254780291

254780291

hypothetical protein CLIBASIA_00880

GeneID in NCBI database:8209273Locus tag:CLIBASIA_00880
Protein GI in NCBI database:254780291Protein Accession:YP_003064704.1
Gene range:+(181640, 183067)Protein Length:475aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MSKTKHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDLLPKQR
cccHHHHHEEEEEEccccEEEEHHHHHHHHHHHHHHHHHHHHHEEEEccccccHHHHccccEEEEEccccccHHHcccHHHHHHHHHHHcccccHHHHHHHHHHcccccccEEEcccccEEEEEEEEEEcHHHHHHHHcccccccEEEEEEHHHcccccccEEEEEcccccccccHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHEEEEcHHHcccccHHHccccccccccEEccccccEEEEEEHHHHHHHHHcccccHHHHHccccHHHHccccccccEEEEEEEcccEEEEEcccEEEEEEccEEEEEEEEccccccEEEEEccccccHHHcHHHcccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHcHHHHHHHHHHHHHcccEEEEEEEEccccHHHHHcccccEEEEEEcccccccEEEEEEEcccEEEEEEEEcccccccHHHcccHHHcccccc
cccccHccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccEEEEEcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccEEEEEEEEEcccHHHHHHHccccccccEEEEHHHHHHHccccEEEEEccHHHcccHHHHHHHHHHHHcccEEEEEEEcccccccccccHHHHHEEEEcccccccccccccHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEEEEcccccEEEEEEccccEEEEEEcccHccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHccccccEEEEccccccccEEEEEEcccEEEEEEEccccccccEEEcccccccccccc
msktkhlkKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLlckdsdltpqditppvlkDLETSLIKNDFSIKEAAQIKKESsinyqgkiplsqgtylnlhAVYHVPLNSLERillphkqnmdIVVDVNKILnchhkgiaviadpwykadtpMFVEAINSLKSSKNIILGILtgdmtqsstTKELKRFYNIYslkfpffrglgsqeyignrpcrdpytltpsiygcAFIAINDISQqindhypqiksikefngdsqryrnrswhgetysisisgsqsyswniDNVHFIQANYSMFHSVYFNDEWSNIFTVAvpehiskqdlpshvsngseiSQWIRDDVFQAQREGKYIILFAddidrfssIDQKRMFEKFLTQSKISTIfttrftsspesyikdstgrpvrvyninknsknEFILLEmtphyinvtayerrgkvphitrkmspidllpkqr
msktkhlkktiflskkgnitILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGIltgdmtqsstTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFltqskistifttrftsspesyikdstgrpvRVYNINKNSKNEFILLEMTPHYINVTAyerrgkvphitrkmspidllpkqr
MSKTKHLKKTIFLSKKGNitiltaiiipliitlitisttCANILYHRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETysisisgsqsysWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQskistifttrftssPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDLLPKQR
*****HLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEA***EALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKE*******SSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDLLP***
MSKTKHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDLLPKQR
****KHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDLLP***
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKTKHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDLLPKQR
MSKTKHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDLLPKQR
MSKTKHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDLLPKQR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target475 hypothetical protein CLIBASIA_00880 [Candidatus Liberib
254780934374 hypothetical protein CLIBASIA_04165 [Candidatus Li 0.002
254781108398 von Willebrand factor type A [Candidatus Liberibac 0.012
254780833371 hypothetical protein CLIBASIA_03630 [Candidatus Li 0.039
>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Back     alignment
 Score = 35.4 bits (80), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%)

Query: 9  KTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHG 61
          +  F + KG +TILTAI +P+I  ++ +    ++I + +  + +  D +L H 
Sbjct: 9  RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61

>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 32.7 bits (73), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 22  LTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGIVLLCKDSDL----TPQDIT 77
           +TAIII +    IT +   A+I+Y R  ++++ D A+  G   +  D  +    T +D T
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60

Query: 78  PPVLKDLETSLIKNDFSIKE-AAQIKKESSIN 108
             + K      +K    I+E A  I +++ IN
Sbjct: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQIN 92

>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Back     alignment
 Score = 31.2 bits (69), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 30/50 (60%)

Query: 9  KTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEAL 58
          +  F + KG+I+ILTAI++P+I  ++ +    ++  + +A +    D +L
Sbjct: 7  RNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSL 56

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target475 hypothetical protein CLIBASIA_00880 [Candidatus Liberib
315122852494 hypothetical protein CKC_05540 [Candidatus Liberibacter 1 9e-59
37526143465 hypothetical protein plu2230 [Photorhabdus luminescens 1 2e-17
197286941309 phosphoesterase [Proteus mirabilis HI4320] Length = 309 1 2e-12
49475998334 hypothetical protein BH13090 [Bartonella henselae str. 1 3e-07
226326932192 hypothetical protein PROPEN_00792 [Proteus penneri ATCC 1 2e-06
240850530376 hypothetical protein Bgr_09730 [Bartonella grahamii as4 1 6e-06
49474567334 hypothetical protein BQ10350 [Bartonella quintana str. 1 6e-05
17228824 470 hypothetical protein alr1329 [Nostoc sp. PCC 7120] Leng 1 3e-04
237797607 548 VOMI family protein [Pseudomonas syringae pv. oryzae st 2 2e-26
257484869 545 VOMI family protein [Pseudomonas syringae pv. tabaci AT 2 2e-24
>gi|315122852|ref|YP_004063341.1| hypothetical protein CKC_05540 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 494 Back     alignment and organism information
 Score =  232 bits (592), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 155/488 (31%), Positives = 258/488 (52%), Gaps = 37/488 (7%)

Query: 3   KTKHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGI 62
           K     K +F SKKGN  +++AI+IP +  L+ I    +N L H+ S+E++++EAL+HG+
Sbjct: 22  KIHFFNKLLFFSKKGNFAMISAIMIPSLALLLGIVLVTSNYLLHKYSVESASEEALSHGM 81

Query: 63  VLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLS---QGT 119
            L+C  +D+   ++   +L DL  SL KN+F+ +EA  + K S I+    I  S   +  
Sbjct: 82  SLICYQNDIERDNLAKIILNDLIVSLKKNNFTKQEADLVAKNSKIDITTLINDSTNVKSY 141

Query: 120 YLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADP---WYKADTPM 176
           +  + +VY +PLN + +I  P  +++ IV +VNKI+ C +    ++++P    + +D  +
Sbjct: 142 HFYIKSVYKMPLNKITKIFYP--KDLTIVTNVNKIVPCPYTSYVMLSNPRARQFNSDWDL 199

Query: 177 F----VEAINSLKSSKNIILGILTGDMTQSS----TTKELKRFYNIYS-LKFPFFRGLGS 227
                V AINS+ + KNI   I+ G MT        T E+K+F N+Y  L  P FR +G+
Sbjct: 200 IHRRTVNAINSIITDKNIKYMIINGSMTNFDPSHYYTAEVKQFNNVYRHLNVPIFRSIGT 259

Query: 228 QEYIGNRP-CRDPYTLTP-SIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRS 285
           ++Y+ N   CRD   LT  S Y CAF A+ND+S +I + Y     + E N D +R+ +  
Sbjct: 260 RDYVDNNGICRDGDVLTNFSTYSCAFAALNDLSWRIINEYKY--KLPEINYDVKRWIDYC 317

Query: 286 WHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVP-EHISKQDL 344
           +    +   I GS +Y+WN  N+HF+Q N S+F+S +F            P  H    ++
Sbjct: 318 FFQTIH--HIRGSLAYTWNDKNIHFVQLNNSLFYSSHF-----------YPITHEFDCEI 364

Query: 345 PSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIF 404
              +  G   + W+  D+ +A++E K IILF D +  F S  Q + F+  L + KI+ +F
Sbjct: 365 EPTMHPGELTASWLEQDLRKARKENKTIILFVDQLHDFYSSSQLQAFKDLLIRHKIAAVF 424

Query: 405 TTRFTSSPESYIKDSTGRPVRVYN--INKNSKNEFILLEMTPHYINVTAYERRGKVPHIT 462
           +       E ++ D+     + YN  +       F+LLE   H ++V  Y    ++  + 
Sbjct: 425 SGLEPGKEEEFVYDNNNHVTKFYNTGVAIPRYGHFMLLENRGHSLDVLIYNTSNRIATLA 484

Query: 463 RKMSPIDL 470
           +KMS I L
Sbjct: 485 KKMSSITL 492


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|37526143|ref|NP_929487.1| hypothetical protein plu2230 [Photorhabdus luminescens subsp. laumondii TTO1] Length = 465 Back     alignment and organism information
>gi|197286941|ref|YP_002152813.1| phosphoesterase [Proteus mirabilis HI4320] Length = 309 Back     alignment and organism information
>gi|49475998|ref|YP_034039.1| hypothetical protein BH13090 [Bartonella henselae str. Houston-1] Length = 334 Back     alignment and organism information
>gi|226326932|ref|ZP_03802450.1| hypothetical protein PROPEN_00792 [Proteus penneri ATCC 35198] Length = 192 Back     alignment and organism information
>gi|240850530|ref|YP_002971929.1| hypothetical protein Bgr_09730 [Bartonella grahamii as4aup] Length = 376 Back     alignment and organism information
>gi|49474567|ref|YP_032609.1| hypothetical protein BQ10350 [Bartonella quintana str. Toulouse] Length = 334 Back     alignment and organism information
>gi|17228824|ref|NP_485372.1| hypothetical protein alr1329 [Nostoc sp. PCC 7120] Length = 470 Back     alignment and organism information
>gi|237797607|ref|ZP_04586068.1| VOMI family protein [Pseudomonas syringae pv. oryzae str. 1_6] Length = 548 Back     alignment and organism information
>gi|257484869|ref|ZP_05638910.1| VOMI family protein [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 545 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 475 hypothetical protein CLIBASIA_00880 [Candidatus Liberib
COG5555392 Cytolysin, a secreted calcineurin-like phosphatase [Cel 99.58
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodiesterase; 98.99
KOG2679336 consensus 97.36
COG2129226 Predicted phosphoesterases, related to the Icc protein 95.49
KOG3770577 consensus 94.22
COG5555392 Cytolysin, a secreted calcineurin-like phosphatase [Cel 98.56
KOG1378452 consensus 98.44
pfam00149186 Metallophos Calcineurin-like phosphoesterase. This fami 97.74
COG1409301 Icc Predicted phosphohydrolases [General function predi 97.97
PRK11340270 phosphodiesterase YaeI; Provisional 95.6
>COG5555 Cytolysin, a secreted calcineurin-like phosphatase [Cell motility and secretion] Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>KOG2679 consensus Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>KOG3770 consensus Back     alignment and domain information
>COG5555 Cytolysin, a secreted calcineurin-like phosphatase [Cell motility and secretion] Back     alignment and domain information
>KOG1378 consensus Back     alignment and domain information
>pfam00149 Metallophos Calcineurin-like phosphoesterase Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target475 hypothetical protein CLIBASIA_00880 [Candidatus Liberib
2nxf_A322 Putative dimetal phosphatase; dinuclear metal center ph 99.39
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fold, s 99.15
1ute_A313 Protein (II purple acid phosphatase); tartrate resistan 99.15
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metallohydr 99.02
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, unkn 98.52
1uf3_A228 Hypothetical protein TT1561; metallo-dependent phosphat 98.45
2q8u_A336 Exonuclease, putative; structural genomics, joint cente 97.11
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; H 99.1
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2 99.09
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break repair, 97.26
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
Probab=99.39  E-value=9e-12  Score=96.06  Aligned_cols=254  Identities=12%  Similarity=0.111  Sum_probs=132.1

Q ss_pred             CEEEEECCCEE-CC----------------CHHHHHHHHHHHHCCCEEEEEEECCCCCC------CCHHHHHHHHHHH-C
Q ss_conf             51555133100-46----------------31468899988611656789760510012------1267788888672-6
Q gi|254780291|r  161 GIAVIADPWYK-AD----------------TPMFVEAINSLKSSKNIILGILTGDMTQS------STTKELKRFYNIY-S  216 (475)
Q Consensus       161 ~~~~~~~pw~k-~~----------------~~~~vesinsl~~~~~~~~gIINGDLTeF------G~q~qL~eFr~Vw-n  216 (475)
                      -++||+||-|. .+                ...+.++|..+. ..++.|-|++|||++-      +...+++++...+ +
T Consensus         7 ~f~~isD~h~~~~~~~~~~~~~~~~~~~~s~~~l~~ai~~~~-~~~~dfVv~~GDl~d~~~~~~~~~~~~~~~~~~~~~~   85 (322)
T 2nxf_A            7 TFGLIADVQYADIEDGENYLRTRRRYYRGSADLLRDAVLQWR-RERVQCVVQLGDIIDGHNRRRDASDRALDTVMAELDA   85 (322)
T ss_dssp             EEEEECCCCBCSSCCEECTTSSSEECTTHHHHHHHHHHHHHH-HTTCSEEEECSCCBCTHHHHTTCHHHHHHHHHHHHHT
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH-CCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999983178777776523344303456666999999999973-3799999999987889885236899999999999986


Q ss_pred             CCCCEEECCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCEEEE
Q ss_conf             55751302455444788-87667454550000036888999999998776555666542100100134445655210377
Q gi|254780291|r  217 LKFPFFRGLGSQEYIGN-RPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISI  295 (475)
Q Consensus       217 l~iPv~lGLGNHDYqNN-~dC~~P~~~d~s~n~CA~sav~~M~s~I~dy~~q~s~i~efN~Ds~~y~~~~~~~~~~~vei  295 (475)
                      +++|++...||||+... .++........            +..+..+..          ......              
T Consensus        86 ~~~p~~~~~GNHD~~~~~~~~~~~~~~~~------------~~~~~~~~~----------~~~~~~--------------  129 (322)
T 2nxf_A           86 CSVDVHHVWGNHEFYNFSRPSLLSSRLNS------------AQRTGTDTG----------SDLIGD--------------  129 (322)
T ss_dssp             TCSEEEECCCHHHHHHCCHHHHHTSTTCC------------CC------C----------EECGGG--------------
T ss_pred             CCCCEEEECCCCCCCCCCCHHHCCCCCCC------------HHHHCCCCC----------CCCCCC--------------
T ss_conf             59978982687752223300000012341------------222112233----------222577--------------


Q ss_pred             EEEEEEEEECCCEEEEEECCCCEEEEECCCCCC-----HHHHHHHHHCCCCCCEE--------EEEE----CCCCHHHHH
Q ss_conf             754433430273355540364103675167530-----01222210002565113--------4320----565577887
Q gi|254780291|r  296 SGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWS-----NIFTVAVPEHISKQDLP--------SHVS----NGSEISQWI  358 (475)
Q Consensus       296 ~GSLSYSWd~gdvHfVQ~NYpsy~~V~~n~~~~-----~af~Iqv~n~Id~q~l~--------s~Vn----~~~~iskWL  358 (475)
                      .+...+.-..++.+++-++-..+..........     -.+.......+.....+        ....    ....-..||
T Consensus       130 ~~~~~~~~~~~~~~~i~ld~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q~~wl  209 (322)
T 2nxf_A          130 DIYAYEFSPAPNFRFVLLDAYDLSVIGREEESEKHTHSWRILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWL  209 (322)
T ss_dssp             TCCCEEEEEETTEEEEECCTTSBCSSSSCTTSHHHHHHHHHHHHHCCCTTCTTSCSCSSSGGGGCSTTCCBCCHHHHHHH
T ss_pred             CCCEEEEECCCCEEEEEECCCCCCCCCCCCCCCCHHCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             87404764179769999657543444566565210011000012466621003553223555554444556889999999


Q ss_pred             HHHHHHCCCCCCEEEEECCCCCCC------HHHHHHHHHHHHHHHC-CCCEEEEEEEECCCCCCCCCCCCCEEEEEEECC
Q ss_conf             888884034795799950047720------0389999999999858-961799986423676524655531013897045
Q gi|254780291|r  359 RDDVFQAQREGKYIILFADDIDRF------SSIDQKRMFEKFLTQS-KISTIFTTRFTSSPESYIKDSTGRPVRVYNINK  431 (475)
Q Consensus       359 ~~DL~~A~~~gK~IILN~HD~~~~------sSi~~KrmFks~itk~-nV~AIF~aH~Hqshe~~lec~~GykVPvy~iGS  431 (475)
                      ++.|..+++.++++|+.+|.-...      .....-..+..++.++ +|.++|.||.|...  +...+.|  ++++..++
T Consensus       210 ~~~L~~~~~~~~~~iv~~H~p~~~~~~~~~~~~~~~~~~~~~l~~~~~V~~v~~GH~H~~~--~~~~~~g--i~~v~~~~  285 (322)
T 2nxf_A          210 DAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVLSVLRSHQSVLCFIAGHDHDGG--RCTDSSG--AQHITLEG  285 (322)
T ss_dssp             HHHHHHHHHHTCEEEEEESSCCCTTSSCGGGSCTTHHHHHHHHHTCTTEEEEEECSCTTCE--EEECTTS--CEEEECCC
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--EEECCCC--CEEEECCE
T ss_conf             9999862642874899992189777788763113499999999748984699947747886--3344489--76997780


Q ss_pred             CCC-----CCEEEEEECCCEEEEEEEECC
Q ss_conf             646-----718999964885999998516
Q gi|254780291|r  432 NSK-----NEFILLEMTPHYINVTAYERR  455 (475)
Q Consensus       432 vpk-----NrF~~lem~~~~atITgY~~R  455 (475)
                      +..     +.|..+|+.+-.++|+||-+-
T Consensus       286 ~~~~~~~~~~~~~~~~~~d~~~i~~~~~~  314 (322)
T 2nxf_A          286 VIETPPHSHAFATAYLYEDRMVMKGRGRV  314 (322)
T ss_dssp             GGGCCTTSCEEEEEEECSSEEEEEEEETS
T ss_pred             ECCCCCCCCCEEEEEEECCEEEEEEEEEE
T ss_conf             20268999988999998999999989876



>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, hydrolase; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase, metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national project on protein structural and functional analyses; 1.60A {Aquifex aeolicus VF5} SCOP: d.159.1.6 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target475 hypothetical protein CLIBASIA_00880 [Candidatus Liberib
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish ( 99.45
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycobacteri 99.18
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa) [Ta 99.12
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [ 99.01
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus [TaxI 98.68
d2qfra2312 Plant purple acid phosphatase, catalytic domain {Kidney 99.26
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxI 98.39
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.45
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidium par 91.86
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: ADPRibase-Mn-like
domain: Uncharacterized C17orf48 homolog zgc:64213
species: Zebrafish (Danio rerio) [TaxId: 7955]
Probab=99.45  E-value=8.3e-13  Score=101.32  Aligned_cols=239  Identities=10%  Similarity=0.057  Sum_probs=132.7

Q ss_pred             HHHHHHHHHHCCCEEEEEEECCCCC------CCCHHHHHHHHHHH-CCCCCEEECCCCCCCCCC-CCCCCCCCCCCCCCH
Q ss_conf             6889998861165678976051001------21267788888672-655751302455444788-876674545500000
Q gi|254780291|r  177 FVEAINSLKSSKNIILGILTGDMTQ------SSTTKELKRFYNIY-SLKFPFFRGLGSQEYIGN-RPCRDPYTLTPSIYG  248 (475)
Q Consensus       177 ~vesinsl~~~~~~~~gIINGDLTe------FG~q~qL~eFr~Vw-nl~iPv~lGLGNHDYqNN-~dC~~P~~~d~s~n~  248 (475)
                      +.+++..+ ...++.|-|+.||+++      .+...+++++.+.+ .+++|++...||||+.++ .+.......+.....
T Consensus        38 l~~~v~~i-~~~~~DfVv~~GDl~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~v~GNHD~~~~~~~~~~~~~~~~~~~~  116 (320)
T d2nxfa1          38 LRDAVLQW-RRERVQCVVQLGDIIDGHNRRRDASDRALDTVMAELDACSVDVHHVWGNHEFYNFSRPSLLSSRLNSAQRT  116 (320)
T ss_dssp             HHHHHHHH-HHTTCSEEEECSCCBCTHHHHTTCHHHHHHHHHHHHHTTCSEEEECCCHHHHHHCCHHHHHTSTTCCCC--
T ss_pred             HHHHHHHH-HHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHCCCCCCCCHHHH
T ss_conf             99999998-64798999988987889873135799999999999997599889940467655431011000112403332


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCEEEEEEEEEEEEECCCEEEEEECCCCEEEEECCCCCC
Q ss_conf             36888999999998776555666542100100134445655210377754433430273355540364103675167530
Q gi|254780291|r  249 CAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWS  328 (475)
Q Consensus       249 CA~sav~~M~s~I~dy~~q~s~i~efN~Ds~~y~~~~~~~~~~~vei~GSLSYSWd~gdvHfVQ~NYpsy~~V~~n~~~~  328 (475)
                                  ..+..             ....           .-.+...+..+.++.+|+.++...+..........
T Consensus       117 ------------~~~~~-------------~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (320)
T d2nxfa1         117 ------------GTDTG-------------SDLI-----------GDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEESE  160 (320)
T ss_dssp             ----------------C-------------EECG-----------GGTCCCEEEEEETTEEEEECCTTSBCSSSSCTTSH
T ss_pred             ------------CCCCC-------------CCCC-----------CCCCCCCEEECCCCEEEEEECCCCCCCCCCCCCCC
T ss_conf             ------------12233-------------2235-----------77775302421797499994474333445655652


Q ss_pred             HHH-----HHHHHHCCCCCCEEE------------EEECCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCC------HHH
Q ss_conf             012-----222100025651134------------320565577887888884034795799950047720------038
Q gi|254780291|r  329 NIF-----TVAVPEHISKQDLPS------------HVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRF------SSI  385 (475)
Q Consensus       329 ~af-----~Iqv~n~Id~q~l~s------------~Vn~~~~iskWL~~DL~~A~~~gK~IILN~HD~~~~------sSi  385 (475)
                      ...     .....-.+....++.            ....+.+--+||++.|..+++.++++|+.+|.-...      ...
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ql~WL~~~L~~~~~~~~~viv~~H~p~~~~~~~~~~~~  240 (320)
T d2nxfa1         161 KHTHSWRILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLA  240 (320)
T ss_dssp             HHHHHHHHHHHHCCCTTCTTSCSCSSSGGGGCSTTCCBCCHHHHHHHHHHHHHHHHHTCEEEEEESSCCCTTSSCGGGSC
T ss_pred             CCCCCCCEEEECCCCCCEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCH
T ss_conf             10010000222146631110355434555554445544569999999999986464498559998878766778876302


Q ss_pred             HHHHHHHHHHHHC-CCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCC-----CCCCEEEEEECCCEEEEEEEECCC
Q ss_conf             9999999999858-9617999864236765246555310138970456-----467189999648859999985167
Q gi|254780291|r  386 DQKRMFEKFLTQS-KISTIFTTRFTSSPESYIKDSTGRPVRVYNINKN-----SKNEFILLEMTPHYINVTAYERRG  456 (475)
Q Consensus       386 ~~KrmFks~itk~-nV~AIF~aH~Hqshe~~lec~~GykVPvy~iGSv-----pkNrF~~lem~~~~atITgY~~Rd  456 (475)
                      ..-..|.+++.++ +|.+||.||.|.. + +....  ..++++..|++     .++.|.++|+.+..+.|+||-+..
T Consensus       241 ~~~~~~~~~l~~~~~V~~v~~GH~H~~-~-~~~~~--~g~~~i~~~~~~~~~~~~~~~~~~~v~~d~~~~~~~~~~~  313 (320)
T d2nxfa1         241 WNHEAVLSVLRSHQSVLCFIAGHDHDG-G-RCTDS--SGAQHITLEGVIETPPHSHAFATAYLYEDRMVMKGRGRVE  313 (320)
T ss_dssp             TTHHHHHHHHHTCTTEEEEEECSCTTC-E-EEECT--TSCEEEECCCGGGCCTTSCEEEEEEECSSEEEEEEEETSC
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCC-C-EEECC--CCCEEEECCEEECCCCCCCCEEEEEEECCEEEEEEECCCC
T ss_conf             339999999985899559996886786-7-14356--9977997881322789999889999989999999823644



>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target475 hypothetical protein CLIBASIA_00880 [Candidatus Liberib
1ute_A_313 Protein (II purple acid phosphatase); tartrate res 98.99
1uf3_A_228 Hypothetical protein TT1561; metallo-dependent pho 98.91
2qfp_A_115-424310 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 98.67
1xzw_A_122-426305 Purple acid phosphatase; hydrolase; HET: NAG FUC M 98.58
3ib7_A_23-284262 ICC protein; metallophosphoesterase, alpha-beta fo 98.48
2yvt_A_260 Hypothetical protein AQ_1956; structural genomics, 98.43
2q8u_A_1-281281 Exonuclease, putative; TM1635, structural genomics 98.03
2nxf_A_118-289172 Putative dimetal phosphatase; dinuclear metal cent 98.74
1ii7_A_333 MRE11 nuclease; RAD50, DNA double-strand break rep 98.21
3d03_A_1-98_224-274149 Phosphohydrolase; glycerophosphodiesterase, metall 97.92
1t71_A_281 Phosphatase, conserved; crystal, X-RAY crystallogr 96.36
2nxf_A_1-117_290-322150 Putative dimetal phosphatase; dinuclear metal cent 94.34
2a22_A_215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 91.24
3d03_A_99-223125 Phosphohydrolase; glycerophosphodiesterase, metall 97.47
>1ute_A (A:) Protein (II purple acid phosphatase); tartrate resistant acid phosphatase, metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} Back     alignment and structure
Probab=98.99  E-value=6.9e-09  Score=78.03  Aligned_cols=237  Identities=14%  Similarity=0.111  Sum_probs=141.0

Q ss_pred             EEEEECCCEEC-------CCHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHH------HHHHHHHH----CCCCCEEEC
Q ss_conf             15551331004-------63146889998861165678976051001212677------88888672----655751302
Q gi|254780291|r  162 IAVIADPWYKA-------DTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKE------LKRFYNIY----SLKFPFFRG  224 (475)
Q Consensus       162 ~~~~~~pw~k~-------~~~~~vesinsl~~~~~~~~gIINGDLTeFG~q~q------L~eFr~Vw----nl~iPv~lG  224 (475)
                      |++++|.-+-.       ...-..+.+....+..+..|-++.|||++-+....      .+.+...-    .++.|++.+
T Consensus         9 i~~~sD~H~~~~~~~~~~~~~~~~~~~~~~i~~~~~d~vi~~GDi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (313)
T 1ute_A            9 FVAVGDWGGVPNAPFHTAREMANAKAIATTVKTLGADFILSLGDNFYFTGVHDAKDKRFQETFEDVFSDPSLRNVPWHVL   88 (313)
T ss_dssp             EEEECSCCCCSSTTSSCHHHHHHHHHHHHHHHHHCCSEEEECSCCSTTTCCSSTTCTHHHHHTTTTSCSGGGTTCCEEEC
T ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             99996589998754430779999999999975079979998998877578886406899999999861100147646987


Q ss_pred             CCCCCCCCC-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCEEEEEEEEEEEE
Q ss_conf             455444788-8766745455000003688899999999877655566654210010013444565521037775443343
Q gi|254780291|r  225 LGSQEYIGN-RPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSW  303 (475)
Q Consensus       225 LGNHDYqNN-~dC~~P~~~d~s~n~CA~sav~~M~s~I~dy~~q~s~i~efN~Ds~~y~~~~~~~~~~~vei~GSLSYSW  303 (475)
                      .||||+.++ ..+..                     +. ...       ........+.     .........+...|+.
T Consensus        89 ~gnhd~~~~~~~~~~---------------------~~-~~~-------~~~~~~~~~~-----~~~~~~~~~~~~~~~~  134 (313)
T 1ute_A           89 AGNHDHLGNVSAQIA---------------------YS-KIS-------KRWNFPSPYY-----RLRFKIPRSNVSVAIF  134 (313)
T ss_dssp             CCHHHHHSCHHHHHH---------------------GG-GTS-------TTEECCSSSE-----EEEEECTTSSCEEEEE
T ss_pred             ECCCCCCCCCCCCCC---------------------HH-CCC-------CCCCCCCCCC-----EEEECCCCCCCCEEEE
T ss_conf             405510366412103---------------------00-026-------4554899874-----0364367889616999


Q ss_pred             ECCCEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCCCC--
Q ss_conf             027335554036410367516753001222210002565113432056557788788888403479579995004772--
Q gi|254780291|r  304 NIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDR--  381 (475)
Q Consensus       304 d~gdvHfVQ~NYpsy~~V~~n~~~~~af~Iqv~n~Id~q~l~s~Vn~~~~iskWL~~DL~~A~~~gK~IILN~HD~~~--  381 (475)
                      +.+.++|+.++...+......                    ........+--+||+++|..  ..++.+|+.+|...-  
T Consensus       135 ~~~~~~~~~l~~~~~~~~~~~--------------------~~~~~~~~~q~~wl~~~l~~--~~~~~~iv~~H~p~~~~  192 (313)
T 1ute_A          135 MLDTVTLCGNSDDFVSQQPER--------------------PRNLALARTQLAWIKKQLAA--AKEDYVLVAGHYPVWSI  192 (313)
T ss_dssp             ECCHHHHHCCGGGSTTCSCCS--------------------CSCHHHHHHHHHHHHHHHHH--CCCSEEEEECSSCSSCC
T ss_pred             EECCEEEEECCCCCCCCCCCC--------------------CCCCCHHHHHHHHHHHHHHC--CCCCCEEEEECCCCCCC
T ss_conf             824366771357643322246--------------------54510499999999999960--85677799825665445


Q ss_pred             ---CHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCEEEEEEECC--------------------------C
Q ss_conf             ---00389999999999858961799986423676524655531013897045--------------------------6
Q gi|254780291|r  382 ---FSSIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRPVRVYNINK--------------------------N  432 (475)
Q Consensus       382 ---~sSi~~KrmFks~itk~nV~AIF~aH~Hqshe~~lec~~GykVPvy~iGS--------------------------v  432 (475)
                         .........|...+.+++|.++|.||.|......    ....++++..|+                          .
T Consensus       193 ~~~~~~~~~~~~~~~~l~~~~v~~~l~GH~H~~~~~~----~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~  268 (313)
T 1ute_A          193 AEHGPTHCLVKQLLPLLTTHKVTAYLCGHDHNLQYLQ----DENGLGFVLSGAGNFMDPSKKHLRKVPNGYLRFHFGAEN  268 (313)
T ss_dssp             SSSCCCHHHHHHTHHHHHHTTCSEEEECSSSSEEEEE----CTTCCEEEEECBSSCCCCCCTTGGGSCTTCEEEEECCTT
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCEEEEE----CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCEEEECCCC
T ss_conf             5555658888868999987496299966774246872----599866999798877788755566688543314451578


Q ss_pred             CCCCEEEEEECCCEEEEEEEECCCCC
Q ss_conf             46718999964885999998516763
Q gi|254780291|r  433 SKNEFILLEMTPHYINVTAYERRGKV  458 (475)
Q Consensus       433 pkNrF~~lem~~~~atITgY~~Rd~t  458 (475)
                      ....|..+++++..++++.+..-+..
T Consensus       269 ~~~~~~~i~v~~~~~~~~~~~~~~~~  294 (313)
T 1ute_A          269 SLGGFAYVEITPKEMSVTYIEASGKS  294 (313)
T ss_dssp             SCCEEEEEEECSSCEEEEEEETTSCE
T ss_pred             CCCEEEEEEEECCEEEEEEECCCCCE
T ss_conf             87649999998999999999099979



>1uf3_A (A:) Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} Back     alignment and structure
>2qfp_A (A:115-424) Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} Back     alignment and structure
>1xzw_A (A:122-426) Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} Back     alignment and structure
>3ib7_A (A:23-284) ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, hydrolase; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2yvt_A (A:) Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national project on protein structural and functional analyses; 1.60A {Aquifex aeolicus VF5} Back     alignment and structure
>2q8u_A (A:1-281) Exonuclease, putative; TM1635, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 2.20A {Thermotoga maritima MSB8} Back     alignment and structure
>2nxf_A (A:118-289) Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} Back     alignment and structure
>1ii7_A (A:) MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3d03_A (A:1-98,A:224-274) Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} Back     alignment and structure
>1t71_A (A:) Phosphatase, conserved; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} Back     alignment and structure
>2nxf_A (A:1-117,A:290-322) Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} Back     alignment and structure
>2a22_A (A:) Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3d03_A (A:99-223) Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} Back     alignment and structure