254780294

254780294

N-acetyl-gamma-glutamyl-phosphate reductase

GeneID in NCBI database:8209276Locus tag:CLIBASIA_00895
Protein GI in NCBI database:254780294Protein Accession:YP_003064707.1
Gene range:+(184511, 185446)Protein Length:311aa
Gene description:N-acetyl-gamma-glutamyl-phosphate reductase
COG prediction:none
KEGG prediction:N-acetyl-gamma-glutamyl-phosphate reductase (EC:1.2.1.38); K00145 N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl -phosphate reductase [EC:1.2.1.38 1.2.1.-]
SEED prediction:N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Arginine and proline metabolism [PATH:las00330]
Subsystem involved in SEED:Arginine Biosynthesis extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL
ccEEEEEccccHHHHHHHHHHHccccEEEEEEEccccccccccHHHHccccEEEEccccHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEcccHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHHcccccccccccccccccccccccHHHHHHcccccccEEEEEEcccccccEEEEEEEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHHHccc
ccEEEEEcccccHHHHHHHHHHccccEEEEEEEcccHccccHHHHHHHcccEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccEEccHcccHHHHHHHHHccEEccccccHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccHHHHHHHccccHccccccccccHHHHHHHcccccEEEccccccccccEEEEEEEEHHHccccccHHHHHHHHHHHHccccEEEEEccccccccccccHHHccccccEEEEEEEcccccEEEEEEEHHHHHccHHHHHHHHHHHHHccc
mykifidgehgttglKIRSRIvqrkdlcllsipceerhnlrYREDLLnaadvsilclpdvaSLEIIQLIKKNginsriidtstahriapgwvygfpemdkSQKEKIRSAryitnpgcyatGAIAILRPLrkakllpdrypitinavsgytggGKKLISRMEqknmpdtissnhfFYSLDLLHkhlpeitqysliktspmflpsvgrfpqgIAIQISLDMERLSWKTNSEELHSIFQEYYmgqnivsvvpleesrkIKTIACEMmsgndklhlfffdsselpyinIIAVFdnlgkgasgaAIQNMDLLLSSL
mykifidgehgttglkirsrivqrkdlcllsipceerHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITinavsgytggGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL
MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL
MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL
MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL
MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL
MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL
MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLLLSSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target311 N-acetyl-gamma-glutamyl-phosphate reductase [Candidatus
315122855311 N-acetyl-gamma-glutamyl-phosphate reductase [Candidatus 1 1e-149
241204053310 N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium 1 1e-103
116251434310 N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium 1 1e-103
161621435310 N-acetyl-gamma-glutamyl-phosphate reductase [Sinorhizob 1 1e-102
190891249310 N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium 1 1e-102
307317800310 N-acetyl-gamma-glutamyl-phosphate reductase [Sinorhizob 1 1e-102
209548833310 N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium 1 1e-102
86357204310 N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium 1 1e-102
150396082310 N-acetyl-gamma-glutamyl-phosphate reductase [Sinorhizob 1 1e-102
218462205310 N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium 1 1e-102
>gi|315122855|ref|YP_004063344.1| N-acetyl-gamma-glutamyl-phosphate reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 311 Back     alignment and organism information
 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 250/311 (80%), Positives = 282/311 (90%)

Query: 1   MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYREDLLNAADVSILCLPDV 60
           MYKIFIDGEHGTTGLKIR R++QRKDL LLS+P  ERHN+ YREDLLN AD++ILCLPD 
Sbjct: 1   MYKIFIDGEHGTTGLKIRERLLQRKDLQLLSLPSRERHNIHYREDLLNTADIAILCLPDS 60

Query: 61  ASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYAT 120
           ASLE IQLIKKNGIN+RIIDTSTAHR+A GW+YGFPEM+ SQKEKIRSA YI+NPGCYAT
Sbjct: 61  ASLETIQLIKKNGINNRIIDTSTAHRVAQGWMYGFPEMEPSQKEKIRSAHYISNPGCYAT 120

Query: 121 GAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQKNMPDTISSNHFFYSLDL 180
           GAIAILRPLRKAK++P++YPITINAVSGYTGGGKKLISRMEQKNM D+ISSNHFFYSLDL
Sbjct: 121 GAIAILRPLRKAKIIPEKYPITINAVSGYTGGGKKLISRMEQKNMVDSISSNHFFYSLDL 180

Query: 181 LHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYM 240
           LHKHLPEIT+YSLIK +P+FLPSVGRFPQGI +QI  D E+L+ KTN +E+H+IF EYY 
Sbjct: 181 LHKHLPEITKYSLIKQNPIFLPSVGRFPQGIVVQIPFDTEQLARKTNLKEIHNIFHEYYA 240

Query: 241 GQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELPYINIIAVFDNLGKGASGAA 300
           G+N +SV+ LEES KI+TI CEMM GND++ LFFF SS+LPYINIIAV DNLGKGASGAA
Sbjct: 241 GENTISVISLEESSKIETIDCEMMVGNDRMKLFFFGSSQLPYINIIAVLDNLGKGASGAA 300

Query: 301 IQNMDLLLSSL 311
           IQNMDLLLSSL
Sbjct: 301 IQNMDLLLSSL 311


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241204053|ref|YP_002975149.1| N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 310 Back     alignment and organism information
>gi|116251434|ref|YP_767272.1| N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 310 Back     alignment and organism information
>gi|161621435|ref|NP_385346.2| N-acetyl-gamma-glutamyl-phosphate reductase [Sinorhizobium meliloti 1021] Length = 310 Back     alignment and organism information
>gi|190891249|ref|YP_001977791.1| N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium etli CIAT 652] Length = 310 Back     alignment and organism information
>gi|307317800|ref|ZP_07597238.1| N-acetyl-gamma-glutamyl-phosphate reductase [Sinorhizobium meliloti AK83] Length = 310 Back     alignment and organism information
>gi|209548833|ref|YP_002280750.1| N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 310 Back     alignment and organism information
>gi|86357204|ref|YP_469096.1| N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium etli CFN 42] Length = 310 Back     alignment and organism information
>gi|150396082|ref|YP_001326549.1| N-acetyl-gamma-glutamyl-phosphate reductase [Sinorhizobium medicae WSM419] Length = 310 Back     alignment and organism information
>gi|218462205|ref|ZP_03502296.1| N-acetyl-gamma-glutamyl-phosphate reductase [Rhizobium etli Kim 5] Length = 310 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target311 N-acetyl-gamma-glutamyl-phosphate reductase [Candidatus
PRK11863313 PRK11863, PRK11863, N-acetyl-gamma-glutamyl-phosphate r 1e-140
TIGR01851310 TIGR01851, argC_other, N-acetyl-gamma-glutamyl-phosphat 2e-95
PLN02968381 PLN02968, PLN02968, Probable N-acetyl-gamma-glutamyl-ph 2e-55
COG0002349 COG0002, ArgC, Acetylglutamate semialdehyde dehydrogena 3e-67
TIGR01850346 TIGR01850, argC, N-acetyl-gamma-glutamyl-phosphate redu 1e-36
PRK00436343 PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate reduc 4e-36
KOG4354340 KOG4354, KOG4354, KOG4354, N-acetyl-gamma-glutamyl-phos 2e-30
smart00859122 smart00859, Semialdhyde_dh, Semialdehyde dehydrogenase, 7e-11
pfam01118121 pfam01118, Semialdhyde_dh, Semialdehyde dehydrogenase, 7e-10
COG0136334 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Ami 3e-04
TIGR00978341 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase 0.003
>gnl|CDD|183344 PRK11863, PRK11863, N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|162560 TIGR01851, argC_other, N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>gnl|CDD|178552 PLN02968, PLN02968, Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>gnl|CDD|30351 COG0002, ArgC, Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162559 TIGR01850, argC, N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>gnl|CDD|179024 PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>gnl|CDD|39555 KOG4354, KOG4354, KOG4354, N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|129092 smart00859, Semialdhyde_dh, Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|144637 pfam01118, Semialdhyde_dh, Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|30485 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162144 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 311 N-acetyl-gamma-glutamyl-phosphate reductase [Candidatus
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 100.0
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 100.0
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 100.0
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 100.0
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
TIGR01296350 asd_B aspartate-semialdehyde dehydrogenase; InterPro: I 100.0
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK08040337 putative semialdehyde dehydrogenase; Provisional 100.0
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 100.0
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 100.0
PRK06901323 aspartate-semialdehyde dehydrogenase; Provisional 100.0
TIGR01851314 argC_other N-acetyl-gamma-glutamyl-phosphate reductase; 100.0
KOG4354340 consensus 100.0
KOG4777361 consensus 100.0
TIGR01745367 asd_gamma aspartate-semialdehyde dehydrogenase; InterPr 99.78
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisional 99.44
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose 99.36
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 99.33
PRK08955333 glyceraldehyde-3-phosphate dehydrogenase; Validated 99.32
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 99.17
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validated 99.16
PRK08289479 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 98.91
TIGR01532334 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase; In 98.8
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 99.96
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 99.96
PRK08300298 acetaldehyde dehydrogenase; Validated 98.73
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 98.58
PRK13303265 L-aspartate dehydrogenase; Provisional 98.14
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.08
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 98.04
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.02
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondar 97.98
PRK00048265 dihydrodipicolinate reductase; Provisional 97.84
CHL00194319 ycf39 Ycf39; Provisional 97.76
PRK08655 441 prephenate dehydrogenase; Provisional 97.7
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.63
PRK08507275 prephenate dehydrogenase; Validated 97.61
TIGR01921326 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR0101 97.59
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 97.59
PRK11579346 putative oxidoreductase; Provisional 97.51
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.49
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 97.44
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 97.4
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 97.34
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.3
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.26
PRK10206345 putative dehydrogenase; Provisional 97.24
pfam00044150 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD b 97.22
PRK06545357 prephenate dehydrogenase; Validated 97.17
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 97.15
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD b 97.08
PRK07417280 arogenate dehydrogenase; Reviewed 97.06
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 97.05
COG2085211 Predicted dinucleotide-binding enzymes [General functio 97.02
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 97.01
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 96.89
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 96.86
COG2910211 Putative NADH-flavin reductase [General function predic 96.8
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 96.78
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 96.73
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 96.55
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 96.49
PRK08818373 prephenate dehydrogenase; Provisional 96.41
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 96.23
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 96.16
COG1042 598 Acyl-CoA synthetase (NDP forming) [Energy production an 96.11
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 96.01
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 96.0
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 95.94
PRK08374316 homoserine dehydrogenase; Provisional 95.93
PRK11559295 garR tartronate semialdehyde reductase; Provisional 95.88
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 95.84
PRK06270342 homoserine dehydrogenase; Provisional 95.83
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 95.78
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 95.72
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.64
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.51
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+ 95.48
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 95.44
PRK06349432 homoserine dehydrogenase; Provisional 95.4
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 95.24
pfam00899134 ThiF ThiF family. This family contains a repeated domai 95.18
COG5322351 Predicted dehydrogenase [General function prediction on 95.05
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 95.0
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.98
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 94.82
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.79
PRK09117282 consensus 94.76
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 94.71
PRK12439340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 94.71
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.56
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.56
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 94.54
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transport and 94.52
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase WecG/Tag 94.49
pfam03808172 Glyco_tran_WecB Glycosyl transferase WecB/TagA/CpsF fam 94.44
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 94.4
PRK07660283 consensus 94.38
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 94.35
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 94.24
PRK06813341 homoserine dehydrogenase; Validated 94.2
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 94.11
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.1
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.07
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 94.0
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.0
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 93.91
PRK07680273 late competence protein ComER; Validated 93.73
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 93.71
PRK06444197 prephenate dehydrogenase; Provisional 93.62
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 93.54
PRK05562222 precorrin-2 dehydrogenase; Provisional 93.31
PRK06392326 homoserine dehydrogenase; Provisional 93.15
PRK06719157 precorrin-2 dehydrogenase; Validated 93.0
KOG2711372 consensus 92.96
PRK12416 466 protoporphyrinogen oxidase; Provisional 92.9
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 92.63
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.2
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 92.15
PRK11728400 hypothetical protein; Provisional 92.06
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 91.89
TIGR02717 457 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP formi 91.79
TIGR01915233 npdG NADPH-dependent F420 reductase; InterPro: IPR01018 91.7
PRK10124464 putative UDP-glucose lipid carrier transferase; Provisi 91.66
COG3804350 Uncharacterized conserved protein related to dihydrodip 91.52
PRK01368 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.31
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.28
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 91.11
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 90.79
PRK10430239 DNA-binding transcriptional activator DcuR; Provisional 90.66
PRK08666261 5'-methylthioadenosine phosphorylase; Validated 90.41
PRK08328230 hypothetical protein; Provisional 90.36
TIGR01759329 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 90.27
pfam02774167 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerizatio 99.92
PRK04207338 glyceraldehyde-3-phosphate dehydrogenase; Provisional 99.08
TIGR01534366 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type 98.43
TIGR01546335 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenas 95.85
PTZ00325313 malate dehydrogenase; Provisional 98.06
PRK05447379 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 97.64
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 97.45
PRK05086312 malate dehydrogenase; Provisional 97.39
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 97.35
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 97.24
PTZ00117313 malate dehydrogenase; Provisional 97.15
pfam02670129 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoi 96.96
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 96.95
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 96.89
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 96.86
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 96.8
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 96.72
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 96.72
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 96.67
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 96.6
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 96.6
KOG1502327 consensus 96.46
PTZ00082322 L-lactate dehydrogenase; Provisional 96.45
PRK05442325 malate dehydrogenase; Provisional 96.41
PRK06223312 malate dehydrogenase; Reviewed 96.4
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 96.37
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 96.29
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 96.29
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 96.26
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 96.12
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.05
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 95.91
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 95.85
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 95.83
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 95.67
PRK12367250 short chain dehydrogenase; Provisional 95.53
PRK12464392 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 95.17
COG0743385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Li 95.16
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 95.11
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 94.82
KOG1430361 consensus 94.68
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 94.66
KOG1203411 consensus 94.6
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 94.51
TIGR00243406 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase; In 94.36
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 94.23
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 94.2
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 93.99
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 93.62
KOG1494345 consensus 93.54
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [Gener 93.54
PRK09897 535 hypothetical protein; Provisional 93.49
TIGR02964270 xanthine_xdhC xanthine dehydrogenase accessory protein 93.13
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 92.37
PRK10675338 UDP-galactose-4-epimerase; Provisional 91.16
cd04510334 consensus 90.88
KOG2666 481 consensus 90.69
TIGR01746405 Thioester-redct thioester reductase domain; InterPro: I 90.53
KOG4039238 consensus 97.98
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 97.82
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 96.97
COG2344211 AT-rich DNA-binding protein [General function predictio 96.76
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.12
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.15
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3. 94.77
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.61
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.77
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 93.44
PRK09496 455 trkA potassium transporter peripheral membrane componen 93.4
PRK06249313 2-dehydropantoate 2-reductase; Provisional 93.3
KOG2741351 consensus 93.03
KOG1198347 consensus 93.02
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.84
KOG2013 603 consensus 91.37
PRK12921306 2-dehydropantoate 2-reductase; Provisional 91.31
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.26
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.32
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 97.21
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 97.03
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 96.87
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.65
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 96.53
COG3268382 Uncharacterized conserved protein [Function unknown] 95.56
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 95.41
TIGR01777307 yfcH conserved hypothetical protein TIGR01777; InterPro 94.94
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 94.26
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 93.86
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 90.39
PRK06153393 hypothetical protein; Provisional 96.74
PRK06487317 glycerate dehydrogenase; Provisional 92.27
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 91.16
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 96.5
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 94.44
PRK06436303 glycerate dehydrogenase; Provisional 90.34
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase; InterPro: IPR000706 N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase; InterPro: IPR005986 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: IPR005676 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase; InterPro: IPR010136 N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms Back     alignment and domain information
>KOG4354 consensus Back     alignment and domain information
>KOG4777 consensus Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase; InterPro: IPR011534 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase; InterPro: IPR006422 This group of sequences represent the small clade of dehydrogenases in gamma-proteobacteria which utilise NAD+ to oxidize erythrose-4-phosphate (E4P) to 4-phospho-erythronate, a precursor for the de novo synthesis of pyridoxine via 4-hydroxythreonine and D-1-deoxyxylulose Back     alignment and domain information
>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>pfam03435 Saccharop_dh Saccharopine dehydrogenase Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR010190 This entry represents the diaminopimelate dehydrogenase enzyme which provides an alternate (shortcut) route of lysine biosynthesis in Corynebacterium, Bacterioides, Porphyromonas and other species Back     alignment and domain information
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK10206 putative dehydrogenase; Provisional Back     alignment and domain information
>pfam00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>pfam03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>pfam03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>pfam00899 ThiF ThiF family Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09117 consensus Back     alignment and domain information
>pfam10727 Rossmann-like Rossmann-like domain Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>pfam03808 Glyco_tran_WecB Glycosyl transferase WecB/TagA/CpsF family Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK07660 consensus Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>pfam02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>pfam02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>KOG2711 consensus Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>pfam00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11728 hypothetical protein; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089 This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase; InterPro: IPR010185 Members of this family are found only in species with evidence of coenzyme F420 Back     alignment and domain information
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK08666 5'-methylthioadenosine phosphorylase; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 Malate dehydrogenases catalyse the interconversion of malate and oxaloacetate using dinucleotide cofactors Back     alignment and domain information
>pfam02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerization domain Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I; InterPro: IPR006424 This group of sequences represent glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II; InterPro: IPR006436 This family describes the type II glyceraldehyde-3-phosphate dehydrogenases which are limited to archaea Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>pfam02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>KOG1502 consensus Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12464 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam04321 RmlD_sub_bind RmlD substrate binding domain Back     alignment and domain information
>KOG1430 consensus Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1203 consensus Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR003821 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesizes 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>KOG1494 consensus Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC; InterPro: IPR014308 Members of this protein are the accessory protein XdhC, found in baceria, that is responsible for insertion of the molybdenum cofactor into the xanthine dehydrogenase large chain, XdhB Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>cd04510 consensus Back     alignment and domain information
>KOG2666 consensus Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain; InterPro: IPR010080 This domain includes the C-terminal domain from the fungal alpha aminoadipate reductase enzyme (also known as aminoadipate semialdehyde dehydrogenase) which is involved in the biosynthesis of lysine , as well as the reductase-containing component of the myxochelin biosynthetic gene cluster, MxcG Back     alignment and domain information
>KOG4039 consensus Back     alignment and domain information
>pfam05368 NmrA NmrA-like family Back     alignment and domain information
>pfam02629 CoA_binding CoA binding domain Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG2741 consensus Back     alignment and domain information
>KOG1198 consensus Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2013 consensus Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information