254780298

254780298

putative transmembrane protein

GeneID in NCBI database:8209280Locus tag:CLIBASIA_00915
Protein GI in NCBI database:254780298Protein Accession:YP_003064711.1
Gene range:+(188291, 188647)Protein Length:118aa
Gene description:putative transmembrane protein
COG prediction:none
KEGG prediction:putative transmembrane protein
SEED prediction:hypothetical multidrug efflux transporter protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED4 TM-Helix
HMMTOP4 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI
cHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccc
MKWIALLANVALGVLSSVFIkmsiippeapphfadstrfsdgklfwLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLssliwdepfywtTAIGIMFVMIGITLISFHTI
MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI
MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRiaqtvvtsaiiiiatCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI
MKWIALLANVALGVLSSVFIK****************RFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI
MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI
MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI
iiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHi
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiii
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHiiii
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI
MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI
MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target118 putative transmembrane protein [Candidatus Liberibacter
315122860118 putative transmembrane protein [Candidatus Liberibacter 1 2e-28
323525030118 small multidrug resistance protein [Burkholderia sp. CC 1 2e-11
190572690119 putative transmembrane protein [Stenotrophomonas maltop 1 3e-09
119899879118 multidrug efflux transporter protein [Azoarcus sp. BH72 1 3e-09
31561799497 small multidrug resistance protein [Escherichia coli 34 1 4e-06
119944228116 small multidrug resistance protein [Psychromonas ingrah 1 8e-04
8907190894 hypothetical protein SKA34_07738 [Photobacterium sp. SK 2 3e-13
157364133114 small multidrug resistance protein [Thermotoga lettinga 2 5e-06
307299205123 small multidrug resistance protein [Thermotogales bacte 2 7e-06
162450408123 putative conserved membrane protein [Sorangium cellulos 2 5e-04
>gi|315122860|ref|YP_004063349.1| putative transmembrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 118 Back     alignment and organism information
 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 89/117 (76%)

Query: 1   MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYI 60
           MKWI LLAN+   +LS VFIK+S           D  R S+ K FWLGFFFYA SFF YI
Sbjct: 1   MKWIVLLANIIFSILSCVFIKISTTSQGENTALTDPMRLSNDKFFWLGFFFYAASFFFYI 60

Query: 61  MVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHT 117
           +VV+ FS+++AQT+VTS+IIII TC+SSLIWD+PFYWTT IGI+ + +GITLISF+T
Sbjct: 61  IVVSQFSLQVAQTLVTSSIIIIVTCISSLIWDKPFYWTTGIGILLITLGITLISFNT 117


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|323525030|ref|YP_004227183.1| small multidrug resistance protein [Burkholderia sp. CCGE1001] Length = 118 Back     alignment and organism information
>gi|190572690|ref|YP_001970535.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a] Length = 119 Back     alignment and organism information
>gi|119899879|ref|YP_935092.1| multidrug efflux transporter protein [Azoarcus sp. BH72] Length = 118 Back     alignment and organism information
>gi|315617994|gb|EFU98586.1| small multidrug resistance protein [Escherichia coli 3431] Length = 97 Back     alignment and organism information
>gi|119944228|ref|YP_941908.1| small multidrug resistance protein [Psychromonas ingrahamii 37] Length = 116 Back     alignment and organism information
>gi|89071908|ref|ZP_01158504.1| hypothetical protein SKA34_07738 [Photobacterium sp. SKA34] Length = 94 Back     alignment and organism information
>gi|157364133|ref|YP_001470900.1| small multidrug resistance protein [Thermotoga lettingae TMO] Length = 114 Back     alignment and organism information
>gi|307299205|ref|ZP_07579006.1| small multidrug resistance protein [Thermotogales bacterium mesG1.Ag.4.2] Length = 123 Back     alignment and organism information
>gi|162450408|ref|YP_001612775.1| putative conserved membrane protein [Sorangium cellulosum 'So ce 56'] Length = 123 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 118 putative transmembrane protein [Candidatus Liberibacter
PRK10650109 multidrug efflux system protein MdtI; Provisional 99.96
PRK10452120 multidrug efflux system protein MdtJ; Provisional 99.96
PRK09541110 emrE multidrug efflux protein; Reviewed 99.96
COG2076106 EmrE Membrane transporters of cations and cationic drug 99.95
PRK11431105 quaternary ammonium compound-resistance protein SugE; P 99.95
PRK02971129 hypothetical protein; Provisional 99.93
pfam0089393 Multi_Drug_Res Small Multidrug Resistance protein. This 99.92
TIGR03340 281 phn_DUF6 phosphonate utilization associated putative me 99.38
pfam05653 300 DUF803 Protein of unknown function (DUF803). This famil 99.36
COG2510140 Predicted membrane protein [Function unknown] 99.08
PRK11453299 O-acetylserine/cysteine export protein; Provisional 98.72
PRK11272293 hypothetical protein; Provisional 98.7
pfam10639112 UPF0546 Uncharacterized protein family UPF0546. This fa 98.56
TIGR00950275 2A78 Carboxylate/Amino Acid/Amine Transporter; InterPro 98.53
KOG2922 335 consensus 98.5
PRK11453 299 O-acetylserine/cysteine export protein; Provisional 98.4
pfam02694107 UPF0060 Uncharacterized BCR, YnfA/UPF0060 family. 97.57
PRK02237108 hypothetical protein; Provisional 97.41
KOG4831125 consensus 97.15
COG1742109 Uncharacterized conserved protein [Function unknown] 96.81
COG3169116 Uncharacterized protein conserved in bacteria [Function 96.24
pfam04342108 DUF486 Protein of unknown function, DUF486. This family 95.39
TIGR03340281 phn_DUF6 phosphonate utilization associated putative me 98.77
pfam00892126 EamA EamA-like transporter family. This family includes 98.75
COG0697 292 RhaT Permeases of the drug/metabolite transporter (DMT) 98.29
PRK11689295 hypothetical protein; Provisional 98.28
COG0697292 RhaT Permeases of the drug/metabolite transporter (DMT) 98.22
PRK10532293 threonine and homoserine efflux system; Provisional 98.16
PRK11272 293 hypothetical protein; Provisional 97.46
pfam04142 238 Nuc_sug_transp Nucleotide-sugar transporter. This famil 97.33
pfam06800268 Sugar_transport Sugar transport protein. This is a fami 97.32
pfam03151149 TPT Triose-phosphate Transporter family. This family in 97.15
COG5006292 rhtA Threonine/homoserine efflux transporter [Amino aci 97.03
TIGR00950 275 2A78 Carboxylate/Amino Acid/Amine Transporter; InterPro 96.98
TIGR00776336 RhaT RhaT L-rhamnose-proton symporter family protein; I 96.94
pfam05653300 DUF803 Protein of unknown function (DUF803). This famil 96.72
PRK11689 295 hypothetical protein; Provisional 96.5
pfam06800 268 Sugar_transport Sugar transport protein. This is a fami 96.46
COG2962 293 RarD Predicted permeases [General function prediction o 96.43
KOG2234 345 consensus 96.11
KOG4510 346 consensus 95.64
KOG4314 290 consensus 95.62
TIGR00776 336 RhaT RhaT L-rhamnose-proton symporter family protein; I 95.61
COG2962293 RarD Predicted permeases [General function prediction o 95.37
COG4975288 GlcU Putative glucose uptake permease [Carbohydrate tra 94.31
KOG2765 416 consensus 94.11
KOG3912 372 consensus 93.69
pfam04657139 DUF606 Protein of unknown function, DUF606. This family 93.51
pfam08449303 UAA UAA transporter family. This family includes transp 96.74
KOG1441316 consensus 90.35
>PRK10650 multidrug efflux system protein MdtI; Provisional Back     alignment and domain information
>PRK10452 multidrug efflux system protein MdtJ; Provisional Back     alignment and domain information
>PRK09541 emrE multidrug efflux protein; Reviewed Back     alignment and domain information
>COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11431 quaternary ammonium compound-resistance protein SugE; Provisional Back     alignment and domain information
>PRK02971 hypothetical protein; Provisional Back     alignment and domain information
>pfam00893 Multi_Drug_Res Small Multidrug Resistance protein Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>pfam05653 DUF803 Protein of unknown function (DUF803) Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>PRK11272 hypothetical protein; Provisional Back     alignment and domain information
>pfam10639 UPF0546 Uncharacterized protein family UPF0546 Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter; InterPro: IPR004779 Proteins in this entry contain between eight and ten predicted transmembrane regions and are thought to function as transporters Back     alignment and domain information
>KOG2922 consensus Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>pfam02694 UPF0060 Uncharacterized BCR, YnfA/UPF0060 family Back     alignment and domain information
>PRK02237 hypothetical protein; Provisional Back     alignment and domain information
>KOG4831 consensus Back     alignment and domain information
>COG1742 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3169 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04342 DUF486 Protein of unknown function, DUF486 Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>pfam00892 EamA EamA-like transporter family Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK11689 hypothetical protein; Provisional Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>PRK11272 hypothetical protein; Provisional Back     alignment and domain information
>pfam04142 Nuc_sug_transp Nucleotide-sugar transporter Back     alignment and domain information
>pfam06800 Sugar_transport Sugar transport protein Back     alignment and domain information
>pfam03151 TPT Triose-phosphate Transporter family Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter; InterPro: IPR004779 Proteins in this entry contain between eight and ten predicted transmembrane regions and are thought to function as transporters Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein; InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family Back     alignment and domain information
>pfam05653 DUF803 Protein of unknown function (DUF803) Back     alignment and domain information
>PRK11689 hypothetical protein; Provisional Back     alignment and domain information
>pfam06800 Sugar_transport Sugar transport protein Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>KOG2234 consensus Back     alignment and domain information
>KOG4510 consensus Back     alignment and domain information
>KOG4314 consensus Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein; InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2765 consensus Back     alignment and domain information
>KOG3912 consensus Back     alignment and domain information
>pfam04657 DUF606 Protein of unknown function, DUF606 Back     alignment and domain information
>pfam08449 UAA UAA transporter family Back     alignment and domain information
>KOG1441 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target118 putative transmembrane protein [Candidatus Liberibacter
2i68_A137 Cryo-Em Based Theoretical Model Structure Of Transm 9e-17
3b5d_A110 Emre Multidrug Transporter In Complex With Tpp, C2 3e-13
>gi|116668015|pdb|2I68|A Chain A, Cryo-Em Based Theoretical Model Structure Of Transmembrane Domain Of The Multidrug-Resistance Antiporter From E. Coli Emre Length = 137 Back     alignment and structure
 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 42/116 (36%), Gaps = 13/116 (11%)

Query: 2   KWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIM 61
            +I L   +   V+ +  +K S               F+           Y  SF+    
Sbjct: 3   PYIYLGGAILAEVIGTTLMKFSE-------------GFTRLWPSVGTIICYCASFWLLAQ 49

Query: 62  VVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHT 117
            +A+    IA  + +   I++ + LS   + +       IG+M +  G+ +I+  +
Sbjct: 50  TLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS 105


gi|161761165|pdb|3B5D|A Chain A, Emre Multidrug Transporter In Complex With Tpp, C2 Crystal Form Length = 110 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target118 putative transmembrane protein [Candidatus Liberibacter
2i68_A137 Protein EMRE; transmembrane protein, small-multidrug re 1e-04
>2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Length = 137 Back     alignment and structure
 Score = 40.1 bits (94), Expect = 1e-04
 Identities = 20/113 (17%), Positives = 40/113 (35%), Gaps = 13/113 (11%)

Query: 1   MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYI 60
             +I L   +   V+ +  +K S               F+           Y  SF+   
Sbjct: 2   NPYIYLGGAILAEVIGTTLMKFS-------------EGFTRLWPSVGTIICYCASFWLLA 48

Query: 61  MVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLI 113
             +A+    IA  + +   I++ + LS   + +       IG+M +  G+ +I
Sbjct: 49  QTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLII 101


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target118 putative transmembrane protein [Candidatus Liberibacter
2i68_A137 Protein EMRE; transmembrane protein, small-multidrug re 99.96
3b5d_A110 Multidrug transporter EMRE; helical membrane protein, m 99.95
>2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure
Probab=99.96  E-value=3.5e-29  Score=158.88  Aligned_cols=104  Identities=19%  Similarity=0.258  Sum_probs=99.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHH
Q ss_conf             98999999999999999999953022222121122345666679999999999999999999997033899999999999
Q gi|254780298|r    1 MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAII   80 (118)
Q Consensus         1 M~wl~l~~~i~~~~~g~i~lK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~aL~~~~ls~ayp~~s~~~~   80 (118)
                      ++|+++++++++|+.|+.++|.+.             ++++..|.+..+.+|++|++++..++|++|+|+|||+|+|.|+
T Consensus         2 ~~wl~L~~Ai~~EV~gt~~LK~s~-------------gft~~~p~i~~i~~y~~sf~~ls~alk~iplgvAYAiWsGlG~   68 (137)
T 2i68_A            2 NPYIYLGGAILAEVIGTTLMKFSE-------------GFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGI   68 (137)
T ss_dssp             --CHHHHHHHHHHHHHHHHC-------------------------CHHHHHHHHHHHHHHHHHC-----CHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHC-------------CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             178999999999999999999871-------------8874889999999999999999999973984227999988999


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999389999899999999999999998724
Q gi|254780298|r   81 IIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHT  117 (118)
Q Consensus        81 v~~~~~~~~~f~E~~~~~~~~Gi~lIi~Gvili~~~t  117 (118)
                      +.+++.|+++|||++|+.|++|+.+|+.||+++|+.+
T Consensus        69 v~~~lig~~~f~E~ls~~~ilgi~LIi~GVv~Lnl~s  105 (137)
T 2i68_A           69 VLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS  105 (137)
T ss_dssp             HHHHHHHHHHHC------CHHHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHEECCC
T ss_conf             9999999999479998999999999999998222057



>3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 118 putative transmembrane protein [Candidatus Liberib
2i68_A_137 (A:) Protein EMRE; transmembrane protein, small-mu 1e-04
>2i68_A (A:) Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli}Length = 137 Back     alignment and structure
 Score = 39.8 bits (93), Expect = 1e-04
 Identities = 20/117 (17%), Positives = 41/117 (35%), Gaps = 13/117 (11%)

Query: 1   MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYI 60
             +I L   +   V+ +  +K S       P                    Y  SF+   
Sbjct: 2   NPYIYLGGAILAEVIGTTLMKFSEGFTRLWP-------------SVGTIICYCASFWLLA 48

Query: 61  MVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHT 117
             +A+    IA  + +   I++ + LS   + +       IG+M +  G+ +I+  +
Sbjct: 49  QTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS 105


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target118 putative transmembrane protein [Candidatus Liberibacter
3b5d_A_110 Multidrug transporter EMRE; helical membrane prote 99.94
2i68_A_137 Protein EMRE; transmembrane protein, small-multidr 99.81
>3b5d_A (A:) Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure
Probab=99.94  E-value=1.2e-26  Score=147.20  Aligned_cols=104  Identities=19%  Similarity=0.258  Sum_probs=99.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHH
Q ss_conf             98999999999999999999953022222121122345666679999999999999999999997033899999999999
Q gi|254780298|r    1 MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAII   80 (118)
Q Consensus         1 M~wl~l~~~i~~~~~g~i~lK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~aL~~~~ls~ayp~~s~~~~   80 (118)
                      .+|+++++++++|+.|+..+|.+.             ++++.+|.+..+.+|+.|++++..++|++|+|+||++|+|.|+
T Consensus         2 ~~w~~L~~Ai~~Ev~~t~~lk~s~-------------gft~~~~~~~~~~~~~~sf~~ls~alk~ip~gvAYAvW~GiG~   68 (110)
T 3b5d_A            2 NPYIYLGGAILAEVIGTTLMKFSE-------------GFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGI   68 (110)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHC-------------CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             238999999999999999999874-------------8864578999999999999999999945774148998998899


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999389999899999999999999998724
Q gi|254780298|r   81 IIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHT  117 (118)
Q Consensus        81 v~~~~~~~~~f~E~~~~~~~~Gi~lIi~Gvili~~~t  117 (118)
                      +.+++.|+++|||++|+.|+.|+.+|+.||+.+|+.+
T Consensus        69 ~~~~~~g~~~f~e~~s~~~~~gi~lIi~Gvv~l~l~s  105 (110)
T 3b5d_A           69 VLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS  105 (110)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHEECCC
T ss_conf             9999999999379897999999999999998310147



>2i68_A (A:) Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure