back     alignment and domain information
>gnl|CDD|31092 COG0749, PolA, DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144170 pfam00476, DNA_pol_A, DNA polymerase family A Back     alignment and domain information
>gnl|CDD|176474 cd08637, DNA_pol_A_pol_I_C, Polymerase I functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication Back     alignment and domain information
>gnl|CDD|176475 cd08638, DNA_pol_A_theta, DNA polymerase theta is a low-fidelity family A enzyme implicated in translesion synthesis and in somatic hypermutation Back     alignment and domain information
>gnl|CDD|176473 cd06444, DNA_pol_A, Family A polymerase primarily fills DNA gaps that arise during DNA repair, recombination and replication Back     alignment and domain information
>gnl|CDD|176477 cd08640, DNA_pol_A_plastid_like, DNA polymerase A type from plastids of higher plants possibly involve in DNA replication or in the repair of errors occurring during replication Back     alignment and domain information
>gnl|CDD|176476 cd08639, DNA_pol_A_Aquificae_like, Phylum Aquificae Pol A is different from Escherichia coli Pol A by three signature sequences Back     alignment and domain information
>gnl|CDD|176480 cd08643, DNA_pol_A_pol_I_B, Polymerase I functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication Back     alignment and domain information
>gnl|CDD|128751 smart00475, 53EXOc, 5'-3' exonuclease Back     alignment and domain information
>gnl|CDD|28892 cd00008, 53EXOc, 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes Back     alignment and domain information
>gnl|CDD|30607 COG0258, Exo, 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|184939 PRK14976, PRK14976, 5'-3' exonuclease; Provisional Back     alignment and domain information
>gnl|CDD|181896 PRK09482, PRK09482, flap endonuclease-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128758 smart00482, POLAc, DNA polymerase A domain Back     alignment and domain information
>gnl|CDD|184938 PRK14975, PRK14975, bifunctional 3'-5' exonuclease/DNA polymerase; Provisional Back     alignment and domain information
>gnl|CDD|145734 pfam02739, 5_3_exonuc_N, 5'-3' exonuclease, N-terminal resolvase-like domain Back     alignment and domain information
>gnl|CDD|176651 cd06139, DNA_polA_I_Ecoli_like_exo, DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases Back     alignment and domain information
>gnl|CDD|128750 smart00474, 35EXOc, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|28891 cd00007, 35EXOc, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|110372 pfam01367, 5_3_exonuc, 5'-3' exonuclease, C-terminal SAM fold Back     alignment and domain information
>gnl|CDD|28961 cd00080, HhH2_motif, Helix-hairpin-helix class 2 (Pol1 family) motif Back     alignment and domain information
>gnl|CDD|163388 TIGR03674, fen_arch, flap structure-specific endonuclease Back     alignment and domain information
>gnl|CDD|179693 PRK03980, PRK03980, flap endonuclease-1; Provisional Back     alignment and domain information
>gnl|CDD|176652 cd06140, DNA_polA_I_Bacillus_like_exo, inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases Back     alignment and domain information
>gnl|CDD|144991 pfam01612, 3_5_exonuc, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|176649 cd06128, DNA_polA_exo, DEDDy 3'-5' exonuclease domain of family-A DNA polymerases Back     alignment and domain information
>gnl|CDD|176656 cd09018, DEDDy_polA_RNaseD_like_exo, DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins Back     alignment and domain information
>gnl|CDD|176479 cd08642, DNA_pol_A_pol_I_A, Polymerase I functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication Back     alignment and domain information
>gnl|CDD|29030 cd00128, XPG, Xeroderma pigmentosum G N- and I-regions (XPGN, XPGI); contains the HhH2 motif; domain in nucleases Back     alignment and domain information
>gnl|CDD|37730 KOG2519, KOG2519, KOG2519, 5'-3' exonuclease [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|177280 PHA00439, PHA00439, exonuclease Back     alignment and domain information
>gnl|CDD|128575 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol1 family) motifs Back     alignment and domain information
>gnl|CDD|177397 PHA02567, rnh, RnaseH; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 976 DNA polymerase I [Candidatus Liberibacter asiaticus str
PRK07556977 consensus 100.0
PRK07997928 consensus 100.0
PRK06887954 consensus 100.0
PRK07625922 consensus 100.0
PRK08835931 consensus 100.0
PRK08786927 consensus 100.0
PRK05755889 DNA polymerase I; Provisional 100.0
PRK08928861 consensus 100.0
PRK07898902 consensus 100.0
PRK07456975 consensus 100.0
PRK08434887 consensus 100.0
TIGR005931005 pola DNA polymerase I; InterPro: IPR002298 DNA carries 100.0
PRK08076877 consensus 100.0
PRK05929870 consensus 100.0
PRK05797869 consensus 100.0
PRK07300880 consensus 100.0
COG0749593 PolA DNA polymerase I - 3'-5' exonuclease and polymeras 100.0
pfam00476383 DNA_pol_A DNA polymerase family A. 100.0
cd06444379 DNA_pol_A DNA polymerase family A, 5'-3' polymerase dom 100.0
smart00475259 53EXOc 5'-3' exonuclease. 100.0
PRK09482256 xni exonuclease IX; Provisional 100.0
cd00008240 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease dom 100.0
PHA00439288 exonuclease 99.97
cd00128316 XPG Xeroderma pigmentosum G N- and I-regions (XPGN, XPG 99.97
TIGR03674338 fen_arch flap structure-specific endonuclease. Endonucl 99.86
KOG2519449 consensus 99.59
COG0258310 Exo 5'-3' exonuclease (including N-terminal domain of P 100.0
PTZ00217394 flap endonuclease-1; Provisional 99.86
smart00482206 POLAc DNA polymerase A domain. 100.0
KOG36571075 consensus 99.62
pfam02739169 5_3_exonuc_N 5'-3' exonuclease, N-terminal resolvase-li 100.0
pfam05991166 DUF901 Protein of unknown function (DUF901). This famil 97.4
cd06139193 DNA_polA_I_Ecoli_like_exo The 3'-5' exonuclease domain 100.0
cd06128166 DNA_polA_exo The 3'-5' exonuclease domain of family-A D 100.0
cd06140178 DNA_polA_I_Bacillus_like_exo Bacillus stearothermophilu 99.97
smart00474172 35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proofread 99.92
pfam01612172 3_5_exonuc 3'-5' exonuclease. This domain is responsibl 99.91
cd00007155 35EXOc 3'-5' exonuclease. The 35EXOc domain is responsi 99.89
cd06142178 RNaseD_exo Ribonuclease (RNase) D is a bacterial enzyme 99.87
cd06147192 Rrp6p_like_exo Yeast Rrp6p and its human homolog, the P 99.78
COG0349361 Rnd Ribonuclease D [Translation, ribosomal structure an 99.67
PRK10829373 ribonuclease D; Provisional 99.64
cd06148197 Egl_like_exo The Egalitarian (Egl) protein subfamily is 99.6
TIGR01388374 rnd ribonuclease D; InterPro: IPR006292 These proteins 99.35
TIGR01405 1264 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-p 99.29
PRK06309232 DNA polymerase III subunit epsilon; Validated 99.18
PRK07740240 hypothetical protein; Provisional 99.13
PRK06310250 DNA polymerase III subunit epsilon; Validated 99.06
PRK06807313 DNA polymerase III subunit epsilon; Validated 99.01
PRK08517259 DNA polymerase III subunit epsilon; Provisional 98.99
PRK08074 932 bifunctional ATP-dependent DNA helicase/DNA polymerase 98.97
PRK09145203 DNA polymerase III subunit epsilon; Validated 98.96
PRK06631229 consensus 98.94
PRK07942234 DNA polymerase III subunit epsilon; Provisional 98.92
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polymerase 98.91
PRK07883575 hypothetical protein; Validated 98.9
KOG2206687 consensus 98.89
PRK07009241 consensus 98.84
PRK05711240 DNA polymerase III subunit epsilon; Provisional 98.83
PRK06022234 consensus 98.83
PRK06195309 DNA polymerase III subunit epsilon; Validated 98.81
PRK08816244 consensus 98.76
TIGR01406246 dnaQ_proteo DNA polymerase III, epsilon subunit; InterP 98.75
PRK05168213 ribonuclease T; Provisional 98.75
PRK08858246 consensus 98.75
TIGR01407 944 dinG_rel DnaQ family exonuclease/DinG family helicase, 98.72
PRK07982243 consensus 98.68
PRK07247195 DNA polymerase III subunit epsilon; Validated 98.68
smart00479169 EXOIII exonuclease domain in DNA-polymerase alpha and e 98.67
cd06134189 RNaseT RNase T is a DEDDh-type DnaQ-like 3'-5' exoribon 98.66
PRK09146239 DNA polymerase III subunit epsilon; Validated 98.65
PRK09182293 DNA polymerase III subunit epsilon; Validated 98.18
COG0847243 DnaQ DNA polymerase III, epsilon subunit and related 3' 98.06
PTZ00166 1081 DNA polymerase delta catalytic subunit; Provisional 97.61
cd05777230 DNA_polB_delta_exo The 3'-5' exonuclease domain of euka 97.5
TIGR00573228 dnaq exonuclease, DNA polymerase III, epsilon subunit f 97.38
COG3359278 Predicted exonuclease [DNA replication, recombination, 96.33
KOG2249280 consensus 95.56
PRK11779477 sbcB exonuclease I; Provisional 95.08
KOG2207617 consensus 93.36
pfam01367100 5_3_exonuc 5'-3' exonuclease, C-terminal SAM fold. 99.97
TIGR00084217 ruvA Holliday junction DNA helicase RuvA; InterPro: IPR 92.05
PRK03980295 flap endonuclease-1; Provisional 99.87
cd0008075 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) mo 99.82
PRK08609570 hypothetical protein; Provisional 94.69
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 94.33
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 93.47
pfam1039152 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda 91.66
smart00483334 POLXc DNA polymerase X family. includes vertebrate poly 91.41
cd06141168 WRN_exo WRN is a unique RecQ DNA helicase exhibiting an 99.45
cd06129159 RNaseD_like The RNase D-like group is composed of RNase 99.42
cd06146191 mut-7_like_exo The mut-7 subfamily is composed of Caeno 99.39
cd06126181 DEDDy DEDDy exonucleases, part of the DnaQ-like (or DED 99.04
cd06131167 DNA_pol_III_epsilon_Ecoli_like This subfamily is compos 98.89
PRK06063313 DNA polymerase III subunit epsilon; Provisional 98.66
cd06127159 DEDDh DEDDh exonucleases, part of the DnaQ-like (or DED 98.63
cd06130156 DNA_pol_III_epsilon_like This subfamily is composed of 98.6
cd06136177 TREX1_2 Three prime repair exonuclease (TREX) 1 and 2 a 98.5
pfam00929162 Exonuc_X-T Exonuclease. This family includes a variety 98.45
cd06144152 REX4_like This subfamily is composed of RNA exonuclease 98.25
cd06138183 ExoI_N This subfamily is composed of the N-terminal dom 98.16
cd06133176 ERI-1_3'hExo_like This subfamily is composed of Caenorh 98.02
cd05780195 DNA_polB_Kod1_like_exo The 3'-5' exonuclease domain of 97.93
cd05781188 DNA_polB_B3_exo The 3'-5' exonuclease domain of archaea 97.77
cd05779204 DNA_polB_epsilon_exo The 3'-5' exonuclease domain of eu 97.76
PRK05762785 DNA polymerase II; Reviewed 97.67
cd05160200 DNA_polB_exo The 3'-5' exonuclease domain of family-B D 97.6
cd05785207 DNA_polB_like2_exo A subfamily of the 3'-5' exonuclease 97.59
cd06137161 DEDDh_RNase This group is composed of eukaryotic exorib 97.47
cd05784193 DNA_polB_II_exo The 3'-5' exonuclease domain of Escheri 97.39
cd05782208 DNA_polB_like1_exo A subfamily of the 3'-5' exonuclease 97.17
smart00486471 POLBc DNA polymerase type-B family. DNA polymerase alph 95.25
COG0417792 PolB DNA polymerase elongation subunit (family B) [DNA 90.96
TIGR03491457 RecB family nuclease, putative, TM0106 family. Members 90.87
smart0027936 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs. 99.31
KOG2520815 consensus 98.74
KOG1798 2173 consensus 96.3
COG1948254 MUS81 ERCC4-type nuclease [DNA replication, recombinati 92.33
cd00141307 NT_POLXc Nucleotidyltransferase (NT) domain of family X 91.37
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-positive t 99.02
PRK00448 1436 polC DNA polymerase III PolC; Validated 98.99
PRK06859253 consensus 98.69
cd06125130 DnaQ_like_exo The DnaQ-like exonuclease superfamily is 98.36
KOG2518556 consensus 98.94
TIGR00600 1127 rad2 DNA excision repair protein (rad2); InterPro: IPR0 98.87
pfam00752100 XPG_N XPG N-terminal domain. 93.55
smart0048599 XPGN Xeroderma pigmentosum G N-region. domain in nuclea 92.95
PRK07983219 exodeoxyribonuclease X; Provisional 98.16
cd06149157 ISG20 Interferon (IFN) Stimulated Gene product of 20 kD 97.28
cd06143174 PAN2_exo PAN2 is the catalytic subunit of poly(A) nucle 97.13
cd06145150 REX1_like This subfamily is composed of RNA exonuclease 96.84
cd05783204 DNA_polB_B1_exo The 3'-5' exonuclease domain of Sulfolo 96.8
KOG0969 1066 consensus 96.28
cd05776234 DNA_polB_alpha_exo The 3'-5' exonuclease domain of euka 96.22
pfam09281138 Taq-exonuc Taq polymerase, exonuclease. Members of this 95.66
pfam10108211 Exon_PolB Predicted 3'-5' exonuclease related to the ex 94.57
PRK07748205 sporulation inhibitor KapD; Provisional 92.77
PRK05761777 DNA polymerase I; Reviewed 91.3
KOG2248380 consensus 90.95
KOG09501008 consensus 97.65
PRK00558609 uvrC excinuclease ABC subunit C; Validated 97.53
PRK13766764 Hef nuclease; Provisional 97.28
cd06135173 Orn Oligoribonuclease (Orn) is a DEDDh-type DnaQ-like 3 96.66
pfam00940391 RNA_pol DNA-dependent RNA polymerase. This is a family 96.61
PHA00452816 T3/T7-like RNA polymerase 92.5
pfam0086789 XPG_I XPG I-region. 96.1
pfam01550443 consensus 95.11
smart0048473 XPGI Xeroderma pigmentosum G I-region. domain in nuclea 91.17
COG3688173 Predicted RNA-binding protein containing a PIN domain [ 95.54
COG0322581 UvrC Nuclease subunit of the excinuclease complex [DNA 95.38
PRK05601377 DNA polymerase III subunit epsilon; Validated 95.11
PRK07956668 ligA NAD-dependent DNA ligase LigA; Validated 94.93
cd05778231 DNA_polB_zeta_exo The 3'-5' exonuclease domain of eukar 94.32
PRK00116198 ruvA Holliday junction DNA helicase RuvA; Reviewed 94.01
PRK13901196 ruvA Holliday junction DNA helicase motor protein; Prov 90.98
pfam04857235 CAF1 CAF1 family ribonuclease. The major pathways of mR 93.74
PRK06722242 exonuclease; Provisional 91.66
TIGR00575706 dnlj DNA ligase, NAD-dependent; InterPro: IPR001679 DNA 92.27
PRK10702211 endonuclease III; Provisional 91.88
COG0272667 Lig NAD-dependent DNA ligase (contains BRCT domain type 90.59
>PRK07556 consensus Back     alignment and domain information
>PRK07997 consensus Back     alignment and domain information
>PRK06887 consensus Back     alignment and domain information
>PRK07625 consensus Back     alignment and domain information
>PRK08835 consensus Back     alignment and domain information
>PRK08786 consensus Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>PRK08928 consensus Back     alignment and domain information
>PRK07898 consensus Back     alignment and domain information
>PRK07456 consensus Back     alignment and domain information
>PRK08434 consensus Back     alignment and domain information
>TIGR00593 pola DNA polymerase I; InterPro: IPR002298 DNA carries the biological information that instructs cells how to exist in an ordered fashion Back     alignment and domain information
>PRK08076 consensus Back     alignment and domain information
>PRK05929 consensus Back     alignment and domain information
>PRK05797 consensus Back     alignment and domain information
>PRK07300 consensus Back     alignment and domain information
>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam00476 DNA_pol_A DNA polymerase family A Back     alignment and domain information
>cd06444 DNA_pol_A DNA polymerase family A, 5'-3' polymerase domain Back     alignment and domain information
>smart00475 53EXOc 5'-3' exonuclease Back     alignment and domain information
>PRK09482 xni exonuclease IX; Provisional Back     alignment and domain information
>cd00008 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes Back     alignment and domain information
>PHA00439 exonuclease Back     alignment and domain information
>cd00128 XPG Xeroderma pigmentosum G N- and I-regions (XPGN, XPGI); contains the HhH2 motif; domain in nucleases Back     alignment and domain information
>TIGR03674 fen_arch flap structure-specific endonuclease Back     alignment and domain information
>KOG2519 consensus Back     alignment and domain information
>COG0258 Exo 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00217 flap endonuclease-1; Provisional Back     alignment and domain information
>smart00482 POLAc DNA polymerase A domain Back     alignment and domain information
>KOG3657 consensus Back     alignment and domain information
>pfam02739 5_3_exonuc_N 5'-3' exonuclease, N-terminal resolvase-like domain Back     alignment and domain information
>pfam05991 DUF901 Protein of unknown function (DUF901) Back     alignment and domain information
>cd06139 DNA_polA_I_Ecoli_like_exo The 3'-5' exonuclease domain of DNA polymerases has a fundamental role in reducing polymerase errors and is involved in proofreading activity Back     alignment and domain information
>cd06128 DNA_polA_exo The 3'-5' exonuclease domain of family-A DNA polymerases has a fundamental role in reducing polymerase errors and is involved in proofreading activity Back     alignment and domain information
>cd06140 DNA_polA_I_Bacillus_like_exo Bacillus stearothermophilus-like Polymerase I (pol I), a subgroup of the family-A DNA polymerases, contains an inactive DnaQ-like 3'-5' exonuclease domain in the same polypeptide chain as the polymerase region Back     alignment and domain information
>smart00474 35EXOc 3'-5' exonuclease Back     alignment and domain information
>pfam01612 3_5_exonuc 3'-5' exonuclease Back     alignment and domain information
>cd00007 35EXOc 3'-5' exonuclease Back     alignment and domain information
>cd06142 RNaseD_exo Ribonuclease (RNase) D is a bacterial enzyme involved in the maturation of small stable RNAs and the 3' maturation of tRNA Back     alignment and domain information
>cd06147 Rrp6p_like_exo Yeast Rrp6p and its human homolog, the Polymyositis/scleroderma autoantigen 100kDa (PM/Scl-100), are exosome-associated proteins involved in the degradation and processing of precursors to stable RNAs Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10829 ribonuclease D; Provisional Back     alignment and domain information
>cd06148 Egl_like_exo The Egalitarian (Egl) protein subfamily is composed of Drosophila Egl and similar proteins Back     alignment and domain information
>TIGR01388 rnd ribonuclease D; InterPro: IPR006292 These proteins represent ribonuclease D, a 3-exonuclease shown to act on tRNA both in vitro and when overexpressed in vivo Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-positive type; InterPro: IPR006308 These are the polypeptide chains of DNA polymerase III Back     alignment and domain information
>PRK06309 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07740 hypothetical protein; Provisional Back     alignment and domain information
>PRK06310 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06807 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08517 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK09145 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06631 consensus Back     alignment and domain information
>PRK07942 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>KOG2206 consensus Back     alignment and domain information
>PRK07009 consensus Back     alignment and domain information
>PRK05711 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK06022 consensus Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08816 consensus Back     alignment and domain information
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit; InterPro: IPR006309 These represent DnaQ, the DNA polymerase III epsilon subunit, as found in most Proteobacteria Back     alignment and domain information
>PRK05168 ribonuclease T; Provisional Back     alignment and domain information
>PRK08858 consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative; InterPro: IPR006310 These are a family of proteins in Gram-positive bacteria Back     alignment and domain information
>PRK07982 consensus Back     alignment and domain information
>PRK07247 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>cd06134 RNaseT RNase T is a DEDDh-type DnaQ-like 3'-5' exoribonuclease E implicated in the 3' maturation of small stable RNAs and 23srRNA, and in the end turnover of tRNA Back     alignment and domain information
>PRK09146 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK09182 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00166 DNA polymerase delta catalytic subunit; Provisional Back     alignment and domain information
>cd05777 DNA_polB_delta_exo The 3'-5' exonuclease domain of eukaryotic DNA polymerase delta Back     alignment and domain information
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family; InterPro: IPR006054 All proteins in this entry for which functions are known are components of the DNA polymerase III complex (epsilon subunit) Back     alignment and domain information
>COG3359 Predicted exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2249 consensus Back     alignment and domain information
>PRK11779 sbcB exonuclease I; Provisional Back     alignment and domain information
>KOG2207 consensus Back     alignment and domain information
>pfam01367 5_3_exonuc 5'-3' exonuclease, C-terminal SAM fold Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase RuvA; InterPro: IPR000085 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information
>PRK03980 flap endonuclease-1; Provisional Back     alignment and domain information
>cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA; InterPro: IPR011938 This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO), and archaeal RadB (IPR011939 from INTERPRO) Back     alignment and domain information