254780295

254780295

tRNA pseudouridine synthase A

GeneID in NCBI database:8209277Locus tag:CLIBASIA_00900
Protein GI in NCBI database:254780295Protein Accession:YP_003064708.1
Gene range:-(185481, 186224)Protein Length:247aa
Gene description:tRNA pseudouridine synthase A
COG prediction:[J] Pseudouridylate synthase
KEGG prediction:truA; tRNA pseudouridine synthase A (EC:5.4.99.12); K06173 tRNA pseudouridine synthase A [EC:5.4.99.12]
SEED prediction:tRNA pseudouridine synthase A (EC 4.2.1.70)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing;
tRNA modification Archaea
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVEYS
ccEEEEEEEEccccccccccccccccHHHHHHHHHHHHccccEEEEEEEccccccccccEEEEEEEcccccHHHHHHHHHHHccccccEEEEEEEEcccccccEEcccEEEEEEEEEccccccccccccEEEccccccHHHHHHHHHHHcccccHHHHHcccccccccEEEEEEEEEEEEccEEEEEEEEccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccEEEEEEcc
ccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHccccccEEccccccccEEEEEEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEEccccccHHEcccccEEEEEEEccccccHHHccccEEccccccHHHHHHHHHHHcEEEEcHHHccccccccccEEEEEEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHcccccccHHHHHHHHccHHHcccccccccEEEEEEEcc
MIRYCMIIeyngsgyfgwqrqkngssiqGSIEKAIFLVTGEIVVVhgagrtdsgvhALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEkgrawlipksldcENMRIAAQHLvgrhdfttfrsihcqasspirtidhfdvnsfgnLIEIRVVARSFLHTQIRSFVGSlklvgdgkwtSTDLEKALQaqdrkecgplappeglyfdsveys
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALqaqdrkecgplappeglyfdsveys
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVEYS
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVEYS
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVEYS
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVEYS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVEYS
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVEYS
MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVEYS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target247 tRNA pseudouridine synthase A [Candidatus Liberibacter
315122856247 tRNA pseudouridine synthase A [Candidatus Liberibacter 1 1e-119
222084710266 tRNA pseudouridine synthase A [Agrobacterium radiobacte 1 1e-89
86356072267 tRNA pseudouridine synthase A [Rhizobium etli CFN 42] L 1 3e-89
327191110266 tRNA-pseudouridine synthase I protein [Rhizobium etli C 1 4e-89
190890088266 tRNA-pseudouridine synthase I protein [Rhizobium etli C 1 2e-88
116250203272 tRNA pseudouridine synthase A [Rhizobium leguminosarum 1 3e-87
15964174247 tRNA pseudouridine synthase A [Sinorhizobium meliloti 1 1 3e-87
241202830272 tRNA pseudouridine synthase A [Rhizobium leguminosarum 1 4e-87
307317990247 tRNA pseudouridine synthase A [Sinorhizobium meliloti A 1 4e-87
227820646247 tRNA pseudouridine synthase A [Sinorhizobium fredii NGR 1 7e-87
>gi|315122856|ref|YP_004063345.1| tRNA pseudouridine synthase A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 247 Back     alignment and organism information
 Score =  430 bits (1106), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 203/247 (82%), Positives = 222/247 (89%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           MIRYC+IIEY+GSGY GWQRQKNG SIQG IEKAIFLVTGE + V+GAGRTDSGVHALRQ
Sbjct: 1   MIRYCLIIEYDGSGYVGWQRQKNGVSIQGEIEKAIFLVTGESMTVYGAGRTDSGVHALRQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDLVREWVP  LCKALNA+L IS+ ISIL L +VD++FHARFSAIRRSYLYRIITRQ
Sbjct: 61  VAHFDLVREWVPEKLCKALNAHLNISNDISILELCVVDEKFHARFSAIRRSYLYRIITRQ 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APLALEKGRAW  PK LDCE MR+AAQHL+G+HDFTTFRS+ CQA SPIRTID  D+N  
Sbjct: 121 APLALEKGRAWWFPKDLDCEMMRVAAQHLIGKHDFTTFRSVQCQALSPIRTIDRLDINRL 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G++IEIRVVARSFLHTQIRSFVGSLKLVGD KWTS DL+KAL+AQDRK CGPL+P EGLY
Sbjct: 181 GDMIEIRVVARSFLHTQIRSFVGSLKLVGDRKWTSDDLQKALKAQDRKACGPLSPSEGLY 240

Query: 241 FDSVEYS 247
           FDSVEYS
Sbjct: 241 FDSVEYS 247


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084710|ref|YP_002543239.1| tRNA pseudouridine synthase A [Agrobacterium radiobacter K84] Length = 266 Back     alignment and organism information
>gi|86356072|ref|YP_467964.1| tRNA pseudouridine synthase A [Rhizobium etli CFN 42] Length = 267 Back     alignment and organism information
>gi|327191110|gb|EGE58158.1| tRNA-pseudouridine synthase I protein [Rhizobium etli CNPAF512] Length = 266 Back     alignment and organism information
>gi|190890088|ref|YP_001976630.1| tRNA-pseudouridine synthase I protein [Rhizobium etli CIAT 652] Length = 266 Back     alignment and organism information
>gi|116250203|ref|YP_766041.1| tRNA pseudouridine synthase A [Rhizobium leguminosarum bv. viciae 3841] Length = 272 Back     alignment and organism information
>gi|15964174|ref|NP_384527.1| tRNA pseudouridine synthase A [Sinorhizobium meliloti 1021] Length = 247 Back     alignment and organism information
>gi|241202830|ref|YP_002973926.1| tRNA pseudouridine synthase A [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 272 Back     alignment and organism information
>gi|307317990|ref|ZP_07597427.1| tRNA pseudouridine synthase A [Sinorhizobium meliloti AK83] Length = 247 Back     alignment and organism information
>gi|227820646|ref|YP_002824616.1| tRNA pseudouridine synthase A [Sinorhizobium fredii NGR234] Length = 247 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target247 tRNA pseudouridine synthase A [Candidatus Liberibacter
PRK00021244 PRK00021, truA, tRNA pseudouridine synthase A; Validate 8e-95
COG0101266 COG0101, TruA, Pseudouridylate synthase [Translation, r 3e-79
TIGR00071227 TIGR00071, hisT_truA, pseudouridylate synthase I 2e-53
PRK12434245 PRK12434, PRK12434, tRNA pseudouridine synthase A; Revi 1e-50
PRK14586245 PRK14586, PRK14586, tRNA pseudouridine synthase ACD; Pr 7e-49
cd00497224 cd00497, PseudoU_synth_TruA_like, PseudoU_synth_TruA: P 4e-39
PRK14588272 PRK14588, PRK14588, tRNA pseudouridine synthase ACD; Pr 6e-39
KOG4393295 KOG4393, KOG4393, KOG4393, Predicted pseudouridylate sy 1e-34
cd02866221 cd02866, PseudoU_synth_TruA_Archea, PseudoU_synth_arche 7e-33
PRK14589265 PRK14589, PRK14589, tRNA pseudouridine synthase ACD; Pr 2e-23
cd02568245 cd02568, PseudoU_synth_PUS1_PUS2, PseudoU_synth_PUS1_PU 3e-19
KOG2554 425 KOG2554, KOG2554, KOG2554, Pseudouridylate synthase [Tr 2e-18
KOG2553416 KOG2553, KOG2553, KOG2553, Pseudouridylate synthase [Tr 1e-16
PRK14587256 PRK14587, PRK14587, tRNA pseudouridine synthase ACD; Pr 6e-13
cd02570239 cd02570, PseudoU_synth_EcTruA, PseudoU_synth_EcTruA: Ps 2e-85
pfam01416103 pfam01416, PseudoU_synth_1, tRNA pseudouridine synthase 5e-19
cd02569256 cd02569, PseudoU_synth_ScPus3, PseudoU_synth_ScPus3-lik 5e-18
pfam01416103 pfam01416, PseudoU_synth_1, tRNA pseudouridine synthase 3e-04
PLN03078 513 PLN03078, PLN03078, Putative tRNA pseudouridine synthas 7e-04
>gnl|CDD|178798 PRK00021, truA, tRNA pseudouridine synthase A; Validated Back     alignment and domain information
>gnl|CDD|30450 COG0101, TruA, Pseudouridylate synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161691 TIGR00071, hisT_truA, pseudouridylate synthase I Back     alignment and domain information
>gnl|CDD|171495 PRK12434, PRK12434, tRNA pseudouridine synthase A; Reviewed Back     alignment and domain information
>gnl|CDD|173050 PRK14586, PRK14586, tRNA pseudouridine synthase ACD; Provisional Back     alignment and domain information
>gnl|CDD|30005 cd00497, PseudoU_synth_TruA_like, PseudoU_synth_TruA: Pseudouridine synthase, TruA family Back     alignment and domain information
>gnl|CDD|173052 PRK14588, PRK14588, tRNA pseudouridine synthase ACD; Provisional Back     alignment and domain information
>gnl|CDD|39594 KOG4393, KOG4393, KOG4393, Predicted pseudouridylate synthase [RNA processing and modification, Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30026 cd02866, PseudoU_synth_TruA_Archea, PseudoU_synth_archea: Pseudouridine synthase, Back     alignment and domain information
>gnl|CDD|173053 PRK14589, PRK14589, tRNA pseudouridine synthase ACD; Provisional Back     alignment and domain information
>gnl|CDD|73314 cd02568, PseudoU_synth_PUS1_PUS2, PseudoU_synth_PUS1_PUS2: Pseudouridine synthase, PUS1/ PUS2 like Back     alignment and domain information
>gnl|CDD|37765 KOG2554, KOG2554, KOG2554, Pseudouridylate synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|37764 KOG2553, KOG2553, KOG2553, Pseudouridylate synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173051 PRK14587, PRK14587, tRNA pseudouridine synthase ACD; Provisional Back     alignment and domain information
>gnl|CDD|30020 cd02570, PseudoU_synth_EcTruA, PseudoU_synth_EcTruA: Pseudouridine synthase, Escherichia coli TruA like Back     alignment and domain information
>gnl|CDD|144857 pfam01416, PseudoU_synth_1, tRNA pseudouridine synthase Back     alignment and domain information
>gnl|CDD|30019 cd02569, PseudoU_synth_ScPus3, PseudoU_synth_ScPus3-like: Pseudouridine synthase, Saccharomyces cerevisiae Pus3 like Back     alignment and domain information
>gnl|CDD|144857 pfam01416, PseudoU_synth_1, tRNA pseudouridine synthase Back     alignment and domain information
>gnl|CDD|178627 PLN03078, PLN03078, Putative tRNA pseudouridine synthase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 247 tRNA pseudouridine synthase A [Candidatus Liberibacter
PRK00021244 truA tRNA pseudouridine synthase A; Validated 100.0
PRK12434245 tRNA pseudouridine synthase A; Reviewed 100.0
COG0101266 TruA Pseudouridylate synthase [Translation, ribosomal s 100.0
cd02570239 PseudoU_synth_EcTruA PseudoU_synth_EcTruA: Pseudouridin 100.0
cd00497224 PseudoU_synth_TruA_like PseudoU_synth_TruA: Pseudouridi 100.0
TIGR00071326 hisT_truA tRNA pseudouridine synthase A; InterPro: IPR0 100.0
cd02866221 PseudoU_synth_TruA_Archea PseudoU_synth_archea: Pseudou 100.0
cd02569256 PseudoU_synth_ScPus3 PseudoU_synth_ScPus3-like: Pseudou 100.0
cd02568245 PseudoU_synth_PUS1_PUS2 PseudoU_synth_PUS1_PUS2: Pseudo 100.0
KOG2553416 consensus 100.0
KOG4393295 consensus 100.0
KOG2554 425 consensus 100.0
pfam01416103 PseudoU_synth_1 tRNA pseudouridine synthase. Involved i 99.96
pfam10105186 DUF2344 Uncharacterized protein conserved in bacteria ( 96.96
COG1258398 Predicted pseudouridylate synthase [Translation, riboso 91.9
>PRK00021 truA tRNA pseudouridine synthase A; Validated Back     alignment and domain information
>PRK12434 tRNA pseudouridine synthase A; Reviewed Back     alignment and domain information
>COG0101 TruA Pseudouridylate synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02570 PseudoU_synth_EcTruA PseudoU_synth_EcTruA: Pseudouridine synthase, Escherichia coli TruA like Back     alignment and domain information
>cd00497 PseudoU_synth_TruA_like PseudoU_synth_TruA: Pseudouridine synthase, TruA family Back     alignment and domain information
>TIGR00071 hisT_truA tRNA pseudouridine synthase A; InterPro: IPR001406 Transfer RNA-pseudouridine synthetase contains one atom of zinc essential for its native conformation and tRNA recognition and has a strictly conserved aspartic acid that is likely to be involved in catalysis Back     alignment and domain information
>cd02866 PseudoU_synth_TruA_Archea PseudoU_synth_archea: Pseudouridine synthase, Back     alignment and domain information
>cd02569 PseudoU_synth_ScPus3 PseudoU_synth_ScPus3-like: Pseudouridine synthase, Saccharomyces cerevisiae Pus3 like Back     alignment and domain information
>cd02568 PseudoU_synth_PUS1_PUS2 PseudoU_synth_PUS1_PUS2: Pseudouridine synthase, PUS1/ PUS2 like Back     alignment and domain information
>KOG2553 consensus Back     alignment and domain information
>KOG4393 consensus Back     alignment and domain information
>KOG2554 consensus Back     alignment and domain information
>pfam01416 PseudoU_synth_1 tRNA pseudouridine synthase Back     alignment and domain information
>pfam10105 DUF2344 Uncharacterized protein conserved in bacteria (DUF2344) Back     alignment and domain information
>COG1258 Predicted pseudouridylate synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target247 tRNA pseudouridine synthase A [Candidatus Liberibacter
1dj0_A264 The Crystal Structure Of E. Coli Pseudouridine Synt 2e-46
2nqp_A270 Crystal Structure Of Pseudoudirinde Synthase Trua I 3e-46
1vs3_A249 Crystal Structure Of The Trna Pseudouridine Synthas 3e-38
>gi|8569326|pdb|1DJ0|A Chain A, The Crystal Structure Of E. Coli Pseudouridine Synthase I At 1.5 Angstrom Resolution Length = 264 Back     alignment and structure
 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 5   KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 64

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 65  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLR 122

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 123 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 182

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 183 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 242

Query: 243 SVEY 246
           +V+Y
Sbjct: 243 AVDY 246


gi|149242461|pdb|2NQP|A Chain A, Crystal Structure Of Pseudoudirinde Synthase Trua In Complex With Leucyl Trna Length = 270 Back     alignment and structure
>gi|122919612|pdb|1VS3|A Chain A, Crystal Structure Of The Trna Pseudouridine Synthase Trua From Thermus Thermophilus Hb8 Length = 249 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target247 tRNA pseudouridine synthase A [Candidatus Liberibacter
1dj0_A264 Pseudouridine synthase I; alpha/beta fold, RNA-binding 9e-74
1vs3_A249 TRNA pseudouridine synthase A; TRUA, tRNA modification, 5e-44
>1dj0_A Pseudouridine synthase I; alpha/beta fold, RNA-binding motif, RNA-modifying enzyme, lyase; 1.50A {Escherichia coli} SCOP: d.265.1.1 PDB: 2nqp_A 2nr0_A 2nre_A Length = 264 Back     alignment and structure
 Score =  271 bits (695), Expect = 9e-74
 Identities = 90/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           + +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   Q
Sbjct: 3   VYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +
Sbjct: 63  VVHFETTALRKDAAWTLGVNANLP--GDIAVRWVKTVPDDFHARFSATARRYRYIIYNHR 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   
Sbjct: 121 LRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRH 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY
Sbjct: 181 GPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLY 240

Query: 241 FDSVEY 246
             +V+Y
Sbjct: 241 LVAVDY 246


>1vs3_A TRNA pseudouridine synthase A; TRUA, tRNA modification, structural genomics, NPPSFA; 2.25A {Thermus thermophilus HB8} Length = 249 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target247 tRNA pseudouridine synthase A [Candidatus Liberibacter
1dj0_A264 Pseudouridine synthase I; alpha/beta fold, RNA-binding 100.0
1vs3_A249 TRNA pseudouridine synthase A; TRUA, tRNA modification, 100.0
>1dj0_A Pseudouridine synthase I; alpha/beta fold, RNA-binding motif, RNA-modifying enzyme, lyase; 1.50A {Escherichia coli} SCOP: d.265.1.1 PDB: 2nqp_A 2nr0_A 2nre_A Back     alignment and structure
Probab=100.00  E-value=0  Score=542.11  Aligned_cols=245  Identities=37%  Similarity=0.573  Sum_probs=239.6

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEEEEECCCCCCHHHHHHHH
Q ss_conf             92299999971668720048753877889999999997099569997112138612223468864063211046899999
Q gi|254780295|r    1 MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALN   80 (247)
Q Consensus         1 M~r~~~~i~YdGt~y~G~q~Q~~~~TVq~~le~aL~~~~~~~~~~~~a~RTD~GVhA~~qv~~f~~~~~~~~~~~~~~lN   80 (247)
                      |.||++.|+||||+|+|||+||+.+||||+||+||.+++++++.+.+|||||+||||++||+||+++...+.+.+...||
T Consensus         3 ~~r~~l~i~Y~Gt~y~G~Q~Q~~~~TVq~~Le~aL~~~~~~~i~~~~agRTD~GVHA~~qv~~~~~~~~~~~~~~~~~ln   82 (264)
T 1dj0_A            3 VYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVN   82 (264)
T ss_dssp             CEEEEEEEEECCTTSSCSCCTTCSSCHHHHHHHHHHHHHTSCCCEEESSCCCTTCEEEEEEEEEEESCCCCHHHHHHHHH
T ss_pred             CEEEEEEEEEECCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             47999999997987216658889969999999999997399738998678857837050168988312114688988887


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCEECCCCEEEEEEEEECCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHEEEECC
Q ss_conf             86188876543443226777550002100223556852443202333210244333335665565676520011001024
Q gi|254780295|r   81 AYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRS  160 (247)
Q Consensus        81 ~~L~~p~~Irv~~~~~v~~~FhaR~~a~~R~Y~Y~i~~~~~~~~~~~~~~~~~~~~lD~~~l~~a~~~l~G~HdF~~F~~  160 (247)
                      +.|  |+||+|+++.+|+++||||++|++|+|+|+++++..++++.+.+.|+...++|+++|++|++.|+|+|||++||+
T Consensus        83 ~~L--p~dI~i~~~~~v~~~F~aR~~a~~r~Y~Y~i~~~~~~~~~~~~~~~~~~~~lD~~~m~~a~~~~~G~HdF~~F~~  160 (264)
T 1dj0_A           83 ANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRA  160 (264)
T ss_dssp             HTS--CTTEEEEEEEECCTTCCTTTTCCEEEEEEEEECSSSCCCTTTTSSEECCSCCCHHHHHHHHGGGCEEEECGGGCC
T ss_pred             HCC--CCEEEEEEEEECCCCCCCCCCCCEEEEEEEEECCCCCCHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEC
T ss_conf             309--824788554205998660103787999987644756864440243356766788999999997768577575330


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
Q ss_conf             56553332110331111233320011315888899999999999999976899888999998358821166636989847
Q gi|254780295|r  161 IHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY  240 (247)
Q Consensus       161 ~~~~~~~~~R~I~~~~v~~~~~~i~i~i~g~~FL~~mVR~mVG~li~v~~g~~~~~~i~~~L~~~~r~~~~~~APa~GL~  240 (247)
                      .+++.++++|++..+++.+.++++.|+|+|+||||||||+|||+|++||+|++++++|+++|+.+++...+++|||+||+
T Consensus       161 ~~~~~~~~~r~i~~~~~~~~~~~i~~~i~g~sFL~~qVR~mVg~ll~vg~g~~~~~~i~~~L~~~~r~~~~~~APa~GL~  240 (264)
T 1dj0_A          161 VQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLY  240 (264)
T ss_dssp             TTCCCSCCEEEEEEEEEEEETTEEEEEEEESCCCTTHHHHHHHHHHHHHTTSSCTTHHHHHHHHCCGGGSCCCCCSTTEE
T ss_pred             CCCCCCCCCCCEEEEEEEECCCEEEEEEEHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
T ss_conf             56678887642057889973868999998337799999999999999987999999999998668866686645898767


Q ss_pred             EEEEEEC
Q ss_conf             6330439
Q gi|254780295|r  241 FDSVEYS  247 (247)
Q Consensus       241 L~~V~Y~  247 (247)
                      |++|+|.
T Consensus       241 L~~V~Y~  247 (264)
T 1dj0_A          241 LVAVDYP  247 (264)
T ss_dssp             EEEEECC
T ss_pred             ECCCCCC
T ss_conf             8543378



>1vs3_A TRNA pseudouridine synthase A; TRUA, tRNA modification, structural genomics, NPPSFA; 2.25A {Thermus thermophilus HB8} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 247 tRNA pseudouridine synthase A [Candidatus Liberibacter
d1dj0a_264 d.265.1.1 (A:) Pseudouridine synthase I TruA {Escherich 7e-45
>d1dj0a_ d.265.1.1 (A:) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]} Length = 264 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Pseudouridine synthase
superfamily: Pseudouridine synthase
family: Pseudouridine synthase I TruA
domain: Pseudouridine synthase I TruA
species: Escherichia coli [TaxId: 562]
 Score =  174 bits (441), Expect = 7e-45
 Identities = 89/246 (36%), Positives = 128/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           + +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   Q
Sbjct: 3   VYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+             +NA L     +  +    V   FHARFSA  R Y Y I   +
Sbjct: 63  VVHFETTALRKDAAWTLGVNANLPGDIAVRWVK--TVPDDFHARFSATARRYRYIIYNHR 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   
Sbjct: 121 LRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRH 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY
Sbjct: 181 GPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLY 240

Query: 241 FDSVEY 246
             +V+Y
Sbjct: 241 LVAVDY 246


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target247 tRNA pseudouridine synthase A [Candidatus Liberibacter
d1dj0a_264 Pseudouridine synthase I TruA {Escherichia coli [TaxId: 100.0
>d1dj0a_ d.265.1.1 (A:) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Pseudouridine synthase
superfamily: Pseudouridine synthase
family: Pseudouridine synthase I TruA
domain: Pseudouridine synthase I TruA
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=540.27  Aligned_cols=245  Identities=37%  Similarity=0.573  Sum_probs=239.4

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEEEEECCCCCCHHHHHHHH
Q ss_conf             92299999971668720048753877889999999997099569997112138612223468864063211046899999
Q gi|254780295|r    1 MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALN   80 (247)
Q Consensus         1 M~r~~~~i~YdGt~y~G~q~Q~~~~TVq~~le~aL~~~~~~~~~~~~a~RTD~GVhA~~qv~~f~~~~~~~~~~~~~~lN   80 (247)
                      |.||++.|+||||+|+|||+||+.+||||+||+||.+++++++.+.+|||||+||||++||+||+++...+.+.+...||
T Consensus         3 ~~r~al~i~Y~Gt~f~G~Q~Q~~~~TVq~~Le~aL~~~~~~~~~~~~agRTD~GVhA~~qv~~~~~~~~~~~~~~~~~lN   82 (264)
T d1dj0a_           3 VYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVN   82 (264)
T ss_dssp             CEEEEEEEEECCTTSSCSCCTTCSSCHHHHHHHHHHHHHTSCCCEEESSCCCTTCEEEEEEEEEEESCCCCHHHHHHHHH
T ss_pred             CEEEEEEEEEECCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCEEEEEEEEEECCCHHHHHHHCCCC
T ss_conf             47999999997997125758969979999999999996399738998402467733166799975122000111000001


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCEECCCCEEEEEEEEECCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHEEEECC
Q ss_conf             86188876543443226777550002100223556852443202333210244333335665565676520011001024
Q gi|254780295|r   81 AYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRS  160 (247)
Q Consensus        81 ~~L~~p~~Irv~~~~~v~~~FhaR~~a~~R~Y~Y~i~~~~~~~~~~~~~~~~~~~~lD~~~l~~a~~~l~G~HdF~~F~~  160 (247)
                      +.|  |+||+|+++.+|+++||||++|++|+|+|++.++..++++.+.+.|+...++|+++|++|++.|+|+|||++||+
T Consensus        83 ~~L--p~dI~i~~~~~v~~~F~aR~~a~~r~Y~Y~i~~~~~~~~~~~~~~~~~~~~ld~~~m~~a~~~~~G~hdF~~F~~  160 (264)
T d1dj0a_          83 ANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRA  160 (264)
T ss_dssp             HTS--CTTEEEEEEEECCTTCCTTTTCCEEEEEEEEECSSSCCCTTTTSSEECCSCCCHHHHHHHHGGGCEEEECGGGCC
T ss_pred             CCC--CCCCCCCCCEECCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             234--423110000001665440033331243002013445663223321024677656888877763367541111211


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
Q ss_conf             56553332110331111233320011315888899999999999999976899888999998358821166636989847
Q gi|254780295|r  161 IHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY  240 (247)
Q Consensus       161 ~~~~~~~~~R~I~~~~v~~~~~~i~i~i~g~~FL~~mVR~mVG~li~v~~g~~~~~~i~~~L~~~~r~~~~~~APa~GL~  240 (247)
                      .++..++++|++..+++.+.++++.|+|+|+||||||||+|||+|++||+|++++++|+++|+++++....++|||+|||
T Consensus       161 ~~~~~~~~~r~i~~~~~~~~~~~i~i~i~g~sFL~~qVR~mvg~ll~vg~g~~~~~~i~~~L~~~~r~~~~~~APa~GL~  240 (264)
T d1dj0a_         161 VQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLY  240 (264)
T ss_dssp             TTCCCSCCEEEEEEEEEEEETTEEEEEEEESCCCTTHHHHHHHHHHHHHTTSSCTTHHHHHHHHCCGGGSCCCCCSTTEE
T ss_pred             CCCCCCCCCCCCCCCCCEECCCEEEEEECHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
T ss_conf             45557774222211011014837998741037999999999999999976999999999998668856685644898878


Q ss_pred             EEEEEEC
Q ss_conf             6330439
Q gi|254780295|r  241 FDSVEYS  247 (247)
Q Consensus       241 L~~V~Y~  247 (247)
                      |++|+|.
T Consensus       241 L~~V~Y~  247 (264)
T d1dj0a_         241 LVAVDYP  247 (264)
T ss_dssp             EEEEECC
T ss_pred             ECCCCCC
T ss_conf             7555368



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 247 tRNA pseudouridine synthase A [Candidatus Liberiba
1dj0_A_264 (A:) Pseudouridine synthase I; alpha/beta fold, RN 6e-55
1vs3_A_249 (A:) TRNA pseudouridine synthase A; TRUA, tRNA mod 5e-52
>1dj0_A (A:) Pseudouridine synthase I; alpha/beta fold, RNA-binding motif, RNA-modifying enzyme, lyase; 1.50A {Escherichia coli}Length = 264 Back     alignment and structure
 Score =  208 bits (530), Expect = 6e-55
 Identities = 90/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           + +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   Q
Sbjct: 3   VYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +
Sbjct: 63  VVHFETTALRKDAAWTLGVNANLP--GDIAVRWVKTVPDDFHARFSATARRYRYIIYNHR 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   
Sbjct: 121 LRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRH 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY
Sbjct: 181 GPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLY 240

Query: 241 FDSVEY 246
             +V+Y
Sbjct: 241 LVAVDY 246


>1vs3_A (A:) TRNA pseudouridine synthase A; TRUA, tRNA modification, structural genomics, NPPSFA; 2.25A {Thermus thermophilus HB8}Length = 249 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target247 tRNA pseudouridine synthase A [Candidatus Liberibacter
1dj0_A_264 Pseudouridine synthase I; alpha/beta fold, RNA-bin 100.0
1vs3_A_249 TRNA pseudouridine synthase A; TRUA, tRNA modifica 100.0
>1dj0_A (A:) Pseudouridine synthase I; alpha/beta fold, RNA-binding motif, RNA-modifying enzyme, lyase; 1.50A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=539.25  Aligned_cols=245  Identities=37%  Similarity=0.573  Sum_probs=241.3

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEEEEECCCCCCHHHHHHHH
Q ss_conf             92299999971668720048753877889999999997099569997112138612223468864063211046899999
Q gi|254780295|r    1 MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALN   80 (247)
Q Consensus         1 M~r~~~~i~YdGt~y~G~q~Q~~~~TVq~~le~aL~~~~~~~~~~~~a~RTD~GVhA~~qv~~f~~~~~~~~~~~~~~lN   80 (247)
                      |+||++.|+||||+|+|||+||+.+|||++||+||.++.++++.+.+|||||+||||++|++||+++.++++..+...||
T Consensus         3 ~~~~~l~i~Y~Gt~f~G~q~q~~~~TVq~~le~aL~~~~~~~~~~~~a~RTD~GVhA~~qv~~~~~~~~~~~~~~~~~lN   82 (264)
T 1dj0_A            3 VYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVN   82 (264)
T ss_dssp             CEEEEEEEEECCTTSSCSCCTTCSSCHHHHHHHHHHHHHTSCCCEEESSCCCTTCEEEEEEEEEEESCCCCHHHHHHHHH
T ss_pred             CEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             57999999997997014727889989999999999996399807997055667815555379986265457499999998


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCEECCCCEEEEEEEEECCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHEEEECC
Q ss_conf             86188876543443226777550002100223556852443202333210244333335665565676520011001024
Q gi|254780295|r   81 AYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRS  160 (247)
Q Consensus        81 ~~L~~p~~Irv~~~~~v~~~FhaR~~a~~R~Y~Y~i~~~~~~~~~~~~~~~~~~~~lD~~~l~~a~~~l~G~HdF~~F~~  160 (247)
                      +.|  |+||+|+++.+|+++||||++|++|+|+|+++.+..++++.+++.|+....+|+++|++||+.|+|+|||++||+
T Consensus        83 ~~L--p~dI~v~~~~~v~~~F~aR~~~~~R~Y~Y~i~~~~~~~~~~~~~~~~~~~~ld~~~m~~a~~~~~G~HDF~~F~~  160 (264)
T 1dj0_A           83 ANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRA  160 (264)
T ss_dssp             HTS--CTTEEEEEEEECCTTCCTTTTCCEEEEEEEEECSSSCCCTTTTSSEECCSCCCHHHHHHHHGGGCEEEECGGGCC
T ss_pred             HCC--CCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCCHHHCCCEEEECCCCCHHHHHHHHHHCCCCCCCEEEEC
T ss_conf             239--977289489988987776434760599999767877985672844675366799999999987538666378853


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
Q ss_conf             56553332110331111233320011315888899999999999999976899888999998358821166636989847
Q gi|254780295|r  161 IHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY  240 (247)
Q Consensus       161 ~~~~~~~~~R~I~~~~v~~~~~~i~i~i~g~~FL~~mVR~mVG~li~v~~g~~~~~~i~~~L~~~~r~~~~~~APa~GL~  240 (247)
                      .+.+.++++|+|.++++.+..+.+.|+|+|+||||||||+|||+++++|+|++++++|.++|+++++...+++|||+||+
T Consensus       161 ~~~~~~~~~r~i~~~~~~~~~~~~~~~i~g~sFL~~qVR~mvg~li~vg~g~~~~~~i~~~L~~~~~~~~~~~APa~GL~  240 (264)
T 1dj0_A          161 VQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLY  240 (264)
T ss_dssp             TTCCCSCCEEEEEEEEEEEETTEEEEEEEESCCCTTHHHHHHHHHHHHHTTSSCTTHHHHHHHHCCGGGSCCCCCSTTEE
T ss_pred             CCCCCCCCEEEEEEEEEEEECCEEEEEEEECHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
T ss_conf             69999997699999999951999999999765889999999999999987999999999998568866687767898767


Q ss_pred             EEEEEEC
Q ss_conf             6330439
Q gi|254780295|r  241 FDSVEYS  247 (247)
Q Consensus       241 L~~V~Y~  247 (247)
                      |++|.|.
T Consensus       241 L~~v~y~  247 (264)
T 1dj0_A          241 LVAVDYP  247 (264)
T ss_dssp             EEEEECC
T ss_pred             EEECCCC
T ss_conf             8001479



>1vs3_A (A:) TRNA pseudouridine synthase A; TRUA, tRNA modification, structural genomics, NPPSFA; 2.25A {Thermus thermophilus HB8} Back     alignment and structure