254780287

254780287

iron-sulfur cluster assembly accessory protein

GeneID in NCBI database:8209269Locus tag:CLIBASIA_00860
Protein GI in NCBI database:254780287Protein Accession:YP_003064700.1
Gene range:+(176457, 176786)Protein Length:109aa
Gene description:iron-sulfur cluster assembly accessory protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:iron-sulfur cluster assembly accessory protein
SEED prediction:probable iron binding protein from the HesB_IscA_SufA family
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Fe-S cluster assembly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI
ccccEEEcHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEcccccccccEEEEcccEEEEEcHHHHHHHcccEEEEEEcccccEEEEEcccccccccccccccc
ccccccccHHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEEccccccccEEEcccEEEEEccccHHHHcccEEEEEccccccEEEEEcccccccccccccccc
MVPIIKITDAAATQIKTILESNSDKKALRITIegggcsgfsykfdleskqseddivfeknGAQIFIDKISLAYLTNSEIDFVDNLLSksfqirnpnatsncgcgtsfsi
mvpiikitdaAATQIKtilesnsdkkalRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSfqirnpnatsncgcgtsfsi
MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI
**PIIKITDAAATQIKT*****SDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFS*
MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI
***IIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSF**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI
MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI
MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target109 iron-sulfur cluster assembly accessory protein [Candida
254781064116 FeS assembly scaffold SufA [Candidatus Liberibacte 7e-19
>gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Back     alignment
 Score = 84.0 bits (206), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 63/111 (56%), Gaps = 2/111 (1%)

Query: 1   MVPIIKITDAAATQIKTIL-ESNSDKKALRITIEGGGCSGFSYKFDLESKQSED-DIVFE 58
           M  I+ +T+AA  +IK I+  S    + +RI+++ GGC+G  Y  DL +    D D + E
Sbjct: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60

Query: 59  KNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           K+G +++ID  SL Y+  +EIDF    L   F   NPN  S CGCG S  I
Sbjct: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target109 iron-sulfur cluster assembly accessory protein [Candida
315122847109 iron-sulfur cluster assembly accessory protein [Candida 1 9e-46
163843146108 iron-sulfur cluster assembly accessory protein [Brucell 1 4e-34
17987374108 HESB protein [Brucella melitensis bv. 1 str. 16M] Lengt 1 4e-34
86357444110 hypothetical protein RHE_CH01816 [Rhizobium etli CFN 42 1 1e-33
239831754108 iron-sulfur cluster assembly accessory protein [Ochroba 1 2e-33
153009681108 iron-sulfur cluster assembly accessory protein [Ochroba 1 2e-33
110634166116 iron-sulfur cluster assembly accessory protein [Mesorhi 1 3e-33
218681510110 iron-sulfur cluster assembly accessory protein [Rhizobi 1 3e-33
209549081110 iron-sulfur cluster assembly accessory protein [Rhizobi 1 4e-33
163759457111 hypothetical protein HPDFL43_08897 [Hoeflea phototrophi 1 9e-33
>gi|315122847|ref|YP_004063336.1| iron-sulfur cluster assembly accessory protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 109 Back     alignment and organism information
 Score =  186 bits (472), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 89/109 (81%), Positives = 99/109 (90%)

Query: 1   MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKN 60
           M  II ITDAAA QIKTILES  DKKALRI+IEGGGCSGFSYKF+LESK+ EDD+VFEKN
Sbjct: 1   MASIINITDAAAKQIKTILESEHDKKALRISIEGGGCSGFSYKFELESKKCEDDVVFEKN 60

Query: 61  GAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           G+Q+FIDKISL+Y+ NSEIDFVD LLSKSFQIRNPNA S+CGCGTSFS+
Sbjct: 61  GSQVFIDKISLSYIANSEIDFVDTLLSKSFQIRNPNAISSCGCGTSFSM 109


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163843146|ref|YP_001627550.1| iron-sulfur cluster assembly accessory protein [Brucella suis ATCC 23445] Length = 108 Back     alignment and organism information
>gi|17987374|ref|NP_540008.1| HESB protein [Brucella melitensis bv. 1 str. 16M] Length = 108 Back     alignment and organism information
>gi|86357444|ref|YP_469336.1| hypothetical protein RHE_CH01816 [Rhizobium etli CFN 42] Length = 110 Back     alignment and organism information
>gi|239831754|ref|ZP_04680083.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum intermedium LMG 3301] Length = 108 Back     alignment and organism information
>gi|153009681|ref|YP_001370896.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum anthropi ATCC 49188] Length = 108 Back     alignment and organism information
>gi|110634166|ref|YP_674374.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium sp. BNC1] Length = 116 Back     alignment and organism information
>gi|218681510|ref|ZP_03529397.1| iron-sulfur cluster assembly accessory protein [Rhizobium etli CIAT 894] Length = 110 Back     alignment and organism information
>gi|209549081|ref|YP_002280998.1| iron-sulfur cluster assembly accessory protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 110 Back     alignment and organism information
>gi|163759457|ref|ZP_02166542.1| hypothetical protein HPDFL43_08897 [Hoeflea phototrophica DFL-43] Length = 111 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target109 iron-sulfur cluster assembly accessory protein [Candida
TIGR00049105 TIGR00049, TIGR00049, Iron-sulfur cluster assembly acce 4e-36
PRK13623115 PRK13623, PRK13623, iron-sulfur cluster insertion prote 6e-31
pfam0152191 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthes 1e-25
KOG1119199 KOG1119, KOG1119, KOG1119, Mitochondrial Fe-S cluster b 8e-25
TIGR01997107 TIGR01997, sufA_proteo, FeS assembly scaffold SufA 2e-23
KOG1120134 KOG1120, KOG1120, KOG1120, Fe-S cluster biosynthesis pr 1e-21
PRK09504122 PRK09504, sufA, iron-sulfur cluster assembly scaffold p 6e-21
TIGR02011105 TIGR02011, IscA, iron-sulfur cluster assembly protein I 2e-19
PLN03082163 PLN03082, PLN03082, Iron-sulfur cluster assembly; Provi 3e-19
PRK09502107 PRK09502, iscA, iron-sulfur cluster assembly protein; P 7e-19
TIGR03341190 TIGR03341, YhgI_GntY, IscR-regulated protein YhgI 2e-07
PRK11190192 PRK11190, PRK11190, Fe/S biogenesis protein NfuA; Provi 1e-05
COG0316110 COG0316, IscA, Uncharacterized conserved protein [Funct 3e-34
>gnl|CDD|161681 TIGR00049, TIGR00049, Iron-sulfur cluster assembly accessory protein Back     alignment and domain information
>gnl|CDD|184186 PRK13623, PRK13623, iron-sulfur cluster insertion protein ErpA; Provisional Back     alignment and domain information
>gnl|CDD|110518 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthesis Back     alignment and domain information
>gnl|CDD|36335 KOG1119, KOG1119, KOG1119, Mitochondrial Fe-S cluster biosynthesis protein ISA2 (contains a HesB-like domain) [Energy production and conversion, Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|131052 TIGR01997, sufA_proteo, FeS assembly scaffold SufA Back     alignment and domain information
>gnl|CDD|36336 KOG1120, KOG1120, KOG1120, Fe-S cluster biosynthesis protein ISA1 (contains a HesB-like domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181915 PRK09504, sufA, iron-sulfur cluster assembly scaffold protein; Provisional Back     alignment and domain information
>gnl|CDD|131066 TIGR02011, IscA, iron-sulfur cluster assembly protein IscA Back     alignment and domain information
>gnl|CDD|178631 PLN03082, PLN03082, Iron-sulfur cluster assembly; Provisional Back     alignment and domain information
>gnl|CDD|181914 PRK09502, iscA, iron-sulfur cluster assembly protein; Provisional Back     alignment and domain information
>gnl|CDD|132384 TIGR03341, YhgI_GntY, IscR-regulated protein YhgI Back     alignment and domain information
>gnl|CDD|183027 PRK11190, PRK11190, Fe/S biogenesis protein NfuA; Provisional Back     alignment and domain information
>gnl|CDD|30664 COG0316, IscA, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 109 iron-sulfur cluster assembly accessory protein [Candida
TIGR00049105 TIGR00049 iron-sulfur cluster assembly accessory protei 100.0
PRK09502107 iscA iron-sulfur cluster assembly protein; Provisional 100.0
COG0316110 sufA Fe-S cluster assembly scaffold protein [Posttransl 100.0
PRK13623118 iron-sulfur cluster insertion protein ErpA; Provisional 100.0
PRK09504122 sufA iron-sulfur cluster assembly scaffold protein; Pro 100.0
TIGR01997110 sufA_proteo FeS assembly scaffold SufA; InterPro: IPR01 100.0
KOG1120134 consensus 99.97
TIGR02011105 IscA iron-sulfur cluster assembly protein IscA; InterPr 99.96
PRK11190192 putative DNA uptake protein; Provisional 99.96
TIGR03341190 YhgI_GntY IscR-regulated protein YhgI. IscR (TIGR02010) 99.96
pfam0152191 Fe-S_biosyn Iron-sulphur cluster biosynthesis. This fam 99.95
KOG1119199 consensus 99.94
TIGR0191193 HesB_rel_seleno HesB-related (seleno)protein; InterPro: 98.88
COG484195 Uncharacterized protein conserved in bacteria [Function 98.01
COG4918114 Uncharacterized protein conserved in bacteria [Function 96.84
COG3564116 Uncharacterized protein conserved in bacteria [Function 94.99
>TIGR00049 TIGR00049 iron-sulfur cluster assembly accessory protein; InterPro: IPR016092 This family includes HesB which may be involved in nitrogen fixation; the hesB gene is expressed only under nitrogen fixation conditions Back     alignment and domain information
>PRK09502 iscA iron-sulfur cluster assembly protein; Provisional Back     alignment and domain information
>COG0316 sufA Fe-S cluster assembly scaffold protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13623 iron-sulfur cluster insertion protein ErpA; Provisional Back     alignment and domain information
>PRK09504 sufA iron-sulfur cluster assembly scaffold protein; Provisional Back     alignment and domain information
>TIGR01997 sufA_proteo FeS assembly scaffold SufA; InterPro: IPR011298 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>KOG1120 consensus Back     alignment and domain information
>TIGR02011 IscA iron-sulfur cluster assembly protein IscA; InterPro: IPR011302 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>PRK11190 putative DNA uptake protein; Provisional Back     alignment and domain information
>TIGR03341 YhgI_GntY IscR-regulated protein YhgI Back     alignment and domain information
>pfam01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis Back     alignment and domain information
>KOG1119 consensus Back     alignment and domain information
>TIGR01911 HesB_rel_seleno HesB-related (seleno)protein; InterPro: IPR010965 This entry represents a family of small proteins related to HesB and its close homologs, which are likely to be involved in iron-sulphur cluster assembly Back     alignment and domain information
>COG4841 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4918 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3564 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target109 iron-sulfur cluster assembly accessory protein [Candida
2apn_A114 Hi1723 Solution Structure Length = 114 2e-30
1nwb_A124 Solution Nmr Structure Of Protein Aq_1857 From Aqui 7e-29
1s98_A107 E.Coli Isca Crystal Structure To 2.3 A Length = 107 1e-28
1r94_A118 Crystal Structure Of Isca (Mercury Derivative) Leng 1e-28
2d2a_A145 Crystal Structure Of Escherichia Coli Sufa Involved 2e-26
1x0g_A112 Crystal Structure Of Isca With The [2fe-2s] Cluster 3e-17
2k4z_A125 Solution Nmr Structure Of Allochromatium Vinosum Ds 5e-07
gi|116666731|pdb|2APN|A Chain A, Hi1723 Solution Structure Length = 114 Back     alignment and structure
 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 68/110 (61%), Gaps = 1/110 (0%)

Query: 1   MVPIIKITDAAATQIKTILESNSD-KKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEK 59
           M   +  TDAAA ++K+++    +    LR+ I GGGCSGF Y F  + K ++ D+  EK
Sbjct: 5   MAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEK 64

Query: 60  NGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           +G Q+ ID +SL YL    +D+ + L    F + NPNATS CGCG+SFSI
Sbjct: 65  SGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI 114


>gi|31615730|pdb|1NWB|A Chain A, Solution Nmr Structure Of Protein Aq_1857 From Aquifex Aeolicus: Northeast Structural Genomics Consortium Target Qr6 Length = 124 Back     alignment and structure
>gi|49258913|pdb|1S98|A Chain A, E.Coli Isca Crystal Structure To 2.3 A Length = 107 Back     alignment and structure
>gi|40889628|pdb|1R94|A Chain A, Crystal Structure Of Isca (Mercury Derivative) Length = 118 Back     alignment and structure
>gi|85544500|pdb|2D2A|A Chain A, Crystal Structure Of Escherichia Coli Sufa Involved In Biosynthesis Of Iron-Sulfur Clusters Length = 145 Back     alignment and structure
gi|109156916|pdb|1X0G|A Chain A, Crystal Structure Of Isca With The [2fe-2s] Cluster Length = 112 Back     alignment and structure
>gi|194368480|pdb|2K4Z|A Chain A, Solution Nmr Structure Of Allochromatium Vinosum Dsrr: Northeast Structural Genomics Consortium Target Op5 Length = 125 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target109 iron-sulfur cluster assembly accessory protein [Candida
1r94_A118 Protein YFHF; tetrameric, beta barrel, iron-sulfur clus 4e-33
1nwb_A124 Hypothetical protein AQ_1857; QR6, structural genomics, 5e-31
2d2a_A145 SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, me 4e-30
1x0g_A112 ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swa 5e-28
2apn_A114 Protein HI1723; HI1723 solution structure, structural g 5e-25
2k4z_A125 DSRR; ISCA/SUFA/HESB like fold, structural genomics, PS 7e-19
>1r94_A Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} SCOP: b.124.1.1 PDB: 1r95_A 1s98_A Length = 118 Back     alignment and structure
 Score =  134 bits (339), Expect = 4e-33
 Identities = 37/105 (35%), Positives = 61/105 (58%)

Query: 5   IKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQI 64
           I ++D+AA ++ T L +      LR+ +   GCSG +Y  +   + + +DIVFE  G ++
Sbjct: 3   ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKV 62

Query: 65  FIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
            +D  SL +L  +++DFV   L++ F+  NPN    CGCG SF +
Sbjct: 63  VVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFKL 107


>1nwb_A Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} SCOP: b.124.1.1 Length = 124 Back     alignment and structure
>2d2a_A SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli} Length = 145 Back     alignment and structure
>1x0g_A ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus} Length = 112 Back     alignment and structure
>2apn_A Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae} Length = 114 Back     alignment and structure
>2k4z_A DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Length = 125 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target109 iron-sulfur cluster assembly accessory protein [Candida
2d2a_A145 SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, me 100.0
1r94_A118 Protein YFHF; tetrameric, beta barrel, iron-sulfur clus 100.0
1nwb_A124 Hypothetical protein AQ_1857; QR6, structural genomics, 100.0
1x0g_A112 ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swa 100.0
2apn_A114 Protein HI1723; HI1723 solution structure, structural g 100.0
2k4z_A125 DSRR; ISCA/SUFA/HESB like fold, structural genomics, PS 99.94
2qgo_A141 Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 103 98.2
2p2e_A128 Putative Fe-S biosynthesis protein; hypothetical protei 97.92
>2d2a_A SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=3.2e-39  Score=249.16  Aligned_cols=107  Identities=33%  Similarity=0.735  Sum_probs=103.2

Q ss_pred             CCEEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEEEHHHHCCCCCCCEECCCCEEEEECHHHHHHCCCCEEEEE
Q ss_conf             40331889999999999728988479999836887651465333210352113004687899984677654068799987
Q gi|254780287|r    3 PIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFV   82 (109)
Q Consensus         3 ~mi~iT~~A~~~i~~l~~~~~~~~~lRi~v~~gGCsG~~y~l~~~~~~~~~D~v~~~~gi~v~vd~~s~~~L~g~~IDy~   82 (109)
                      ..|+||++|+++|+++++++++..+|||+|++||||||+|.|+++++++++|.+++.+|++|+||+.|++||+|++|||+
T Consensus        39 q~ItITd~A~~~ik~ll~~~~~~~~LRi~Vk~GGCsGf~Y~l~~~~~~~~dD~v~~~~g~~v~Vd~~S~~~L~Gs~IDy~  118 (145)
T 2d2a_A           39 QGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFV  118 (145)
T ss_dssp             CCCEECHHHHHHHHHHHHHSTTCCEEEEEEEEETTTEEEEEEEEESSCCTTEEEEEETTEEEEEEGGGHHHHTTCEEEEE
T ss_pred             CEEEECHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCEEEECCCCCCCCCCCEEEECCCCEEEEEHHHHHHCCCCEEEEE
T ss_conf             60899999999999999739996179999937864885857353623567855897389899998688644589799885


Q ss_pred             ECCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             278545238988888887788622469
Q gi|254780287|r   83 DNLLSKSFQIRNPNATSNCGCGTSFSI  109 (109)
Q Consensus        83 ~~~~g~gF~i~nPna~~~CgCG~SF~~  109 (109)
                      +++++++|+|+||||+++||||+||+|
T Consensus       119 ~~~~gsgF~f~NPNa~~~CGCG~SFsV  145 (145)
T 2d2a_A          119 REGLNQIFKFHNPKAQNECGCGESFGV  145 (145)
T ss_dssp             EETTEEEEEEECTTTCSCCCCBCEEEC
T ss_pred             ECCCCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             668867079989998952389877569



>1r94_A Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} SCOP: b.124.1.1 PDB: 1r95_A 1s98_A Back     alignment and structure
>1nwb_A Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} SCOP: b.124.1.1 Back     alignment and structure
>1x0g_A ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2apn_A Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae} Back     alignment and structure
>2k4z_A DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Back     alignment and structure
>2qgo_A Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 10399G, Fe-S cluster protein, structural genomics; 2.04A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2p2e_A Putative Fe-S biosynthesis protein; hypothetical protein, beta-barrel, structural genomics, protein structure initiative, PSI-2; 2.48A {Lactobacillus salivarius UCC118} SCOP: b.124.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 109 iron-sulfur cluster assembly accessory protein [Candida
d1s98a_97 b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Esche 6e-22
d1nwba_101 b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex ae 6e-19
>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

class: All beta proteins
fold: HesB-like domain
superfamily: HesB-like domain
family: HesB-like domain
domain: Fe-S scaffold protein IscA (YfhF)
species: Escherichia coli [TaxId: 562]
 Score = 96.2 bits (239), Expect = 6e-22
 Identities = 30/95 (31%), Positives = 54/95 (56%)

Query: 5  IKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQI 64
          I ++D+AA ++ T L +      LR+ +   GCSG +Y  +   + + +DIVFE  G ++
Sbjct: 2  ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKV 61

Query: 65 FIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATS 99
           +D  S+ +L  +++DFV   L++ F+  NPN   
Sbjct: 62 VVDGKSMQFLDGTQLDFVKEGLNEGFKFTNPNVKD 96


>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Length = 101 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target109 iron-sulfur cluster assembly accessory protein [Candida
d1s98a_97 Fe-S scaffold protein IscA (YfhF) {Escherichia coli [Ta 99.96
d1nwba_101 Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 99.94
d2p2ea1118 Putative Fe-S biosynthesis protein LSL1730 {Lactobacill 98.06
>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: HesB-like domain
superfamily: HesB-like domain
family: HesB-like domain
domain: Fe-S scaffold protein IscA (YfhF)
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=8.8e-30  Score=192.63  Aligned_cols=97  Identities=31%  Similarity=0.663  Sum_probs=92.7

Q ss_pred             CEEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEEEHHHHCCCCCCCEECCCCEEEEECHHHHHHCCCCEEEEEE
Q ss_conf             03318899999999997289884799998368876514653332103521130046878999846776540687999872
Q gi|254780287|r    4 IIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVD   83 (109)
Q Consensus         4 mi~iT~~A~~~i~~l~~~~~~~~~lRi~v~~gGCsG~~y~l~~~~~~~~~D~v~~~~gi~v~vd~~s~~~L~g~~IDy~~   83 (109)
                      -|+||++|+++|++++++++++.+|||+|++|||+||+|.|.|++++.++|.+++.+|++|+||+.|++||+|++|||++
T Consensus         1 ~I~iT~~A~~~i~~ll~~~~~~~~lRi~v~~gGCsG~~Y~l~~~~~~~~~D~~~~~~g~~i~id~~s~~~L~G~~IDy~~   80 (97)
T d1s98a_           1 SITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVVDGKSMQFLDGTQLDFVK   80 (97)
T ss_dssp             CCEECHHHHHHHHHHHHTTCCCCEEEEEEEEETTTEEEEEEEEESSCCTTEEEEEETTEEEEEEGGGHHHHTTCEEEEEC
T ss_pred             CEEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCCEEEECCCCEEEEEHHHHHHHCCCEEEEEE
T ss_conf             98989999999999997389981799999718977636776005458999699872899999827999873899998856


Q ss_pred             CCCCCEEEEECCCCCCC
Q ss_conf             78545238988888887
Q gi|254780287|r   84 NLLSKSFQIRNPNATSN  100 (109)
Q Consensus        84 ~~~g~gF~i~nPna~~~  100 (109)
                      +++++||+|+||||++.
T Consensus        81 ~~~~~gF~f~NPNak~e   97 (97)
T d1s98a_          81 EGLNEGFKFTNPNVKDE   97 (97)
T ss_dssp             SSTTCEEEEECTTSCCC
T ss_pred             CCCCCCEEEECCCCCCC
T ss_conf             68868469989888898



>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2p2ea1 b.124.1.1 (A:3-120) Putative Fe-S biosynthesis protein LSL1730 {Lactobacillus salivarius [TaxId: 1624]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 109 iron-sulfur cluster assembly accessory protein [Ca
2d2a_A_145 (A:) SUFA protein; iron-sulfur cluster, iron, ISCA 3e-30
2apn_A_114 (A:) Protein HI1723; HI1723 solution structure, st 1e-29
1x0g_A_112 (A:) ISCA; [2Fe-2S], biosynthesis, cyanobacteria, 4e-28
2qgo_A_141 (A:) Putative Fe-S biosynthesis protein; PSI-2, NY 2e-21
2p2e_A_128 (A:) Putative Fe-S biosynthesis protein; hypotheti 7e-15
1nwb_A_30-8152 (A:30-81) Hypothetical protein AQ_1857; QR6, struc 6e-16
1r94_A_23-6947 (A:23-69) Protein YFHF; tetrameric, beta barrel, i 3e-14
1r94_A_1-22_70-11871 (A:1-22,A:70-118) Protein YFHF; tetrameric, beta b 1e-11
1nwb_A_1-29_82-12472 (A:1-29,A:82-124) Hypothetical protein AQ_1857; QR 2e-10
>2d2a_A (A:) SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli}Length = 145 Back     alignment and structure
 Score =  125 bits (314), Expect = 3e-30
 Identities = 35/107 (32%), Positives = 64/107 (59%)

Query: 3   PIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGA 62
             + +T AAA  I+ ++        +R+ ++  GC+GF Y  D  S+  +DD++FE +GA
Sbjct: 39  QGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGA 98

Query: 63  QIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           ++F+   ++ ++  +E+DFV   L++ F+  NP A + CGCG SF +
Sbjct: 99  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 145


>2apn_A (A:) Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae}Length = 114 Back     alignment and structure
>1x0g_A (A:) ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus}Length = 112 Back     alignment and structure
>2qgo_A (A:) Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 10399G, Fe-S cluster protein, structural genomics; 2.04A {Lactobacillus acidophilus ncfm}Length = 141 Back     alignment and structure
>2p2e_A (A:) Putative Fe-S biosynthesis protein; hypothetical protein, beta-barrel, structural genomics, protein structure initiative, PSI-2; 2.48A {Lactobacillus salivarius UCC118}Length = 128 Back     alignment and structure
>1nwb_A (A:30-81) Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus}Length = 52 Back     alignment and structure
>1r94_A (A:23-69) Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli}Length = 47 Back     alignment and structure
>1r94_A (A:1-22,A:70-118) Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli}Length = 71 Back     alignment and structure
>1nwb_A (A:1-29,A:82-124) Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus}Length = 72 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target109 iron-sulfur cluster assembly accessory protein [Candida
2d2a_A_145 SUFA protein; iron-sulfur cluster, iron, ISCA, YAD 100.0
2apn_A_114 Protein HI1723; HI1723 solution structure, structu 100.0
1x0g_A_112 ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domai 100.0
2qgo_A_141 Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC 99.75
2p2e_A_128 Putative Fe-S biosynthesis protein; hypothetical p 99.35
1r94_A_1-22_70-11871 Protein YFHF; tetrameric, beta barrel, iron-sulfur 99.49
1nwb_A_1-29_82-12472 Hypothetical protein AQ_1857; QR6, structural geno 99.39
2k4z_A_1-41_90-12577 DSRR; ISCA/SUFA/HESB like fold, structural genomic 94.54
1nwb_A_30-8152 Hypothetical protein AQ_1857; QR6, structural geno 99.38
1r94_A_23-6947 Protein YFHF; tetrameric, beta barrel, iron-sulfur 99.28
2k4z_A_42-8948 DSRR; ISCA/SUFA/HESB like fold, structural genomic 93.2
>2d2a_A (A:) SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=2.7e-36  Score=232.93  Aligned_cols=108  Identities=32%  Similarity=0.720  Sum_probs=105.4

Q ss_pred             CCCEEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEEEHHHHCCCCCCCEECCCCEEEEECHHHHHHCCCCEEEE
Q ss_conf             84033188999999999972898847999983688765146533321035211300468789998467765406879998
Q gi|254780287|r    2 VPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDF   81 (109)
Q Consensus         2 ~~mi~iT~~A~~~i~~l~~~~~~~~~lRi~v~~gGCsG~~y~l~~~~~~~~~D~v~~~~gi~v~vd~~s~~~L~g~~IDy   81 (109)
                      .+||+||++|+++|+++++++++..+|||.|+++||+|++|.|.|+++++++|++++.+|++|+||+.++.||+|++|||
T Consensus        38 ~~~i~iT~~A~~~l~~ll~~~~~~~~LRi~v~~~GCsG~~y~l~l~~~~~~~D~v~e~~G~~v~id~~~~~~L~g~~IDy  117 (145)
T 2d2a_A           38 WQGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDF  117 (145)
T ss_dssp             CCCCEECHHHHHHHHHHHHHSTTCCEEEEEEEEETTTEEEEEEEEESSCCTTEEEEEETTEEEEEEGGGHHHHTTCEEEE
T ss_pred             CCCEEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCEEECCCCCEEEEECCCCEEEECHHHHHHCCCCEEEE
T ss_conf             87679999999999999973999846999996687478764232200124403799737945886488882479979987


Q ss_pred             EECCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             7278545238988888887788622469
Q gi|254780287|r   82 VDNLLSKSFQIRNPNATSNCGCGTSFSI  109 (109)
Q Consensus        82 ~~~~~g~gF~i~nPna~~~CgCG~SF~~  109 (109)
                      +++..+++|+|.|||++++||||+||+|
T Consensus       118 ~~~~~g~~F~i~nPn~~~~CgCG~SF~v  145 (145)
T 2d2a_A          118 VREGLNQIFKFHNPKAQNECGCGESFGV  145 (145)
T ss_dssp             EEETTEEEEEEECTTTCSCCCCBCEEEC
T ss_pred             EECCCCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             4568866079989898952489877759



>2apn_A (A:) Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae} Back     alignment and structure
>1x0g_A (A:) ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2qgo_A (A:) Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 10399G, Fe-S cluster protein, structural genomics; 2.04A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2p2e_A (A:) Putative Fe-S biosynthesis protein; hypothetical protein, beta-barrel, structural genomics, protein structure initiative, PSI-2; 2.48A {Lactobacillus salivarius UCC118} Back     alignment and structure
>1r94_A (A:1-22,A:70-118) Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} Back     alignment and structure
>1nwb_A (A:1-29,A:82-124) Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} Back     alignment and structure
>2k4z_A (A:1-41,A:90-125) DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Back     alignment and structure
>1nwb_A (A:30-81) Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} Back     alignment and structure
>1r94_A (A:23-69) Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} Back     alignment and structure
>2k4z_A (A:42-89) DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Back     alignment and structure