254780286

254780286

deoxyguanosinetriphosphate triphosphohydrolase-like protein

GeneID in NCBI database:8209268Locus tag:CLIBASIA_00855
Protein GI in NCBI database:254780286Protein Accession:YP_003064699.1
Gene range:-(175129, 176361)Protein Length:410aa
Gene description:deoxyguanosinetriphosphate triphosphohydrolase-like protein
COG prediction:[F] dGTP triphosphohydrolase
KEGG prediction:deoxyguanosinetriphosphate triphosphohydrolase-like protein; K01129 dGTPase [EC:3.1.5.1]
SEED prediction:Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:Purine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MIVVRKLGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEFH
cEEEEccccccccccccccccHHHccccccccccccccHHHccHHHHcccHHHHHHHHccEEEEccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHcc
cHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccHccccccccHcHHHHHHHcccHccccccHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccEEcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHcccHHHHHHHHHccHccccHHHHHHHHcccHHHHHHHHHHHHccccccEEEEcccc
mivvrklgfghqkkvayaadptqslgrmypekrsltrsefQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAhdfghppfghvGEDVLQELLSsyggfdhniqSFRIVTELEcsyadfdginLTWETLeglighngpilpqdldkpriiprifsdyyhIHGLSLANFASLEGQVAAIAddiaydahdiddgvrAGLLTVDMLKEISFLEKHIASLHDLyghlddkrLVHELVRRQITAMVEDVITVSQKRIahlkphaihDIRSAGyriidfsdemtLVDKEIKSMLVKYVyrhpsimtCCNQIANVIRNLFSaymsdprkmrgcnqleyerdmtdsikarhvgdyLAGMTDSYAIREHHILFgyipdfavdysefh
mivvrklgfghqkkvayaadptqslgrmypekrsltrsefqrdrdrMIHTTafrrlkdktqvffhrqrdhyrtrlmhtievSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRiahlkphaihdirsAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEFH
MIVVRKLGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVaaiaddiaydahdiddGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEFH
*********G*QKKVAYA*****************TRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEF*
MIVVRKLGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEFH
MIVVRKLGFGHQKKVAYA********************EFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEF*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVVRKLGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEFH
MIVVRKLGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEFH
MIVVRKLGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVDYSEFH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
315122846407 deoxyguanosinetriphosphate triphosphohydrolase-like pro 1 0.0
209549082405 deoxyguanosinetriphosphate triphosphohydrolase-like pro 1 1e-132
222085779405 deoxyguanosinetriphosphate triphosphohydrolase protein 1 1e-131
327191800405 deoxyguanosinetriphosphate triphosphohydrolase protein 1 1e-131
86357445405 deoxyguanosinetriphosphate triphosphohydrolase-like pro 1 1e-131
190891506405 deoxyguanosinetriphosphate triphosphohydrolase [Rhizobi 1 1e-131
241204409405 deoxyguanosinetriphosphate triphosphohydrolase-like pro 1 1e-131
15965275405 deoxyguanosinetriphosphate triphosphohydrolase-like pro 1 1e-130
116251800405 deoxyguanosinetriphosphate triphosphohydrolase-like pro 1 1e-130
222148976405 deoxyguanosinetriphosphate triphosphohydrolase-like pro 1 1e-128
>gi|315122846|ref|YP_004063335.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 407 Back     alignment and organism information
 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/405 (77%), Positives = 354/405 (87%)

Query: 1   MIVVRKLGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKT 60
           MI  RKLGFG+QKK  YAA+P QSLGR++ EK+SLTRSEFQRDRDR+IHTTAFRRLKDKT
Sbjct: 1   MIARRKLGFGYQKKAVYAANPAQSLGRIHEEKKSLTRSEFQRDRDRIIHTTAFRRLKDKT 60

Query: 61  QVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDV 120
           QVFF R RDHYRTRL+HTIEVSQIARSLARALR+DEDL E IALAHDFGHPPFGH GE++
Sbjct: 61  QVFFGRHRDHYRTRLLHTIEVSQIARSLARALRLDEDLAEGIALAHDFGHPPFGHTGENI 120

Query: 121 LQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPR 180
           LQE+L+  GGFDHNIQSFRIVTELE SYADFDGINLTWE LEGL+GHNGP LPQD    +
Sbjct: 121 LQEVLAFCGGFDHNIQSFRIVTELEKSYADFDGINLTWEVLEGLLGHNGPFLPQDSKASK 180

Query: 181 IIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISF 240
            IP+IF DY H HGL+L++FA+LE QVAAIADDIAY+AHDIDD VRAG LT DML+EISF
Sbjct: 181 SIPKIFFDYQHKHGLTLSSFANLEAQVAAIADDIAYNAHDIDDSVRAGFLTFDMLEEISF 240

Query: 241 LEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGY 300
           L+K I  + DLY +LDDKRL HELVRRQITAMVEDVITVSQ RIA LKP +IHDIRSA Y
Sbjct: 241 LKKQIIEVKDLYHNLDDKRLAHELVRRQITAMVEDVITVSQNRIAQLKPRSIHDIRSASY 300

Query: 301 RIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQ 360
           RI+DFSD+M +VDKEIKSML KYVY+HP IM C +QI  +IRNLFSAYMSD RKMRG + 
Sbjct: 301 RIVDFSDDMAIVDKEIKSMLFKYVYQHPRIMICRDQITGIIRNLFSAYMSDSRKMRGYDH 360

Query: 361 LEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYIPDFAVD 405
           LE E+D+TD++K R +GDYLAGMTDSYAIREH+ILFGYIPDFA+D
Sbjct: 361 LECEKDITDAVKGRKIGDYLAGMTDSYAIREHNILFGYIPDFALD 405


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209549082|ref|YP_002280999.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 405 Back     alignment and organism information
>gi|222085779|ref|YP_002544309.1| deoxyguanosinetriphosphate triphosphohydrolase protein [Agrobacterium radiobacter K84] Length = 405 Back     alignment and organism information
>gi|327191800|gb|EGE58800.1| deoxyguanosinetriphosphate triphosphohydrolase protein [Rhizobium etli CNPAF512] Length = 405 Back     alignment and organism information
>gi|86357445|ref|YP_469337.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Rhizobium etli CFN 42] Length = 405 Back     alignment and organism information
>gi|190891506|ref|YP_001978048.1| deoxyguanosinetriphosphate triphosphohydrolase [Rhizobium etli CIAT 652] Length = 405 Back     alignment and organism information
>gi|241204409|ref|YP_002975505.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 405 Back     alignment and organism information
>gi|15965275|ref|NP_385628.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Sinorhizobium meliloti 1021] Length = 405 Back     alignment and organism information
>gi|116251800|ref|YP_767638.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Rhizobium leguminosarum bv. viciae 3841] Length = 405 Back     alignment and organism information
>gi|222148976|ref|YP_002549933.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Agrobacterium vitis S4] Length = 405 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
PRK01286336 PRK01286, PRK01286, deoxyguanosinetriphosphate triphosp 1e-119
TIGR01353381 TIGR01353, dGTP_triPase, deoxyguanosinetriphosphate tri 7e-80
PRK05318432 PRK05318, PRK05318, deoxyguanosinetriphosphate triphosp 1e-46
PRK01096440 PRK01096, PRK01096, deoxyguanosinetriphosphate triphosp 2e-35
PRK04926503 PRK04926, dgt, deoxyguanosinetriphosphate triphosphohyd 1e-21
COG0232412 COG0232, Dgt, dGTP triphosphohydrolase [Nucleotide tran 1e-101
PRK03007428 PRK03007, PRK03007, deoxyguanosinetriphosphate triphosp 9e-43
COG1078421 COG1078, COG1078, HD superfamily phosphohydrolases [Gen 3e-05
smart00471124 smart00471, HDc, Metal dependent phosphohydrolases with 3e-05
pfam01966108 pfam01966, HD, HD domain 6e-05
cd00077145 cd00077, HDc, Metal dependent phosphohydrolases with co 0.004
>gnl|CDD|179272 PRK01286, PRK01286, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|162314 TIGR01353, dGTP_triPase, deoxyguanosinetriphosphate triphosphohydrolase, putative Back     alignment and domain information
>gnl|CDD|180010 PRK05318, PRK05318, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179219 PRK01096, PRK01096, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179894 PRK04926, dgt, deoxyguanosinetriphosphate triphosphohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|30581 COG0232, Dgt, dGTP triphosphohydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179526 PRK03007, PRK03007, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|31276 COG1078, COG1078, HD superfamily phosphohydrolases [General function prediction only] Back     alignment and domain information
>gnl|CDD|128747 smart00471, HDc, Metal dependent phosphohydrolases with conserved 'HD' motif Back     alignment and domain information
>gnl|CDD|145246 pfam01966, HD, HD domain Back     alignment and domain information
>gnl|CDD|28958 cd00077, HDc, Metal dependent phosphohydrolases with conserved 'HD' motif Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
PRK03007428 deoxyguanosinetriphosphate triphosphohydrolase-like pro 100.0
PRK01286338 deoxyguanosinetriphosphate triphosphohydrolase-like pro 100.0
PRK05318442 deoxyguanosinetriphosphate triphosphohydrolase-like pro 100.0
COG0232412 Dgt dGTP triphosphohydrolase [Nucleotide transport and 100.0
PRK01096442 deoxyguanosinetriphosphate triphosphohydrolase-like pro 100.0
PRK04926503 dgt deoxyguanosinetriphosphate triphosphohydrolase; Pro 100.0
TIGR01353458 dGTP_triPase deoxyguanosinetriphosphate triphosphohydro 100.0
COG1078421 HD superfamily phosphohydrolases [General function pred 99.18
COG4341186 Predicted HD phosphohydrolase [General function predict 96.34
PRK10119231 hypothetical protein; Provisional 95.94
smart00471124 HDc Metal dependent phosphohydrolases with conserved 'H 98.52
cd00077145 HDc Metal dependent phosphohydrolases with conserved 'H 98.43
pfam01966108 HD HD domain. HD domains are metal dependent phosphohyd 98.42
PRK12705485 hypothetical protein; Provisional 98.09
PRK12704455 phosphodiesterase; Provisional 98.08
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF. 98.04
PRK00106535 hypothetical protein; Provisional 97.96
PRK13480314 3'-5' exoribonuclease YhaM; Provisional 96.81
LOAD_HD114 consensus 98.42
COG1418222 Predicted HD superfamily hydrolase [General function pr 97.98
PRK07152343 nadD putative nicotinate-nucleotide adenylyltransferase 96.71
TIGR03276179 Phn-HD phosphonate degradation operons associated HDIG 96.33
COG1713187 Predicted HD superfamily hydrolase involved in NAD meta 96.31
COG2206344 c-di-GMP phosphodiesterase class II (HD-GYP domain) [Si 95.45
TIGR00277104 HDIG uncharacterized domain HDIG; InterPro: IPR006675 T 95.29
TIGR03401228 cyanamide_fam HD domain protein, cyanamide hydratase fa 95.07
pfam00233237 PDEase_I 3'5'-cyclic nucleotide phosphodiesterase. 93.31
COG3437360 Response regulator containing a CheY-like receiver doma 92.61
KOG2681498 consensus 97.72
pfam07514326 TraI_2 Putative helicase. Some members of this family h 95.61
COG3481287 Predicted HD-superfamily hydrolase [General function pr 91.48
pfam08668196 HDOD HDOD domain. 95.18
COG1480 700 Predicted membrane-associated HD superfamily hydrolase 94.88
>PRK03007 deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional Back     alignment and domain information
>PRK01286 deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional Back     alignment and domain information
>PRK05318 deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional Back     alignment and domain information
>COG0232 Dgt dGTP triphosphohydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01096 deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional Back     alignment and domain information
>PRK04926 dgt deoxyguanosinetriphosphate triphosphohydrolase; Provisional Back     alignment and domain information
>TIGR01353 dGTP_triPase deoxyguanosinetriphosphate triphosphohydrolase, putative; InterPro: IPR006261 DeoxyGTP triphosphohydrolase (dgt) releases inorganic triphosphate, an unusual reaction product, from GTP Back     alignment and domain information
>COG1078 HD superfamily phosphohydrolases [General function prediction only] Back     alignment and domain information
>COG4341 Predicted HD phosphohydrolase [General function prediction only] Back     alignment and domain information
>PRK10119 hypothetical protein; Provisional Back     alignment and domain information
>smart00471 HDc Metal dependent phosphohydrolases with conserved 'HD' motif Back     alignment and domain information
>cd00077 HDc Metal dependent phosphohydrolases with conserved 'HD' motif Back     alignment and domain information
>pfam01966 HD HD domain Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK13480 3'-5' exoribonuclease YhaM; Provisional Back     alignment and domain information
>LOAD_HD consensus Back     alignment and domain information
>COG1418 Predicted HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>TIGR03276 Phn-HD phosphonate degradation operons associated HDIG domain protein Back     alignment and domain information
>COG1713 Predicted HD superfamily hydrolase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>COG2206 c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00277 HDIG uncharacterized domain HDIG; InterPro: IPR006675 This domain is found in a few known nucleotidyltransferes and in a large number of uncharacterised proteins Back     alignment and domain information
>TIGR03401 cyanamide_fam HD domain protein, cyanamide hydratase family Back     alignment and domain information
>pfam00233 PDEase_I 3'5'-cyclic nucleotide phosphodiesterase Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG2681 consensus Back     alignment and domain information
>pfam07514 TraI_2 Putative helicase Back     alignment and domain information
>COG3481 Predicted HD-superfamily hydrolase [General function prediction only] Back     alignment and domain information
>pfam08668 HDOD HDOD domain Back     alignment and domain information
>COG1480 Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
2dqb_A376 Crystal Structure Of Dntp Triphosphohydrolase From 2e-90
3bg2_A444 Crystal Structure Of Deoxyguanosinetriphosphate Tri 2e-53
2pgs_A451 Crystal Structure Of A Putative Deoxyguanosinetriph 8e-52
2hek_A371 Crystal Structure Of O67745, A Hypothetical Protein 5e-06
>gi|126030250|pdb|2DQB|A Chain A, Crystal Structure Of Dntp Triphosphohydrolase From Thermus Thermophilus Hb8, Which Is Homologous To Dgtp Triphosphohydrolase Length = 376 Back     alignment and structure
 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 147/391 (37%), Positives = 205/391 (52%), Gaps = 25/391 (6%)

Query: 7   LGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHR 66
           L     +   YA     + GR +PE  SL R+ +Q+DRDR++HTTAFRRL+ KTQV    
Sbjct: 9   LELEASRLAPYAQKARDTRGRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQVLPGW 68

Query: 67  QRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLS 126
             D+YRTRL HT+EV+Q++RS+ARAL ++EDL EAIAL+HD GHPPFGH GE VL  L  
Sbjct: 69  AGDYYRTRLTHTLEVAQVSRSIARALGLNEDLTEAIALSHDLGHPPFGHTGEHVLNALXQ 128

Query: 127 SYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIF 186
            +GGF+HN Q+ RI+T LE  Y  F G+NLT+E LEG+  H     P             
Sbjct: 129 DHGGFEHNAQALRILTHLEVRYPGFRGLNLTYEVLEGIATHEAAYSPG------------ 176

Query: 187 SDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEIS-FLEKHI 245
                          +LE QV  ++D IAY AHD+DDG RAGLL  + LKE+       +
Sbjct: 177 ------FKPLYEGQGTLEAQVVDLSDAIAYAAHDLDDGFRAGLLHPEELKEVELLQALAL 230

Query: 246 ASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDF 305
               DL    +  R V  LVR+ +   +   I  + +R+      +   +R    R+   
Sbjct: 231 EEGLDLLRLPELDRRV--LVRQLLGYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAAL 288

Query: 306 SDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYER 365
            +E     K +K+ L +  YRHP ++    +   V+  LF+AY   P  +    Q +   
Sbjct: 289 GEEAEKALKALKAFLXERFYRHPEVLRERRKAEAVLEGLFAAYTRYPELLPREVQAKI-- 346

Query: 366 DMTDSIKARHVGDYLAGMTDSYAIREHHILF 396
              +    R V DY+AG TD +A+  +  L 
Sbjct: 347 --PEEGLERAVCDYIAGXTDRFALEAYRRLS 375


gi|161761240|pdb|3BG2|A Chain A, Crystal Structure Of Deoxyguanosinetriphosphate Triphosphohydrolase From Flavobacterium Sp. Med217 Length = 444 Back     alignment and structure
>gi|146387147|pdb|2PGS|A Chain A, Crystal Structure Of A Putative Deoxyguanosinetriphosphate Triphosphohydrolase From Pseudomonas Syringae Pv. Phaseolicola 1448a Length = 451 Back     alignment and structure
gi|110590634|pdb|2HEK|A Chain A, Crystal Structure Of O67745, A Hypothetical Protein From Aquifex Aeolicus At 2.0 A Resolution. Length = 371 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
2dqb_A376 Deoxyguanosinetriphosphate triphosphohydrolase, putativ 1e-79
2pgs_A451 Putative deoxyguanosinetriphosphate triphosphohydrolase 1e-74
3bg2_A444 DGTP triphosphohydrolase; structural genomics, NYSGXRC, 6e-69
2hek_A371 Hypothetical protein; predominantly alpha helical prote 7e-18
3irh_A480 HD domain protein; phosphohydrolase, dntpase, structura 8e-06
2q14_A410 Phosphohydrolase; BT4208, HD domain, structural genomic 1e-09
3dto_A223 BH2835 protein; all alpha-helical protein, structural g 2e-04
2o08_A188 BH1327 protein; NP_242193.1, hypothetical protein, stru 0.002
3ccg_A190 HD superfamily hydrolase; NP_347894.1, HD domain, struc 0.003
>2dqb_A Deoxyguanosinetriphosphate triphosphohydrolase, putative; dntpase, DNTP, single-stranded DNA, DNA, dGTPase, HD superfamily; 2.20A {Thermus thermophilus HB8} Length = 376 Back     alignment and structure
 Score =  292 bits (747), Expect = 1e-79
 Identities = 142/380 (37%), Positives = 199/380 (52%), Gaps = 23/380 (6%)

Query: 17  YAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLM 76
           YA     + GR +PE  SL R+ +Q+DRDR++HTTAFRRL+ KTQV      D+YRTRL 
Sbjct: 19  YAQKARDTRGRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQVLPGWAGDYYRTRLT 78

Query: 77  HTIEVSQIARSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQ 136
           HT+EV+Q++RS+ARAL ++EDL EAIAL+HD GHPPFGH GE VL  L+  +GGF+HN Q
Sbjct: 79  HTLEVAQVSRSIARALGLNEDLTEAIALSHDLGHPPFGHTGEHVLNALMQDHGGFEHNAQ 138

Query: 137 SFRIVTELECSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLS 196
           + RI+T LE  Y  F G+NLT+E LEG+  H                     Y       
Sbjct: 139 ALRILTHLEVRYPGFRGLNLTYEVLEGIATHEAA------------------YSPGFKPL 180

Query: 197 LANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLD 256
                +LE QV  ++D IAY AHD+DDG RAGLL  + LKE+  L+            L 
Sbjct: 181 YEGQGTLEAQVVDLSDAIAYAAHDLDDGFRAGLLHPEELKEVELLQALALEEGLDLLRLP 240

Query: 257 DKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEI 316
           +      LVR+ +   +   I  + +R+      +   +R    R+              
Sbjct: 241 ELD-RRVLVRQLLGYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAALGXXXXXXXXXX 299

Query: 317 KSMLVKYVYRHPSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHV 376
              L++  YRHP ++    +   V+  LF+AY   P  +      E +  + +    R V
Sbjct: 300 XXFLMERFYRHPEVLRERRKAEAVLEGLFAAYTRYPELL----PREVQAKIPEEGLERAV 355

Query: 377 GDYLAGMTDSYAIREHHILF 396
            DY+AGMTD +A+  +  L 
Sbjct: 356 CDYIAGMTDRFALEAYRRLS 375


>2pgs_A Putative deoxyguanosinetriphosphate triphosphohydrolase; deoxyguanosinetriphosphate triphsphohydrolase; 2.35A {Pseudomonas syringae PV} Length = 451 Back     alignment and structure
>3bg2_A DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217} Length = 444 Back     alignment and structure
>2hek_A Hypothetical protein; predominantly alpha helical protein with GDP binding site and active site being FAR from EACH other, structural genomics; HET: GDP; 2.00A {Aquifex aeolicus} SCOP: a.211.1.1 Length = 371 Back     alignment and structure
>3irh_A HD domain protein; phosphohydrolase, dntpase, structural genomics, PSI-2, protein structure initiative; HET: DGT DTP; 2.40A {Enterococcus faecalis V583} PDB: 2o6i_A* Length = 480 Back     alignment and structure
>2q14_A Phosphohydrolase; BT4208, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE ADP; 2.20A {Bacteroides thetaiotaomicron vpi-5482} Length = 410 Back     alignment and structure
>3dto_A BH2835 protein; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Bacillus halodurans} SCOP: a.211.1.1 Length = 223 Back     alignment and structure
>2o08_A BH1327 protein; NP_242193.1, hypothetical protein, structural genomics, joint center for structural genomics, JCSG, PSI-2; HET: UNL PG4 DGI; 1.90A {Bacillus halodurans} Length = 188 Back     alignment and structure
>3ccg_A HD superfamily hydrolase; NP_347894.1, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Clostridium acetobutylicum atcc 824} Length = 190 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
2dqb_A376 Deoxyguanosinetriphosphate triphosphohydrolase, putativ 100.0
3bg2_A444 DGTP triphosphohydrolase; structural genomics, NYSGXRC, 100.0
2pgs_A451 Putative deoxyguanosinetriphosphate triphosphohydrolase 100.0
2hek_A371 Hypothetical protein; predominantly alpha helical prote 100.0
3irh_A480 HD domain protein; phosphohydrolase, dntpase, structura 99.8
2q14_A410 Phosphohydrolase; BT4208, HD domain, structural genomic 99.69
2o08_A188 BH1327 protein; putative HD superfamily hydrolase, stru 98.87
2ogi_A196 Hypothetical protein SAG1661; NP_688652.1, conserved hy 98.31
3ccg_A190 HD superfamily hydrolase; NP_347894.1, HD domain, struc 98.21
2pq7_A220 Predicted HD superfamily hydrolase; 104161995, HD domai 97.68
3m1t_A275 Putative phosphohydrolase; structural genomics, joint c 96.67
3hc1_A305 Uncharacterized HDOD domain protein; HDOD domain protei 96.43
1taz_A365 Calcium/calmodulin-dependent 3',5'-cyclic nucleotide ph 90.43
3djb_A223 Hydrolase, HD family; all alpha-helical protein., struc 97.65
3dto_A223 BH2835 protein; all alpha-helical protein, structural g 97.65
3gw7_A239 Uncharacterized protein YEDJ; all alpha-helical protein 97.57
3b57_A209 LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomi 97.31
2qgs_A225 Protein Se1688; alpha-helical protein, structural genom 97.27
2pjq_A231 Uncharacterized protein LP_2664; LPR71, NESG, structura 97.04
3dyn_A329 High affinity CGMP-specific 3',5'-cyclic phosphodiester 94.21
1tbf_A347 CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5A, hy 92.76
1f0j_A377 PDE4B, phosphodiesterase 4B; PDE phosphodiesterase, hyd 92.04
3itu_A345 CGMP-dependent 3',5'-cyclic phosphodiesterase; Zn-bindi 91.78
3hr1_A380 CAMP and CAMP-inhibited CGMP 3',5'-cyclic phosphodieste 91.47
2r8q_A359 Class I phosphodiesterase PDEB1; leishimaniasis, parasi 91.26
3ecm_A338 High affinity CAMP-specific and IBMX-insensitive 3',5'- 91.16
1y2k_A349 DPDE3, PDE43, CAMP-specific 3',5'-cyclic phosphodiester 91.07
1zkl_A353 HCP1, TM22, high-affinity CAMP-specific 3',5'-cyclic ph 90.78
3g4g_A421 DPDE3, PDE43, CAMP-specific 3',5'-cyclic phosphodiester 90.2
2cqz_A177 177AA long hypothetical protein; hypothetical proteins, 90.05
3mem_A457 Putative signal transduction protein; structural genomi 94.64
3kq5_A393 Hypothetical cytosolic protein; structural genomics, un 93.72
3ljx_A288 MMOQ response regulator; structural genomics, PSI-2, pr 93.97
3bjc_A878 CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5, ere 91.82
3ibj_A691 CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE2A, G 91.58
>2dqb_A Deoxyguanosinetriphosphate triphosphohydrolase, putative; dntpase, DNTP, single-stranded DNA, DNA, dGTPase, HD superfamily; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
Probab=100.00  E-value=0  Score=909.52  Aligned_cols=366  Identities=40%  Similarity=0.610  Sum_probs=333.6

Q ss_pred             CCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHCCCCEEECCHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             67864658543870333773477888999984340000110273462327574787169998706620888999999999
Q gi|254780286|r    8 GFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARS   87 (410)
Q Consensus         8 ~~~~~~~~~~a~~~~~~~gR~~~e~~~~~R~~f~rD~dRIi~S~afRRL~~KTQVf~~~~~d~~rtRLtHslEVa~i~rs   87 (410)
                      .++.+.++|||+++.+++||.+||+++++||||+|||||||||+||||||+||||||+.+||||||||||||||||||||
T Consensus        10 ~~~~~~l~~~a~~~~~~~~R~~~e~~~~~R~~f~rD~dRIi~S~afRRL~~KTQVf~~~~~d~~rtRLTHslEVa~i~rs   89 (376)
T 2dqb_A           10 ELEASRLAPYAQKARDTRGRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQVLPGWAGDYYRTRLTHTLEVAQVSRS   89 (376)
T ss_dssp             HHHHHHSCTTSCCGGGCCCCSSCCCCCSSCCHHHHHHHHHHHSHHHHHGGGSCSSSCSCC--CCCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCHHHCCCCCCCCCCCCCCCCCCCCCHHHCHHHHHCCHHHHCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             88875248854696020388878999999981431404887278776145688263079998537767899999999999


Q ss_pred             HHHHCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             99883999889999998886289988654789999997312554577657788754321146701000247888776347
Q gi|254780286|r   88 LARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEGLIGH  167 (410)
Q Consensus        88 i~~~l~~~~dlvea~~L~HDiGhpPFGH~GE~al~~~~~~~~gFegNaQ~~Rilt~LE~~~~~~~GLNLT~atL~~iiKy  167 (410)
                      ||+.+|+|++||||||||||||||||||+||+||++||+++||||||||||||||+||.+++.++||||||+||+|++||
T Consensus        90 i~~~l~~~~~lvea~~L~HDiGhpPFGH~GE~al~~~~~~~~gFegNaQslRilt~Le~~~~~~~GlnLT~~tl~~i~K~  169 (376)
T 2dqb_A           90 IARALGLNEDLTEAIALSHDLGHPPFGHTGEHVLNALMQDHGGFEHNAQALRILTHLEVRYPGFRGLNLTYEVLEGIATH  169 (376)
T ss_dssp             HHHHTTCCHHHHHHHHHHTTTTCCSSTTHHHHHHHHHTTTTTCCCHHHHHHHHHHTTCBCBTTBSBCCCCHHHHHHHHHS
T ss_pred             HHHHHCCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCC
T ss_conf             99997547333788886034689987506999999987605898545367787564104688989864647665455403


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             57788644455210014577667640223133667321798656554432120798998753067763001566888999
Q gi|254780286|r  168 NGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIAS  247 (410)
Q Consensus       168 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~slEa~iveaADDIAY~~hDlEDai~~gli~~~~l~~~~~~~~~~~~  247 (410)
                      ||+..+...                  ......+++|||||||||||||++||||||+++|+|+++++.+++++.....+
T Consensus       170 ~~~~~~~~~------------------~~~~~~~tlEaqIme~ADDIAY~~hDlEDai~~gli~~~~l~e~~l~~~~~~~  231 (376)
T 2dqb_A          170 EAAYSPGFK------------------PLYEGQGTLEAQVVDLSDAIAYAAHDLDDGFRAGLLHPEELKEVELLQALALE  231 (376)
T ss_dssp             CC-----------------------------CCSCHHHHHHHHHHHHHHHHHHHHHHHHTTCSCGGGGGGSHHHHHHHHH
T ss_pred             CCCCCCCHH------------------HHHHCCCCHHHHHHCCHHCCHHHCCCHHHHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             210042034------------------55533587789985541238553558888986699889998645899999998


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             88654889989999999999999999978886787787515454676442685211147035799999999999985178
Q gi|254780286|r  248 LHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRH  327 (410)
Q Consensus       248 ~~~~~~~~~~~~~~~~l~r~~I~~~i~d~i~~s~~~i~~~~~~~~~di~~~~~~li~fs~~~~~~~k~LK~~l~~~Vy~~  327 (410)
                      ......... ......+++.+++.+|.+++..+.+++........++++..+..++.+|+++....+.+|+|++++||+|
T Consensus       232 ~~~~~~~~~-~~~~~~~~~~~i~~~i~~~i~~~~~~~~~~~~~~~~~i~~~~~~l~~~s~~~~~~~~~lk~fl~~~vy~~  310 (376)
T 2dqb_A          232 EGLDLLRLP-ELDRRVLVRQLLGYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAALGEEAEKALKALKAFLMERFYRH  310 (376)
T ss_dssp             TTCCTTTCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSHHHHHHSSSCCCCCCHHHHHHHHHHHHHHHHHTTTS
T ss_pred             HHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCHHHHHCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             744010231-5677899999874799989999999999821302899972520444311100000347899999999489


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCHHHCCCCHHHHHHHCCCHHCCCEEEHHEECCCCHHHHHHHHHHHH
Q ss_conf             999999999999999999999878884574106776602580000103020006733699999999981
Q gi|254780286|r  328 PSIMTCCNQIANVIRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILF  396 (410)
Q Consensus       328 ~~v~~~e~~g~~iI~~Lf~~f~~~p~~l~~~~~~~~~~~~~~~~r~R~V~DYIAGMTD~YAi~ly~kL~  396 (410)
                      +.|+.++.+|++||..||+.|+++|+.||..|+..+    ++..+.|+||||||||||+||+++|++||
T Consensus       311 ~~v~~~e~~g~~iI~~Lf~~f~~~p~llp~~~~~~~----~~~~~~R~V~DYIAGMTD~yA~~ly~~L~  375 (376)
T 2dqb_A          311 PEVLRERRKAEAVLEGLFAAYTRYPELLPREVQAKI----PEEGLERAVCDYIAGMTDRFALEAYRRLS  375 (376)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHCGGGSCHHHHTTH----HHHCHHHHHHHHHHTCCHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCHHHCCHHHHHHC----CCCCHHHEEHHHHCCCHHHHHHHHHHHCC
T ss_conf             999999999999999999999859985999999646----66665623021021631779999999709



>3bg2_A DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217} Back     alignment and structure
>2pgs_A Putative deoxyguanosinetriphosphate triphosphohydrolase; deoxyguanosinetriphosphate triphsphohydrolase; 2.35A {Pseudomonas syringae PV} Back     alignment and structure
>2hek_A Hypothetical protein; predominantly alpha helical protein with GDP binding site and active site being FAR from EACH other, structural genomics; HET: GDP; 2.00A {Aquifex aeolicus} SCOP: a.211.1.1 Back     alignment and structure
>3irh_A HD domain protein; phosphohydrolase, dntpase, structural genomics, PSI-2, protein structure initiative; HET: DGT DTP; 2.40A {Enterococcus faecalis V583} PDB: 2o6i_A* Back     alignment and structure
>2q14_A Phosphohydrolase; BT4208, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE ADP; 2.20A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2o08_A BH1327 protein; putative HD superfamily hydrolase, structural genomics, JOIN for structural genomics, JCSG; HET: UNL PG4 DGI; 1.90A {Bacillus halodurans} Back     alignment and structure
>2ogi_A Hypothetical protein SAG1661; NP_688652.1, conserved hypothetical protein TIGR00488, structural genomics; HET: GDP MES; 1.85A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ccg_A HD superfamily hydrolase; NP_347894.1, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2pq7_A Predicted HD superfamily hydrolase; 104161995, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.45A {Uncultured thermotogales bacterium} SCOP: a.211.1.1 Back     alignment and structure
>3m1t_A Putative phosphohydrolase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE GOL; 1.62A {Shewanella amazonensis} Back     alignment and structure
>3hc1_A Uncharacterized HDOD domain protein; HDOD domain protein with unknown function, structural genomics; 1.90A {Geobacter sulfurreducens} Back     alignment and structure
>1taz_A Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B; PDE1B, hydrolase; HET: CME; 1.77A {Homo sapiens} SCOP: a.211.1.2 Back     alignment and structure
>3djb_A Hydrolase, HD family; all alpha-helical protein., structural genomics, PSI-2, protein structure initiative; 2.90A {Bacillus thuringiensis serovarkonkukian} SCOP: a.211.1.1 Back     alignment and structure
>3dto_A BH2835 protein; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Bacillus halodurans} SCOP: a.211.1.1 Back     alignment and structure
>3gw7_A Uncharacterized protein YEDJ; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Escherichia coli k-12} Back     alignment and structure
>3b57_A LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomics, PSI-2, protein structure initiative; 3.00A {Listeria innocua CLIP11262} SCOP: a.211.1.1 Back     alignment and structure
>2qgs_A Protein Se1688; alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Staphylococcus epidermidis atcc 12228} SCOP: a.211.1.1 Back     alignment and structure
>2pjq_A Uncharacterized protein LP_2664; LPR71, NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Lactobacillus plantarum WCFS1} SCOP: a.211.1.1 Back     alignment and structure
>3dyn_A High affinity CGMP-specific 3',5'-cyclic phosphodiesterase 9A; crystallography, phophodiestrase, enzyme mechanism, alternative splicing, hydrolase; HET: PCG IBM; 2.10A {Homo sapiens} SCOP: a.211.1.2 PDB: 3dyl_A* 3dy8_A* 3dyq_A* 3dys_A* 3jsi_A* 3jsw_A* 2yy2_A* 2hd1_A* 3k3e_A* 3k3h_A* Back     alignment and structure
>1tbf_A CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5A, hydrolase; HET: VIA; 1.30A {Homo sapiens} SCOP: a.211.1.2 PDB: 1t9s_A* 1xoz_A* 1xp0_A* 2chm_A* 3hc8_A* 3hdz_A* 1t9r_A* 3b2r_A* 2h44_A* 2h42_A* 2h40_A* 1rkp_A* 1udt_A* 1udu_A* 1uho_A* 3jwq_A* 3jwr_A* Back     alignment and structure
>1f0j_A PDE4B, phosphodiesterase 4B; PDE phosphodiesterase, hydrolase; 1.77A {Homo sapiens} SCOP: a.211.1.2 PDB: 1ro6_A* 1ro9_A* 1ror_A* 3hmv_A* 1tb5_A* 1xm6_A* 1xlx_A* 1xm4_A* 1xlz_A* 1xmu_A* 1xmy_A* 1xn0_A* 1xos_A* 1xot_B* 1y2h_A* 1y2j_A* 3kkt_A* 3g4i_A* 3g4k_A* 3g4l_A* ... Back     alignment and structure
>3itu_A CGMP-dependent 3',5'-cyclic phosphodiesterase; Zn-binding, all-alpha-helical, alternative splicing, hydrolase, membrane, polymorphism; HET: IBM; 1.58A {Homo sapiens} PDB: 3itm_A* 1z1l_A Back     alignment and structure
>3hr1_A CAMP and CAMP-inhibited CGMP 3',5'-cyclic phosphodiesterase 10A; PDE 10A, PDE10 inhibitors, allosteric enzyme, alternative splicing; HET: PF9; 1.53A {Rattus norvegicus} PDB: 3hqy_A* 3hqz_A* 3hqw_A* Back     alignment and structure
>2r8q_A Class I phosphodiesterase PDEB1; leishimaniasis, parasite inhibitor selectivity, CAMP phosphodiesterase, hydrolase; HET: IBM; 1.50A {Leishmania major} Back     alignment and structure
>3ecm_A High affinity CAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A...; phosphodiesterase 8A PDE8A inhibitor selectivity; 1.90A {Homo sapiens} PDB: 3ecn_A* Back     alignment and structure
>1y2k_A DPDE3, PDE43, CAMP-specific 3',5'-cyclic phosphodiesterase 4D; PDE4D, pyrazole, hydrolase; HET: 7DE; 1.36A {Homo sapiens} SCOP: a.211.1.2 PDB: 1xon_A* 1xoq_A* 1xom_A* 1xor_A* 1y2c_A* 1y2d_A* 1y2e_A* 1y2b_A* 3iak_A* 3k4s_A* 1tbb_A* 1tb7_A* 2fm0_A* 2fm5_A* 1oyn_A* 1ptw_A* 1q9m_A* 1zkn_A* 2qyn_A* 2pw3_A* ... Back     alignment and structure
>1zkl_A HCP1, TM22, high-affinity CAMP-specific 3',5'-cyclic phosphodiesterase 7A; PDE, hydrolase; HET: IBM; 1.67A {Homo sapiens} PDB: 3g3n_A* Back     alignment and structure
>3g4g_A DPDE3, PDE43, CAMP-specific 3',5'-cyclic phosphodiesterase 4D; PDE4D, UCR2, alternative splicing, cytoplasm, cytoskeleton, hydrolase, membrane; HET: D71; 2.30A {Homo sapiens} PDB: 3g45_A* Back     alignment and structure
>2cqz_A 177AA long hypothetical protein; hypothetical proteins, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.60A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3mem_A Putative signal transduction protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.25A {Marinobacter aquaeolei} Back     alignment and structure
>3kq5_A Hypothetical cytosolic protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Coxiella burnetii} Back     alignment and structure
>3ljx_A MMOQ response regulator; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Methylococcus capsulatus} PDB: 3ljv_A Back     alignment and structure
>3bjc_A CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5, erectIle dysfunction, inhibitor design, allosteric enzyme, alternative splicing, CGMP binding; HET: WAN; 2.00A {Homo sapiens} SCOP: a.211.1.2 PDB: 2k31_A* Back     alignment and structure
>3ibj_A CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE2A, GAF-domains, allosteric regulation hydrolase, membrane; 3.02A {Homo sapiens} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
d2heka1369 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquif 6e-19
d2o6ia1453 a.211.1.1 (A:1-453) Hypothetical protein EF1143 {Entero 5e-06
d3dtoa1212 a.211.1.1 (A:2-213) Uncharacterized protein BH2835 {Bac 3e-04
d2pq7a1217 a.211.1.1 (A:1-217) Predicted hydrolase mes0020 {Uncult 0.002
>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]} Length = 369 Back     information, alignment and structure

class: All alpha proteins
fold: HD-domain/PDEase-like
superfamily: HD-domain/PDEase-like
family: HD domain
domain: Hypothetical protein aq 1910
species: Aquifex aeolicus [TaxId: 63363]
 Score = 89.2 bits (220), Expect = 6e-19
 Identities = 37/158 (23%), Positives = 60/158 (37%), Gaps = 3/158 (1%)

Query: 39  EFQRDRDRMIHTTAFRRLKDKTQVFFHRQ--RDHYRTRLMHTIEVSQIARSLARALRIDE 96
                  R+I +  F+RL+   Q+            TR  H++ V  I   +  +L++ E
Sbjct: 14  RVGEAGLRLIDSFPFQRLRYVKQLGLAYLVFPSAQHTRFEHSLGVYHITERICESLKVKE 73

Query: 97  -DLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGIN 155
            +LV+   L HD GHPPF H  E +L    S     +  I+   I   L+  Y+  D   
Sbjct: 74  KELVKLAGLLHDLGHPPFSHTTEVLLPRERSHEDFTERVIKETEIYEILKQDYSHEDIER 133

Query: 156 LTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIH 193
           L   TL         +L + +       R+       +
Sbjct: 134 LVRITLGKPEDEEEKLLSEIITGEFGSDRMDYLRRDAY 171


>d2o6ia1 a.211.1.1 (A:1-453) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]} Length = 453 Back     information, alignment and structure
>d3dtoa1 a.211.1.1 (A:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]} Length = 212 Back     information, alignment and structure
>d2pq7a1 a.211.1.1 (A:1-217) Predicted hydrolase mes0020 {Uncultured thermotogales bacterium [TaxId: 221214]} Length = 217 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
d2heka1369 Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 100.0
d2o6ia1453 Hypothetical protein EF1143 {Enterococcus faecalis [Tax 99.63
d2pq7a1217 Predicted hydrolase mes0020 {Uncultured thermotogales b 97.82
d3dtoa1212 Uncharacterized protein BH2835 {Bacillus halodurans [Ta 97.63
d1taza_357 Catalytic domain of cyclic nucleotide phosphodiesterase 90.63
d2qgsa1216 Uncharacterized protein SE1688 {Staphylococcus epidermi 97.4
d3b57a1201 Uncharacterized protein Lin1889 {Listeria innocua [TaxI 97.31
d3djba1213 Uncharacterized protein BT9727_1981 {Bacillus thuringie 97.28
d2pjqa1215 Uncharacterized protein LP2664 {Lactobacillus plantarum 97.28
d3dy8a1324 High-affinity cGMP-specific 3',5'-cyclic phosphodiester 93.49
d1tbfa_326 cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibm 93.15
d1y2ka1326 Catalytic domain of cyclic nucleotide phosphodiesterase 92.06
d1xx7a_172 Oxetanocin-like protein PF0395 {Pyrococcus furiosus [Ta 91.08
>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
class: All alpha proteins
fold: HD-domain/PDEase-like
superfamily: HD-domain/PDEase-like
family: HD domain
domain: Hypothetical protein aq 1910
species: Aquifex aeolicus [TaxId: 63363]
Probab=100.00  E-value=1.3e-35  Score=279.52  Aligned_cols=111  Identities=28%  Similarity=0.405  Sum_probs=102.5

Q ss_pred             HHHCCCCEEECCHHHHHHCCCCEEEECCCC--CCCCCCHHHHHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHCCCCCCCC
Q ss_conf             434000011027346232757478716999--8706620888999999999998839998-8999999888628998865
Q gi|254780286|r   39 EFQRDRDRMIHTTAFRRLKDKTQVFFHRQR--DHYRTRLMHTIEVSQIARSLARALRIDE-DLVEAIALAHDFGHPPFGH  115 (410)
Q Consensus        39 ~f~rD~dRIi~S~afRRL~~KTQVf~~~~~--d~~rtRLtHslEVa~i~rsi~~~l~~~~-dlvea~~L~HDiGhpPFGH  115 (410)
                      ++..+..|||+|++||||++||||+|+...  +.+||||||||||+|+||++|+.|+.+. ++|++|||+||||||||||
T Consensus        14 ~~~~~~~rii~s~~fqRL~~~~Ql~~~~~v~p~a~htR~~HSLgV~~lar~l~~~l~~~~~~~v~~A~LlHDiGh~PFsH   93 (369)
T d2heka1          14 RVGEAGLRLIDSFPFQRLRYVKQLGLAYLVFPSAQHTRFEHSLGVYHITERICESLKVKEKELVKLAGLLHDLGHPPFSH   93 (369)
T ss_dssp             EEEHHHHHHHTSHHHHGGGGSBTTTTGGGTSTTCCCBHHHHHHHHHHHHHHHHHHHTCTTHHHHHHHHHTTTTTCCSSSS
T ss_pred             ECCHHHHHHHCCHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCHHHH
T ss_conf             64889999829976703457734785523389995662119989999999999997433288999999986026502220


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCC
Q ss_conf             4789999997312554577657788754321146
Q gi|254780286|r  116 VGEDVLQELLSSYGGFDHNIQSFRIVTELECSYA  149 (410)
Q Consensus       116 ~GE~al~~~~~~~~gFegNaQ~~Rilt~LE~~~~  149 (410)
                      +||++++.|+...++|+++.++.++...++..+.
T Consensus        94 ~gE~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  127 (369)
T d2heka1          94 TTEVLLPRERSHEDFTERVIKETEIYEILKQDYS  127 (369)
T ss_dssp             CHHHHSTTSSSCCCHHHHHHHHSHHHHHHHTTSC
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             4666620345520468998740179999998521



>d2o6ia1 a.211.1.1 (A:1-453) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2pq7a1 a.211.1.1 (A:1-217) Predicted hydrolase mes0020 {Uncultured thermotogales bacterium [TaxId: 221214]} Back     information, alignment and structure
>d3dtoa1 a.211.1.1 (A:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1taza_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 1b, PDE1B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qgsa1 a.211.1.1 (A:1-216) Uncharacterized protein SE1688 {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure
>d3b57a1 a.211.1.1 (A:1-201) Uncharacterized protein Lin1889 {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d3djba1 a.211.1.1 (A:2-214) Uncharacterized protein BT9727_1981 {Bacillus thuringiensis [TaxId: 1428]} Back     information, alignment and structure
>d2pjqa1 a.211.1.1 (A:1-215) Uncharacterized protein LP2664 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d3dy8a1 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbfa_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y2ka1 a.211.1.2 (A:86-411) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx7a_ a.211.1.1 (A:) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 410 deoxyguanosinetriphosphate triphosphohydrolase-lik
2dqb_A_27-308282 (A:27-308) Deoxyguanosinetriphosphate triphosphohy 1e-39
3bg2_A_1-119_180-360300 (A:1-119,A:180-360) DGTP triphosphohydrolase; stru 1e-29
3irh_A_1-247247 (A:1-247) HD domain protein; phosphohydrolase, dnt 2e-37
2q14_A_1-190190 (A:1-190) Phosphohydrolase; BT4208, HD domain, str 9e-28
2hek_A_1-221221 (A:1-221) Hypothetical protein; predominantly alph 6e-35
3ccg_A_1-135135 (A:1-135) HD superfamily hydrolase; NP_347894.1, H 2e-07
2pjq_A_231 (A:) Uncharacterized protein LP_2664; LPR71, NESG, 2e-23
2pq7_A_220 (A:) Predicted HD superfamily hydrolase; 104161995 4e-14
3hc1_A_1-25_111-305220 (A:1-25,A:111-305) Uncharacterized HDOD domain pro 5e-11
2pgs_A_1-113_229-354239 (A:1-113,A:229-354) Putative deoxyguanosinetriphos 2e-21
2pgs_A_1-113_229-354239 (A:1-113,A:229-354) Putative deoxyguanosinetriphos 3e-18
2pgs_A_114-228_355-451212 (A:114-228,A:355-451) Putative deoxyguanosinetriph 6e-18
2dqb_A_309-37668 (A:309-376) Deoxyguanosinetriphosphate triphosphoh 4e-13
3bg2_A_120-179_361-444144 (A:120-179,A:361-444) DGTP triphosphohydrolase; st 9e-12
2qgs_A_1-128128 (A:1-128) Protein Se1688; alpha-helical protein, s 5e-12
3dto_A_1-126126 (A:1-126) BH2835 protein; all alpha-helical protei 9e-12
3djb_A_1-126126 (A:1-126) Hydrolase, HD family; all alpha-helical 2e-10
2o08_A_1-134134 (A:1-134) BH1327 protein; NP_242193.1, hypothetica 2e-09
3b57_A_209 (A:) LIN1889 protein; Q92AN1, X-RAY, NESG, structu 4e-09
3gw7_A_1-131131 (A:1-131) Uncharacterized protein YEDJ; all alpha- 6e-07
3bg2_A_120-179_361-444144 (A:120-179,A:361-444) DGTP triphosphohydrolase; st 2e-07
2ogi_A_1-159159 (A:1-159) Hypothetical protein SAG1661; NP_688652. 9e-10
>2dqb_A (A:27-308) Deoxyguanosinetriphosphate triphosphohydrolase, putative; dntpase, DNTP, single-stranded DNA, DNA, dGTPase, HD superfamily; 2.20A {Thermus thermophilus HB8}Length = 282 Back     alignment and structure
 Score =  158 bits (400), Expect = 1e-39
 Identities = 122/300 (40%), Positives = 166/300 (55%), Gaps = 19/300 (6%)

Query: 26  GRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIA 85
           GR +PE  SL R+ +Q+DRDR++HTTAFRRL+ KTQV      D+YRTRL HT+EV+Q++
Sbjct: 2   GRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQVLPGWAGDYYRTRLTHTLEVAQVS 61

Query: 86  RSLARALRIDEDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELE 145
           RS+ARAL ++EDL EAIAL+HD GHPPFGH GE VL  L   +GGF+HN Q+ RI+T LE
Sbjct: 62  RSIARALGLNEDLTEAIALSHDLGHPPFGHTGEHVLNALXQDHGGFEHNAQALRILTHLE 121

Query: 146 CSYADFDGINLTWETLEGLIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEG 205
             Y  F G+NLT+E LEG+  H                     Y            +LE 
Sbjct: 122 VRYPGFRGLNLTYEVLEGIATHEAA------------------YSPGFKPLYEGQGTLEA 163

Query: 206 QVAAIADDIAYDAHDIDDGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELV 265
           QV  ++D IAY AHD+DDG RAGLL  + LKE+  L+            L +      LV
Sbjct: 164 QVVDLSDAIAYAAHDLDDGFRAGLLHPEELKEVELLQALALEEGLDLLRLPELDR-RVLV 222

Query: 266 RRQITAMVEDVITVSQKRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVY 325
           R+ +   +   I  + +R+      +   +R    R+    +E     K +K+ L +  Y
Sbjct: 223 RQLLGYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAALGEEAEKALKALKAFLXERFY 282


>3bg2_A (A:1-119,A:180-360) DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217}Length = 300 Back     alignment and structure
>3irh_A (A:1-247) HD domain protein; phosphohydrolase, dntpase, structural genomics, PSI-2, protein structure initiative; HET: DGT DTP; 2.40A {Enterococcus faecalis V583} PDB: 2o6i_A*Length = 247 Back     alignment and structure
>2q14_A (A:1-190) Phosphohydrolase; BT4208, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE ADP; 2.20A {Bacteroides thetaiotaomicron vpi-5482}Length = 190 Back     alignment and structure
>2hek_A (A:1-221) Hypothetical protein; predominantly alpha helical protein with GDP binding site and active site being FAR from EACH other, structural genomics; HET: GDP; 2.00A {Aquifex aeolicus}Length = 221 Back     alignment and structure
>3ccg_A (A:1-135) HD superfamily hydrolase; NP_347894.1, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Clostridium acetobutylicum atcc 824}Length = 135 Back     alignment and structure
>2pjq_A (A:) Uncharacterized protein LP_2664; LPR71, NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Lactobacillus plantarum WCFS1}Length = 231 Back     alignment and structure
>2pq7_A (A:) Predicted HD superfamily hydrolase; 104161995, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.45A {Uncultured thermotogales bacterium}Length = 220 Back     alignment and structure
>3hc1_A (A:1-25,A:111-305) Uncharacterized HDOD domain protein; HDOD domain protein with unknown function, structural genomics; 1.90A {Geobacter sulfurreducens}Length = 220 Back     alignment and structure
>2pgs_A (A:1-113,A:229-354) Putative deoxyguanosinetriphosphate triphosphohydrolase; deoxyguanosinetriphosphate triphsphohydrolase; 2.35A {Pseudomonas syringae PV}Length = 239 Back     alignment and structure
>2pgs_A (A:1-113,A:229-354) Putative deoxyguanosinetriphosphate triphosphohydrolase; deoxyguanosinetriphosphate triphsphohydrolase; 2.35A {Pseudomonas syringae PV}Length = 239 Back     alignment and structure
>2pgs_A (A:114-228,A:355-451) Putative deoxyguanosinetriphosphate triphosphohydrolase; deoxyguanosinetriphosphate triphsphohydrolase; 2.35A {Pseudomonas syringae PV}Length = 212 Back     alignment and structure
>2dqb_A (A:309-376) Deoxyguanosinetriphosphate triphosphohydrolase, putative; dntpase, DNTP, single-stranded DNA, DNA, dGTPase, HD superfamily; 2.20A {Thermus thermophilus HB8}Length = 68 Back     alignment and structure
>3bg2_A (A:120-179,A:361-444) DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217}Length = 144 Back     alignment and structure
>2qgs_A (A:1-128) Protein Se1688; alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Staphylococcus epidermidis atcc 12228}Length = 128 Back     alignment and structure
>3dto_A (A:1-126) BH2835 protein; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Bacillus halodurans}Length = 126 Back     alignment and structure
>3djb_A (A:1-126) Hydrolase, HD family; all alpha-helical protein., structural genomics, PSI-2, protein structure initiative; 2.90A {Bacillus thuringiensis serovarkonkukian}Length = 126 Back     alignment and structure
>2o08_A (A:1-134) BH1327 protein; NP_242193.1, hypothetical protein, structural genomics, joint center for structural genomics, JCSG, PSI-2; HET: UNL PG4 DGI; 1.90A {Bacillus halodurans}Length = 134 Back     alignment and structure
>3b57_A (A:) LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomics, PSI-2, protein structure initiative; 3.00A {Listeria innocua CLIP11262}Length = 209 Back     alignment and structure
>3gw7_A (A:1-131) Uncharacterized protein YEDJ; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Escherichia coli k-12}Length = 131 Back     alignment and structure
>3bg2_A (A:120-179,A:361-444) DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217}Length = 144 Back     alignment and structure
>2ogi_A (A:1-159) Hypothetical protein SAG1661; NP_688652.1, conserved hypothetical protein TIGR00488, structural genomics; HET: GDP MES; 1.85A {Streptococcus agalactiae serogroup V}Length = 159 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target410 deoxyguanosinetriphosphate triphosphohydrolase-like pro
3bg2_A_1-119_180-360300 DGTP triphosphohydrolase; structural genomics, NYS 100.0
2pgs_A_1-113_229-354239 Putative deoxyguanosinetriphosphate triphosphohydr 100.0
2dqb_A_27-308282 Deoxyguanosinetriphosphate triphosphohydrolase, pu 100.0
2pgs_A_114-228_355-451212 Putative deoxyguanosinetriphosphate triphosphohydr 100.0
3irh_A_1-247247 HD domain protein; phosphohydrolase, dntpase, stru 100.0
2hek_A_1-221221 Hypothetical protein; predominantly alpha helical 99.97
2pjq_A_231 Uncharacterized protein LP_2664; LPR71, NESG, stru 99.84
2pq7_A_220 Predicted HD superfamily hydrolase; 104161995, HD 99.06
3dto_A_1-126126 BH2835 protein; all alpha-helical protein, structu 98.68
3i7a_A_1-23_106-281199 Putative metal-dependent phosphohydrolase; YP_9268 97.49
3bg2_A_120-179_361-444144 DGTP triphosphohydrolase; structural genomics, NYS 99.96
2dqb_A_309-37668 Deoxyguanosinetriphosphate triphosphohydrolase, pu 99.58
2q14_A_1-190190 Phosphohydrolase; BT4208, HD domain, structural ge 99.91
2o08_A_1-134134 BH1327 protein; NP_242193.1, hypothetical protein, 98.74
3b57_A_209 LIN1889 protein; Q92AN1, X-RAY, NESG, structural g 98.59
3gw7_A_1-131131 Uncharacterized protein YEDJ; all alpha-helical pr 98.54
2ogi_A_1-159159 Hypothetical protein SAG1661; NP_688652.1, conserv 98.44
3ccg_A_1-135135 HD superfamily hydrolase; NP_347894.1, HD domain, 98.29
3hc1_A_1-25_111-305220 Uncharacterized HDOD domain protein; HDOD domain p 97.35
1u6z_A_313-451139 Exopolyphosphatase; alpha/beta protein, askha (ace 93.74
2qgs_A_1-128128 Protein Se1688; alpha-helical protein, structural 98.54
3djb_A_1-126126 Hydrolase, HD family; all alpha-helical protein., 98.43
2paq_A_201 5'-deoxynucleotidase YFBR; HD domain phosphohydrol 96.32
1vqr_A_297 Hypothetical protein CJ0248; 6967725, structural g 95.41
3kh1_A_23-200178 Predicted metal-dependent phosphohydrolase; struct 95.38
1taz_A_1-233233 Calcium/calmodulin-dependent 3',5'-cyclic nucleoti 92.92
3hr1_A_66-221156 CAMP and CAMP-inhibited CGMP 3',5'-cyclic phosphod 92.9
3dyn_A_1-232232 High affinity CGMP-specific 3',5'-cyclic phosphodi 92.84
3ljx_A_98-143_195-288140 MMOQ response regulator; structural genomics, PSI- 92.61
3itu_A_1-238238 CGMP-dependent 3',5'-cyclic phosphodiesterase; Zn- 92.53
1xx7_A_29-184156 Oxetanocin-like protein; PSI, secsg, protein struc 92.07
2our_A_1-190190 CAMP and CAMP-inhibited CGMP 3',5'-cyclic phosphod 91.71
3g4g_A_1-324324 DPDE3, PDE43, CAMP-specific 3',5'-cyclic phosphodi 91.65
1tbf_A_1-257257 CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5 91.58
1y2k_A_1-258258 DPDE3, PDE43, CAMP-specific 3',5'-cyclic phosphodi 91.57
1f0j_A_1-245245 PDE4B, phosphodiesterase 4B; PDE phosphodiesterase 90.56
3ibj_A_348-599252 CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE 93.06
>3bg2_A (A:1-119,A:180-360) DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217} Back     alignment and structure
Probab=100.00  E-value=0  Score=399.39  Aligned_cols=258  Identities=26%  Similarity=0.344  Sum_probs=197.8

Q ss_pred             CCCCCCCCCHHHCCCCCCCCCCCCCCCHHHCCCCEEECCHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             46585438703337734778889999843400001102734623275747871699987066208889999999999988
Q gi|254780286|r   12 QKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRDRMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARA   91 (410)
Q Consensus        12 ~~~~~~a~~~~~~~gR~~~e~~~~~R~~f~rD~dRIi~S~afRRL~~KTQVf~~~~~d~~rtRLtHslEVa~i~rsi~~~   91 (410)
                      +|..++++.+..+.++......+..|.+|++|++|||+|++||||++||||||+..+|++|||+||||||+++||+|++.
T Consensus         3 ~~~~~~~~~~~~~~~~i~d~v~~~i~~~~~~d~~rii~s~~fqRL~~~~Ql~~~~~~~a~htR~~HSlgV~~la~~~~~~   82 (300)
T 3bg2_A            3 NWEHLLSLKRQGDTAKRLRIEQDDTRLGFEVDYDRIIFSAPFRSLQDKTQVIPLSKTDFVHTRLTHSLEVSVVGRSLGRM   82 (300)
T ss_dssp             CHHHHTCCCCTTCSSCCCGGGCCGGGCHHHHHHHHHHHSHHHHHGGGCBCSCC---CCCCCBHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHCHHHCCCCCCCCCCCCCCCCCCHHHCCCHHHCCHHHHHCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             66665061114676577788889989806423118765897762657772514799987717304999999999999999


Q ss_pred             CCCC-------------------HHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             3999-------------------889999998886289988654789999997312554577657788754321146701
Q gi|254780286|r   92 LRID-------------------EDLVEAIALAHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFD  152 (410)
Q Consensus        92 l~~~-------------------~dlvea~~L~HDiGhpPFGH~GE~al~~~~~~~~gFegNaQ~~Rilt~LE~~~~~~~  152 (410)
                      ++.+                   .++|++|||+||||                                           
T Consensus        83 l~~~~~~~~~~~~~~~~~~~~~~~~~v~~A~L~HDiG-------------------------------------------  119 (300)
T 3bg2_A           83 VGKKLLEKYPHLEQVYGYKFNDFGAIVAAAALAHDIG-------------------------------------------  119 (300)
T ss_dssp             HHHHHHHHSTHHHHTTCCCHHHHHHHHHHHHHHTTTT-------------------------------------------
T ss_pred             HHHHHHHHCCCHHHHCCCCCCCHHHHHHHHHCCCCCC-------------------------------------------
T ss_conf             9999988471123212222343588998850155458-------------------------------------------


Q ss_pred             CCCHHHHHHHHHHCCCCCCCCCCCC------CCCCCH---HHHHHHHHHHCCC-------CCCCCCHHHHHHHHHHHHHH
Q ss_conf             0002478887763475778864445------521001---4577667640223-------13366732179865655443
Q gi|254780286|r  153 GINLTWETLEGLIGHNGPILPQDLD------KPRIIP---RIFSDYYHIHGLS-------LANFASLEGQVAAIADDIAY  216 (410)
Q Consensus       153 GLNLT~atL~~iiKyp~~~~~~~~~------~~~~~~---~~~~~~~~~~~~~-------~~~~~slEa~iveaADDIAY  216 (410)
                        |||||||+|++||||++...+..      |++.+.   ..+.......++.       ....+++++|||||||||||
T Consensus       120 --NLT~atL~ailKYP~~~~~~~~~~~~~~~K~G~f~sE~~~~~~i~~~~gl~~~~~~~~~~~~Rhpl~~iMEaADDIaY  197 (300)
T 3bg2_A          120 --RLSYATLGAFMKYPKESLPHKPSDHIADKKYGFFQSERALFEDVAQELGLLKRSTTDDVSWSRHPLAYLVEAADDICY  197 (300)
T ss_dssp             --CCCHHHHHHHCSSCBCCC-----------CCSCCGGGHHHHHHHHHHHTCCBC----CCBBCCCTTHHHHHHHHHHHH
T ss_pred             --HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             --556999999996486546677655433122465465789988688652032045222335578919999998775511


Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHH--HHHHHCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHH
Q ss_conf             212079899875306776300156688899--9886548-8998999999999999999997888678778751545467
Q gi|254780286|r  217 DAHDIDDGVRAGLLTVDMLKEISFLEKHIA--SLHDLYG-HLDDKRLVHELVRRQITAMVEDVITVSQKRIAHLKPHAIH  293 (410)
Q Consensus       217 ~~hDlEDai~~gli~~~~l~~~~~~~~~~~--~~~~~~~-~~~~~~~~~~l~r~~I~~~i~d~i~~s~~~i~~~~~~~~~  293 (410)
                      ++||||||+++|+|+++++.+.  +.....  ....... ..+.......++...|+.+|+.++..+..+...       
T Consensus       198 ~i~DLEDai~~glit~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~R~~~i~~lv~~~~~~F~~~~~~-------  268 (300)
T 3bg2_A          198 TIIDFEDGINLGLIPEEYALEY--MVKLVGQTIDRNKYNALQETSDRVSYLRALAIGTLINESVDTFMKYEEE-------  268 (300)
T ss_dssp             HHHHHHHHHHHSSSCC---------------------CCSCCSHHHHHHHHHHHHHHHHHHHHHHHHHHSHHH-------
T ss_pred             CCEEHHHHHHHCCCCHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------
T ss_conf             0311876665033789999988--9998755556766520014999999899999999999999999996898-------


Q ss_pred             HHHHC--CCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             64426--852111470357999999999999851
Q gi|254780286|r  294 DIRSA--GYRIIDFSDEMTLVDKEIKSMLVKYVY  325 (410)
Q Consensus       294 di~~~--~~~li~fs~~~~~~~k~LK~~l~~~Vy  325 (410)
                       +..+  +..|+.. .+....++.||++++++||
T Consensus       269 -i~~g~~~~~Ll~~-~~~~~~l~~lK~~a~~~Iy  300 (300)
T 3bg2_A          269 -ILAGTFDQSLIDK-SNYQAQITDIINLSIERIY  300 (300)
T ss_dssp             -HHHTCCCSCTGGG-CTTHHHHHHHHHHHHHHTT
T ss_pred             -HHCCCCCCCCCCC-HHHHHHHHHHHHHHHHHCC
T ss_conf             -8525666664477-7999999999999999801



>2pgs_A (A:1-113,A:229-354) Putative deoxyguanosinetriphosphate triphosphohydrolase; deoxyguanosinetriphosphate triphsphohydrolase; 2.35A {Pseudomonas syringae PV} Back     alignment and structure
>2dqb_A (A:27-308) Deoxyguanosinetriphosphate triphosphohydrolase, putative; dntpase, DNTP, single-stranded DNA, DNA, dGTPase, HD superfamily; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>2pgs_A (A:114-228,A:355-451) Putative deoxyguanosinetriphosphate triphosphohydrolase; deoxyguanosinetriphosphate triphsphohydrolase; 2.35A {Pseudomonas syringae PV} Back     alignment and structure
>3irh_A (A:1-247) HD domain protein; phosphohydrolase, dntpase, structural genomics, PSI-2, protein structure initiative; HET: DGT DTP; 2.40A {Enterococcus faecalis V583} PDB: 2o6i_A* Back     alignment and structure
>2hek_A (A:1-221) Hypothetical protein; predominantly alpha helical protein with GDP binding site and active site being FAR from EACH other, structural genomics; HET: GDP; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2pjq_A (A:) Uncharacterized protein LP_2664; LPR71, NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2pq7_A (A:) Predicted HD superfamily hydrolase; 104161995, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.45A {Uncultured thermotogales bacterium} Back     alignment and structure
>3dto_A (A:1-126) BH2835 protein; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Bacillus halodurans} Back     alignment and structure
>3i7a_A (A:1-23,A:106-281) Putative metal-dependent phosphohydrolase; YP_926882.1, structural genomics, joint center for structural genomics, JCSG; 2.06A {Shewanella amazonensis SB2B} Back     alignment and structure
>3bg2_A (A:120-179,A:361-444) DGTP triphosphohydrolase; structural genomics, NYSGXRC, target 10395N, PSI-2, protein structure initiative; 1.95A {Leeuwenhoekiella blandensis MED217} Back     alignment and structure
>2dqb_A (A:309-376) Deoxyguanosinetriphosphate triphosphohydrolase, putative; dntpase, DNTP, single-stranded DNA, DNA, dGTPase, HD superfamily; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>2q14_A (A:1-190) Phosphohydrolase; BT4208, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE ADP; 2.20A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2o08_A (A:1-134) BH1327 protein; NP_242193.1, hypothetical protein, structural genomics, joint center for structural genomics, JCSG, PSI-2; HET: UNL PG4 DGI; 1.90A {Bacillus halodurans} Back     alignment and structure
>3b57_A (A:) LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomics, PSI-2, protein structure initiative; 3.00A {Listeria innocua CLIP11262} Back     alignment and structure
>3gw7_A (A:1-131) Uncharacterized protein YEDJ; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Escherichia coli k-12} Back     alignment and structure
>2ogi_A (A:1-159) Hypothetical protein SAG1661; NP_688652.1, conserved hypothetical protein TIGR00488, structural genomics; HET: GDP MES; 1.85A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ccg_A (A:1-135) HD superfamily hydrolase; NP_347894.1, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3hc1_A (A:1-25,A:111-305) Uncharacterized HDOD domain protein; HDOD domain protein with unknown function, structural genomics; 1.90A {Geobacter sulfurreducens} Back     alignment and structure
>1u6z_A (A:313-451) Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, actin) superfamily; 1.90A {Escherichia coli} Back     alignment and structure
>2qgs_A (A:1-128) Protein Se1688; alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3djb_A (A:1-126) Hydrolase, HD family; all alpha-helical protein., structural genomics, PSI-2, protein structure initiative; 2.90A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2paq_A (A:) 5'-deoxynucleotidase YFBR; HD domain phosphohydrolase, structural genomics, PSI, protein structure initiative; 2.10A {Escherichia coli K12} Back     alignment and structure
>1vqr_A (A:) Hypothetical protein CJ0248; 6967725, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.25A {Campylobacter jejuni subsp} Back     alignment and structure
>3kh1_A (A:23-200) Predicted metal-dependent phosphohydrolase; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.37A {Magnetospirillum magnetotacticum ms-1} Back     alignment and structure
>1taz_A (A:1-233) Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B; PDE1B, hydrolase; HET: CME; 1.77A {Homo sapiens} Back     alignment and structure
>3hr1_A (A:66-221) CAMP and CAMP-inhibited CGMP 3',5'-cyclic phosphodiesterase 10A; PDE 10A, PDE10 inhibitors, allosteric enzyme, alternative splicing; HET: PF9; 1.53A {Rattus norvegicus} PDB: 3hqy_A* 3hqz_A* 3hqw_A* Back     alignment and structure
>3dyn_A (A:1-232) High affinity CGMP-specific 3',5'-cyclic phosphodiesterase 9A; crystallography, phophodiestrase, enzyme mechanism, alternative splicing, hydrolase; HET: PCG IBM; 2.10A {Homo sapiens} Back     alignment and structure
>3ljx_A (A:98-143,A:195-288) MMOQ response regulator; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Methylococcus capsulatus} Back     alignment and structure
>3itu_A (A:1-238) CGMP-dependent 3',5'-cyclic phosphodiesterase; Zn-binding, all-alpha-helical, alternative splicing, hydrolase, membrane, polymorphism; HET: IBM; 1.58A {Homo sapiens} PDB: 3itm_A* 1z1l_A Back     alignment and structure
>1xx7_A (A:29-184) Oxetanocin-like protein; PSI, secsg, protein structure initiative, southeast collaboratory for structural genomics; 2.26A {Pyrococcus furiosus} Back     alignment and structure
>2our_A (A:1-190) CAMP and CAMP-inhibited CGMP 3',5'-cyclic phosphodiesterase 10A; PDE10, substrate specificity, hydrolase; HET: CMP; 1.45A {Homo sapiens} PDB: 2ous_A 2ouu_A* 2wey_A* 2oun_A* 2oup_A 2ouq_A* 2ouv_A 2ouy_A* 2o8h_A* 2ovv_A* 2ovy_A* Back     alignment and structure
>3g4g_A (A:1-324) DPDE3, PDE43, CAMP-specific 3',5'-cyclic phosphodiesterase 4D; PDE4D, UCR2, alternative splicing, cytoplasm, cytoskeleton, hydrolase, membrane; HET: D71; 2.30A {Homo sapiens} PDB: 3g45_A* Back     alignment and structure