254780290

254780290

quinone oxidoreductase

GeneID in NCBI database:8209272Locus tag:CLIBASIA_00875
Protein GI in NCBI database:254780290Protein Accession:YP_003064703.1
Gene range:+(180474, 181472)Protein Length:332aa
Gene description:quinone oxidoreductase
COG prediction:[C] [R] NADPH:quinone reductase and related Zn-dependent oxidoreductases
KEGG prediction:quinone oxidoreductase
SEED prediction:Quinone oxidoreductase (EC 1.6.5.5)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP
cccccHHEEEEEEccccccEEEEEEEccccccccEEEEEEEEEEEcHHHHHHHcccccccccccccccccEEEEEEEEcccccccccccEEEEEEcccccEEEEEccHHHEEEccccccHHHHHcccHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEEEEcccccHHHHHHHHccccccEEEEEcccHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHcccEEEEEEcccHHHHcHHHHHHHHHHHHHHHHHcccccEEEEEEEEHHHHHHHHHHHHccccccEEEEEc
cccccccEEEEEEccccccEEEEccccccccccccEEEEEEEcccccHHHHHHccccccccccccccccEEcEEEEEccccccccccccEEEEEEcccccEEEEEcccHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHcccEEEEcccccHHHHHHHHHccccEEEEEEcccHHHHHHHHccEEEEEEEEEEEEccccccccccHHHHHHHHcEEEccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEEcc
MPICKKMRHVAmsgygksnvmflaespipqpqkeEILIKVEAigvnrpdvmqrkglypppknanpilglEVAGKIvdlgentthwnigdEVCALVngggyaeyclshqghtlpipkgynaiqaaslpesFFTVWANLFQTANLRSGQTVLihggssgigTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLggniateinlnpiiskrititgstlrrrTDIAKQSIRDSLQLKiwpllnshviapvihtvlplgkvamAHDIMEKSEHIGKIILLP
MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNiateinlnpiiskrititgstlrrrtDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKsehigkiillp
MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP
****KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP
MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP
*PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP
MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP
MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target332 quinone oxidoreductase [Candidatus Liberibacter asiatic
222147871389 quinone oxidoreductase [Agrobacterium vitis S4] Length 1 1e-115
159184482327 quinone oxidoreductase [Agrobacterium tumefaciens str. 1 1e-113
325292203337 quinone oxidoreductase [Agrobacterium sp. H13-3] Length 1 1e-113
327194323331 putative quinone oxidoreductase protein [Rhizobium etli 1 1e-111
190890842331 quinone oxidoreductase [Rhizobium etli CIAT 652] Length 1 1e-110
209548385338 NAD(P)H quinone oxidoreductase, PIG3 family [Rhizobium 1 1e-110
116251043332 quinone oxidoreductase [Rhizobium leguminosarum bv. vic 1 1e-109
218462610331 quinone oxidoreductase protein [Rhizobium etli Kim 5] L 1 1e-109
222085211332 quinone oxidoreductase protein [Agrobacterium radiobact 1 1e-109
241203634332 NAD(P)H quinone oxidoreductase, PIG3 family [Rhizobium 1 1e-108
>gi|222147871|ref|YP_002548828.1| quinone oxidoreductase [Agrobacterium vitis S4] Length = 389 Back     alignment and organism information
 Score =  417 bits (1073), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/330 (59%), Positives = 247/330 (74%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   MR+V    +G   VM +A  P+P P   EIL+KVEA GVNRPDV QR+G YPPP
Sbjct: 58  MTLPTHMRYVDTPSFGGPEVMTIAHGPLPAPAAGEILVKVEAAGVNRPDVAQRQGSYPPP 117

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K A+P+LGLEVAG +V LGE  + + IGD+VC L NGGGYAE+C+  +G +LP P+G++A
Sbjct: 118 KGASPVLGLEVAGTVVALGEGVSDFAIGDKVCGLANGGGYAEFCILPEGQSLPWPRGFDA 177

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA++PE+FFTVWANLFQ A L  G+TVLIHGGSSGIGTTAIQLA  FGA V TT  S 
Sbjct: 178 VKAAAVPETFFTVWANLFQMAGLTEGETVLIHGGSSGIGTTAIQLARAFGADVLTTVGSA 237

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EK  ACLKLGA+ AINY  EDF E+++ ET G+G+DIILDM+GA Y  +++  L+K+G L
Sbjct: 238 EKAEACLKLGARRAINYRSEDFAEVVKAETDGKGVDIILDMIGASYFEKNIASLAKDGCL 297

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG +A ++NL PI+ KR+T+TGST+R RT   K++IRD L    WPLL    +A
Sbjct: 298 SIIAFLGGAVAEKVNLGPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLASAWPLLEQGTVA 357

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIHTVLP  KVA AH +ME S HIGKI+L
Sbjct: 358 PVIHTVLPFDKVADAHRLMEDSTHIGKIVL 387


Species: Agrobacterium vitis
Genus: Agrobacterium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184482|ref|NP_353846.2| quinone oxidoreductase [Agrobacterium tumefaciens str. C58] Length = 327 Back     alignment and organism information
>gi|325292203|ref|YP_004278067.1| quinone oxidoreductase [Agrobacterium sp. H13-3] Length = 337 Back     alignment and organism information
>gi|327194323|gb|EGE61184.1| putative quinone oxidoreductase protein [Rhizobium etli CNPAF512] Length = 331 Back     alignment and organism information
>gi|190890842|ref|YP_001977384.1| quinone oxidoreductase [Rhizobium etli CIAT 652] Length = 331 Back     alignment and organism information
>gi|209548385|ref|YP_002280302.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 338 Back     alignment and organism information
>gi|116251043|ref|YP_766881.1| quinone oxidoreductase [Rhizobium leguminosarum bv. viciae 3841] Length = 332 Back     alignment and organism information
>gi|218462610|ref|ZP_03502701.1| quinone oxidoreductase protein [Rhizobium etli Kim 5] Length = 331 Back     alignment and organism information
>gi|222085211|ref|YP_002543741.1| quinone oxidoreductase protein [Agrobacterium radiobacter K84] Length = 332 Back     alignment and organism information
>gi|241203634|ref|YP_002974730.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 332 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target332 quinone oxidoreductase [Candidatus Liberibacter asiatic
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxido 1e-135
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional 8e-92
COG0604326 COG0604, Qor, NADPH:quinone reductase and related Zn-de 3e-77
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 2e-67
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MD 2e-66
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reductase (M 9e-62
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dep 1e-58
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reductase (M 1e-57
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and quinone 2e-56
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 8e-54
KOG1198347 KOG1198, KOG1198, KOG1198, Zinc-binding oxidoreductase 2e-52
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reductase (M 1e-51
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reductase (M 5e-49
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide synth 7e-48
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reductase (M 2e-46
smart00829288 smart00829, PKS_ER, Enoylreductase 2e-46
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [Gen 2e-44
KOG1197336 KOG1197, KOG1197, KOG1197, Predicted quinone oxidoreduc 1e-43
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reductase (M 6e-42
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone oxidore 9e-42
cd08251303 cd08251, polyketide_synthase, polyketide synthase 6e-39
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reductase (M 8e-39
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR fam 2e-37
cd08248350 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 7e-35
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) 1e-33
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 2e-33
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1- 9e-31
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and 7e-29
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related Zn-de 4e-27
cd08252336 cd08252, AL_MDR, Arginate lyase and other MDR family me 7e-27
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-like 1e-26
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase; Pro 6e-26
KOG0023360 KOG0023, KOG0023, KOG0023, Alcohol dehydrogenase, class 1e-25
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenase 1e-24
cd05281341 cd05281, TDH, Threonine dehydrogenase 9e-21
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) 1e-19
cd08292324 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) 8e-19
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, cla 1e-18
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 3e-18
TIGR01751398 TIGR01751, crot-CoA-red, crotonyl-CoA reductase 5e-18
PRK05396341 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated 1e-16
cd08290341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 2e-15
KOG0025354 KOG0025, KOG0025, KOG0025, Zn2+-binding dehydrogenase ( 5e-13
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formaldehyde 5e-12
cd08256350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR fam 1e-11
KOG0022375 KOG0022, KOG0022, KOG0022, Alcohol dehydrogenase, class 5e-11
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR fam 5e-11
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and relat 3e-10
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 7e-09
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 1e-08
TIGR02818368 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione 2e-04
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducib 1e-144
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR 1e-47
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_like 3e-38
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR fa 5e-30
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase 2e-28
cd08296333 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD 1e-27
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR fam 2e-26
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR fam 5e-25
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogenase 1e-24
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR fam 1e-23
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 1e-23
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidoreductas 2e-23
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH-depen 2e-22
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MD 3e-22
cd08291324 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) 4e-20
cd08270305 cd08270, MDR4, Medium chain dehydrogenases/reductase (M 5e-20
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogenase 1e-19
cd08240350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate 8e-18
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol deh 3e-17
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogen 4e-17
KOG1196343 KOG1196, KOG1196, KOG1196, Predicted NAD-dependent oxid 2e-14
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-l 2e-14
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 re 1e-12
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 4e-12
KOG0024354 KOG0024, KOG0024, KOG0024, Sorbitol dehydrogenase [Seco 2e-10
cd08295338 cd08295, double_bond_reductase_like, Arabidopsis alkena 1e-09
PRK10083339 PRK10083, PRK10083, putative oxidoreductase; Provisiona 1e-09
PLN03154348 PLN03154, PLN03154, putative allyl alcohol dehydrogenas 1e-09
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenas 2e-09
TIGR02823323 TIGR02823, oxido_YhdH, putative quinone oxidoreductase, 4e-09
cd08294329 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunction 1e-08
cd08289326 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoredu 3e-08
PLN02514357 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase 1e-07
cd08242319 cd08242, MDR_like, Medium chain dehydrogenases/reductas 5e-07
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reductase (M 3e-44
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and other 4e-27
TIGR02817336 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenas 3e-22
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR fam 3e-19
cd08247352 cd08247, AST1_like, AST1 is a cytoplasmic protein assoc 2e-18
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR fam 1e-10
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative qui 2e-10
TIGR03451358 TIGR03451, mycoS_dep_FDH, mycothiol-dependent formaldeh 5e-09
cd08281371 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydr 2e-08
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogen 3e-08
TIGR03201349 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carb 4e-08
KOG1202 2376 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synth 1e-23
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyll 1e-10
cd08298329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) 3e-21
cd08246393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 5e-19
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/acetal 1e-09
cd08288324 cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductase 2e-05
TIGR02822329 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenas 2e-05
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 7e-20
cd08293345 cd08293, PTGR2, Prostaglandin reductase 1e-07
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like doma 2e-11
PLN02827378 PLN02827, PLN02827, Alcohol dehydrogenase-like 3e-04
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehydroge 0.002
TIGR02825325 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydroge 7e-08
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH 1e-06
PLN02178375 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase 4e-05
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Provisio 4e-04
KOG0725270 KOG0725, KOG0725, KOG0725, Reductases with broad range 0.003
>gnl|CDD|163034 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|30949 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|36412 KOG1198, KOG1198, KOG1198, Zinc-binding oxidoreductase [Energy production and conversion, General function prediction only] Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|129062 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|31264 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|36411 KOG1197, KOG1197, KOG1197, Predicted quinone oxidoreductase [Energy production and conversion, General function prediction only] Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|31263 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|35246 KOG0023, KOG0023, KOG0023, Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>gnl|CDD|31262 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|162516 TIGR01751, crot-CoA-red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|35248 KOG0025, KOG0025, KOG0025, Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription, Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|35245 KOG0022, KOG0022, KOG0022, Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|32313 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|36410 KOG1196, KOG1196, KOG1196, Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|35247 KOG0024, KOG0024, KOG0024, Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|176255 cd08295, double_bond_reductase_like, Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|178699 PLN03154, PLN03154, putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|163033 TIGR02823, oxido_YhdH, putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|163031 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|36416 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|176248 cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|143884 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176253 cd08293, PTGR2, Prostaglandin reductase Back     alignment and domain information
>gnl|CDD|149352 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|166468 PLN02827, PLN02827, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|131872 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|177834 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|180879 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|35944 KOG0725, KOG0725, KOG0725, Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 332 quinone oxidoreductase [Candidatus Liberibacter asiatic
TIGR02824334 quinone_pig3 putative NAD(P)H quinone oxidoreductase, P 100.0
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 100.0
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 100.0
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 100.0
PRK13771332 putative alcohol dehydrogenase; Provisional 100.0
PRK09422338 alcohol dehydrogenase; Provisional 100.0
KOG1197336 consensus 100.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 100.0
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 100.0
TIGR01751409 crot-CoA-red crotonyl-CoA reductase; InterPro: IPR01008 100.0
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 100.0
PRK10083339 putative dehydrogenase; Provisional 100.0
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 100.0
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 100.0
TIGR02823330 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP f 100.0
KOG0023360 consensus 100.0
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 100.0
PRK09880343 L-idonate 5-dehydrogenase; Provisional 100.0
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class III [En 100.0
KOG1198347 consensus 100.0
KOG0024354 consensus 100.0
KOG0025354 consensus 100.0
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 100.0
KOG0022375 consensus 100.0
COG2130340 Putative NADP-dependent oxidoreductases [General functi 100.0
KOG1202 2376 consensus 100.0
KOG1196343 consensus 100.0
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogena 99.97
TIGR01202325 bchC Chlorophyll synthesis pathway, bchC; InterPro: IPR 99.95
TIGR02825327 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo- 99.94
TIGR02822334 adh_fam_2 zinc-binding alcohol dehydrogenase family pro 99.93
TIGR02819403 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-in 99.69
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 100.0
PRK08324676 short chain dehydrogenase; Validated 95.84
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 100.0
pfam11017314 DUF2855 Protein of unknown function (DUF2855). This fam 98.31
pfam08240108 ADH_N Alcohol dehydrogenase GroES-like domain. This is 99.72
pfam00107131 ADH_zinc_N Zinc-binding dehydrogenase. 99.7
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 97.39
PRK05993277 short chain dehydrogenase; Provisional 97.36
PRK05693274 short chain dehydrogenase; Provisional 97.31
PRK06182273 short chain dehydrogenase; Validated 97.31
PRK09424 510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 97.25
PRK06914280 short chain dehydrogenase; Provisional 96.88
PRK07109 338 short chain dehydrogenase; Provisional 96.69
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 96.55
PRK09291257 short chain dehydrogenase; Provisional 96.01
KOG1205282 consensus 95.95
PRK05650270 short chain dehydrogenase; Provisional 95.93
COG2521287 Predicted archaeal methyltransferase [General function 90.94
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 90.94
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 90.88
TIGR01138300 cysM cysteine synthase B; InterPro: IPR005858 Cysteine 90.59
CHL00194 319 ycf39 Ycf39; Provisional 97.78
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 97.23
PRK09072262 short chain dehydrogenase; Provisional 97.12
PRK08263275 short chain dehydrogenase; Provisional 97.01
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 96.62
PRK07326235 short chain dehydrogenase; Provisional 96.61
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 96.6
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 96.56
PRK06180277 short chain dehydrogenase; Provisional 96.52
TIGR01137 527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 96.45
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 96.45
PRK06482276 short chain dehydrogenase; Provisional 96.41
PRK08267258 short chain dehydrogenase; Provisional 96.39
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 96.38
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 96.36
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 96.35
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.34
PRK07806248 short chain dehydrogenase; Provisional 96.34
PRK07825273 short chain dehydrogenase; Provisional 96.25
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 96.22
PRK07578199 short chain dehydrogenase; Provisional 96.18
PRK06398256 aldose dehydrogenase; Validated 96.15
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 96.15
PRK06179270 short chain dehydrogenase; Provisional 96.13
PRK07067256 sorbitol dehydrogenase; Provisional 96.09
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 96.06
PRK07062265 short chain dehydrogenase; Provisional 96.03
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 95.98
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 95.93
PRK08317241 hypothetical protein; Provisional 95.9
PRK07775275 short chain dehydrogenase; Provisional 95.89
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 95.85
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 95.73
TIGR01777 307 yfcH conserved hypothetical protein TIGR01777; InterPro 95.69
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 95.67
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 95.55
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 95.5
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 95.44
PRK07454241 short chain dehydrogenase; Provisional 95.41
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 95.37
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 95.14
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.11
PRK07402196 precorrin-6B methylase; Provisional 95.04
PRK12744257 short chain dehydrogenase; Provisional 94.97
PRK08589272 short chain dehydrogenase; Validated 94.92
PRK08219226 short chain dehydrogenase; Provisional 94.92
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 94.89
PRK12828239 short chain dehydrogenase; Provisional 94.88
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 94.77
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 94.76
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 94.71
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 94.52
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 94.3
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 94.05
COG4122219 Predicted O-methyltransferase [General function predict 93.9
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 93.8
PRK11036256 putative metallothionein SmtA; Provisional 93.73
PRK09135249 pteridine reductase; Provisional 93.7
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.62
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 93.39
PRK12935247 acetoacetyl-CoA reductase; Provisional 93.34
COG2910211 Putative NADH-flavin reductase [General function predic 93.32
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 93.08
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 92.81
KOG1201300 consensus 92.61
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 92.48
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 92.12
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 92.05
PRK10901428 16S rRNA methyltransferase B; Provisional 91.99
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 91.84
TIGR01136315 cysKM cysteine synthases; InterPro: IPR005856 This mode 91.74
PRK07069251 short chain dehydrogenase; Validated 91.53
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 91.43
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 90.84
PRK00536262 speE spermidine synthase; Provisional 90.8
PRK13243333 glyoxylate reductase; Reviewed 90.76
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 90.38
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 90.33
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 90.28
PRK06953222 short chain dehydrogenase; Provisional 97.39
PRK08177225 short chain dehydrogenase; Provisional 97.18
PRK08017256 short chain dehydrogenase; Provisional 96.79
KOG1014312 consensus 96.78
PRK07201663 short chain dehydrogenase; Provisional 96.78
PRK06139 324 short chain dehydrogenase; Provisional 96.62
PRK06181263 short chain dehydrogenase; Provisional 96.6
PRK05866290 short chain dehydrogenase; Provisional 96.59
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 96.54
PRK07832272 short chain dehydrogenase; Provisional 96.37
PRK07024256 short chain dehydrogenase; Provisional 96.35
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 96.3
PRK06125259 short chain dehydrogenase; Provisional 96.3
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.3
PRK06194301 hypothetical protein; Provisional 96.24
PRK05855582 short chain dehydrogenase; Validated 96.1
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 96.05
PRK08251248 short chain dehydrogenase; Provisional 96.04
PRK08862227 short chain dehydrogenase; Provisional 96.03
PRK06483236 short chain dehydrogenase; Provisional 95.98
PRK07041240 short chain dehydrogenase; Provisional 95.96
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.94
PRK08277278 D-mannonate oxidoreductase; Provisional 95.91
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 95.84
PRK12829264 short chain dehydrogenase; Provisional 95.8
PRK07102243 short chain dehydrogenase; Provisional 95.76
PRK05854 314 short chain dehydrogenase; Provisional 95.73
PRK08264235 short chain dehydrogenase; Validated 95.72
PRK06196316 oxidoreductase; Provisional 95.7
PRK08339263 short chain dehydrogenase; Provisional 95.7
PRK06197306 short chain dehydrogenase; Provisional 95.67
PRK07677254 short chain dehydrogenase; Provisional 95.64
PRK07063259 short chain dehydrogenase; Provisional 95.63
PRK08226263 short chain dehydrogenase; Provisional 95.61
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 95.59
PRK08213259 gluconate 5-dehydrogenase; Provisional 95.59
PRK07478254 short chain dehydrogenase; Provisional 95.52
PRK05867253 short chain dehydrogenase; Provisional 95.49
PRK06057255 short chain dehydrogenase; Provisional 95.47
PRK07479252 consensus 95.45
PRK07774250 short chain dehydrogenase; Provisional 95.42
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 95.42
PRK05876275 short chain dehydrogenase; Provisional 95.35
PRK06523260 short chain dehydrogenase; Provisional 95.24
PRK08278273 short chain dehydrogenase; Provisional 95.23
PRK06949258 short chain dehydrogenase; Provisional 95.02
PRK06114262 short chain dehydrogenase; Provisional 94.96
PRK05599246 hypothetical protein; Provisional 94.96
PRK07453 322 protochlorophyllide oxidoreductase; Validated 94.92
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 94.9
PRK08703239 short chain dehydrogenase; Provisional 94.8
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 94.79
PRK08945245 short chain dehydrogenase; Provisional 94.66
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.57
PRK05884223 short chain dehydrogenase; Provisional 94.57
PRK07831261 short chain dehydrogenase; Provisional 94.55
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.51
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.36
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 94.35
PRK08643256 acetoin reductase; Validated 94.21
PRK05875277 short chain dehydrogenase; Provisional 94.17
PRK07904253 short chain dehydrogenase; Provisional 94.1
PRK08303305 short chain dehydrogenase; Provisional 94.0
KOG0725270 consensus 93.81
PRK09186255 flagellin modification protein A; Provisional 93.74
PRK07791285 short chain dehydrogenase; Provisional 93.73
PRK09009235 C factor cell-cell signaling protein; Provisional 93.61
PRK06947252 glucose-1-dehydrogenase; Provisional 93.56
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 93.43
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 93.2
PRK06123249 short chain dehydrogenase; Provisional 93.17
PRK08340259 glucose-1-dehydrogenase; Provisional 93.12
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 93.05
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 92.63
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 92.48
pfam00106167 adh_short short chain dehydrogenase. This family contai 92.38
PRK09134256 short chain dehydrogenase; Provisional 92.36
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 92.05
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 91.76
KOG1210 331 consensus 91.71
PRK06940277 short chain dehydrogenase; Provisional 91.25
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 90.85
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 90.8
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.25
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 92.25
PRK06500249 short chain dehydrogenase; Provisional 96.98
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.89
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.82
PRK05872296 short chain dehydrogenase; Provisional 96.67
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 96.56
PRK06128300 oxidoreductase; Provisional 96.5
PRK12742237 oxidoreductase; Provisional 96.46
PRK06484530 short chain dehydrogenase; Validated 96.3
PRK06841255 short chain dehydrogenase; Provisional 96.16
PRK07060245 short chain dehydrogenase; Provisional 96.12
PRK07985294 oxidoreductase; Provisional 96.08
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 96.07
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 95.99
PRK07523251 gluconate 5-dehydrogenase; Provisional 95.97
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 95.9
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 95.89
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 95.88
PRK06172253 short chain dehydrogenase; Provisional 95.83
PRK07576260 short chain dehydrogenase; Provisional 95.81
PRK06124259 gluconate 5-dehydrogenase; Provisional 95.78
PRK07890258 short chain dehydrogenase; Provisional 95.77
PRK08265261 short chain dehydrogenase; Provisional 95.72
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.71
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 95.65
PRK06227256 consensus 95.63
PRK07577234 short chain dehydrogenase; Provisional 95.63
PRK09242258 tropinone reductase; Provisional 95.62
PRK08085254 gluconate 5-dehydrogenase; Provisional 95.61
PRK12937245 short chain dehydrogenase; Provisional 95.61
PRK07776252 consensus 95.54
PRK07856254 short chain dehydrogenase; Provisional 95.53
PRK12939250 short chain dehydrogenase; Provisional 95.51
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 95.49
PRK07074256 short chain dehydrogenase; Provisional 95.43
PRK05717255 oxidoreductase; Validated 95.33
PRK07814263 short chain dehydrogenase; Provisional 95.2
PRK07035252 short chain dehydrogenase; Provisional 95.17
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 95.17
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.16
PRK08628258 short chain dehydrogenase; Provisional 95.15
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.14
PRK07097265 gluconate 5-dehydrogenase; Provisional 95.13
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.1
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.04
PRK12746254 short chain dehydrogenase; Provisional 95.04
PRK06138252 short chain dehydrogenase; Provisional 94.98
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 94.96
PRK06346251 consensus 94.84
PRK12747252 short chain dehydrogenase; Provisional 94.83
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 94.71
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 94.67
PRK12743253 acetoin dehydrogenase; Provisional 94.64
PRK08936261 glucose-1-dehydrogenase; Provisional 94.62
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 94.62
PRK06198268 short chain dehydrogenase; Provisional 94.6
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 94.3
PRK12827251 short chain dehydrogenase; Provisional 94.19
PRK12824245 acetoacetyl-CoA reductase; Provisional 93.94
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 93.84
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 93.83
PRK07707239 consensus 93.55
PRK12938246 acetyacetyl-CoA reductase; Provisional 93.27
TIGR01139312 cysK cysteine synthase A; InterPro: IPR005859 This mode 91.77
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 91.62
PRK06101241 short chain dehydrogenase; Provisional 96.73
PRK06720169 hypothetical protein; Provisional 96.12
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 95.84
PRK12367250 short chain dehydrogenase; Provisional 94.95
KOG1502 327 consensus 93.98
TIGR01289 321 LPOR light-dependent protochlorophyllide reductase; Int 93.32
PRK06924251 short chain dehydrogenase; Provisional 92.54
PRK00048265 dihydrodipicolinate reductase; Provisional 92.28
PRK07023243 short chain dehydrogenase; Provisional 91.98
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [Gener 91.96
KOG1208314 consensus 91.37
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 91.37
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 91.19
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 91.1
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 90.22
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 96.44
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 94.57
PRK06484530 short chain dehydrogenase; Validated 96.12
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 95.52
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 93.98
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.11
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.21
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 95.31
PRK06701289 short chain dehydrogenase; Provisional 94.72
PRK08655441 prephenate dehydrogenase; Provisional 92.94
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family; InterPro: IPR014189 Members of this family are putative quinone oxidoreductases that belong to the broader superfamily of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxidoreductases Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK09422 alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG1197 consensus Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase; InterPro: IPR010085 Crotonyl-CoA reductase is responsible for the conversion of crotonyl-CoA to butyryl-CoA Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10083 putative dehydrogenase; Provisional Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014182 Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family; InterPro: IPR014188 This entry represents a subfamily of the alcohol dehydrogenase, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc Back     alignment and domain information
>KOG0023 consensus Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L-threonine 3-dehydrogenase (1 Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information