254780299

254780299

acyl-CoA dehydrogenase protein

GeneID in NCBI database:8209281Locus tag:CLIBASIA_00920
Protein GI in NCBI database:254780299Protein Accession:YP_003064712.1
Gene range:-(188764, 190452)Protein Length:562aa
Gene description:acyl-CoA dehydrogenase protein
COG prediction:[I] Acyl-CoA dehydrogenases
KEGG prediction:acyl-CoA dehydrogenase protein; K09456 putative acyl-CoA dehydrogenase
SEED prediction:Acyl-CoA dehydrogenase (EC 1.3.99.3)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560--
MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC
ccHHHHHHHHcccccccHHHHHHHccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccccccccccEEccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHcEEEEEEEcccEEEEEEEEEEEEcccccEEEEEEEEccccccEEEEEEEcccccccEEEccccccccccccccEEEEEEcccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccc
cHHHHHHHHHHHHHcccccccEEEccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccHHHHcHHHHHHHHHHHHcccccccccHHcccccccHHHHHHHHHHHHHHHHccccccccHHHHcHHHHHHccHHHHHHHHHHHHccccccccccccccccEEEEEEEEccccccccccccEEEEEccccEEEEEccEEEEccccccEEEEEEEcccccccEcEccEccccccccEEEEccccccccccccccEEEEccHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccccEEEccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHccc
MTLREIYRRLAMnqvhqpsdslfalnqpplfigmnaysSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMAnyntpqlhaygpggerwdkvefhPAWHALLRRSIhdglhcsiwdrsfePVVRKQAHKIRAARLYLMAQLEaghlmspsvtSASMVALMTtprvhkdwapkifsreydptnkapmqktSVAIGLgltekrggtdiaaITSQgqkisdgiyclsghkwflsspmsDAFIMLAQVEGRVGCflvprlledgspnglcYQRLKnkignrsnaTVELEFSNTFGFllgdlnvstgpvedmKILIYLDSAIMSVSGMRVSLAEAIHYARRRhvsggilidqpVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECiggsgyieERSIARhyrespansillgsgNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFlenrfldnchsthcmlhgrfnAAHIIDSLYLDC
MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTtprvhkdwapKIFSreydptnkapmqKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVsggilidqpVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLeqdlgssgkKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC
MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRaiadialdiaaatalSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIalassaaalYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC
*********LA**QVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFE*VVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC
MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC
MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC
MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC
MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target562 acyl-CoA dehydrogenase protein [Candidatus Liberibacter
315122276551 acyl-CoA dehydrogenase protein [Candidatus Liberibacter 1 0.0
222085618552 acyl-CoA dehydrogenase protein [Agrobacterium radiobact 1 0.0
218509657552 acyl-CoA dehydrogenase protein [Rhizobium etli Brasil 5 1 0.0
190891326552 acyl-CoA dehydrogenase [Rhizobium etli CIAT 652] Length 1 0.0
241204127552 acyl-CoA dehydrogenase [Rhizobium leguminosarum bv. tri 1 0.0
209548903552 acyl-CoA dehydrogenase domain protein [Rhizobium legumi 1 0.0
116251506552 acyl CoA-like DNA repair protein [Rhizobium leguminosar 1 0.0
327190278552 acyl-CoA dehydrogenase protein [Rhizobium etli CNPAF512 1 0.0
86357277552 acyl-CoA dehydrogenase protein [Rhizobium etli CFN 42] 1 0.0
150396160550 acyl-CoA dehydrogenase domain-containing protein [Sinor 1 0.0
>gi|315122276|ref|YP_004062765.1| acyl-CoA dehydrogenase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 551 Back     alignment and organism information
 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/550 (80%), Positives = 494/550 (89%)

Query: 12  MNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVALIANFPSVVHKELELLGEYVLSCTAQ 71
           MNQ HQ  DSL  LNQP LFIGMNAY SDS +V L ANFP  + KELELLGEYV S +AQ
Sbjct: 1   MNQTHQQLDSLSELNQPSLFIGMNAYKSDSFVVDLTANFPRSIRKELELLGEYVFSYSAQ 60

Query: 72  ELARMANYNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQ 131
           ELARMAN+N PQLHAYG GGER D++EFHPAWHALLRRS+ DGLHC++W+R++EP VRKQ
Sbjct: 61  ELARMANHNIPQLHAYGAGGERCDRIEFHPAWHALLRRSMKDGLHCAVWNRNYEPEVRKQ 120

Query: 132 AHKIRAARLYLMAQLEAGHLMSPSVTSASMVALMTTPRVHKDWAPKIFSREYDPTNKAPM 191
            HKIRAARLYLMAQLEAGHL S S+TSASMVALMTTPRVHKDWA KI S+EYDPT+KAPM
Sbjct: 121 IHKIRAARLYLMAQLEAGHLTSLSMTSASMVALMTTPRVHKDWAYKILSQEYDPTSKAPM 180

Query: 192 QKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEG 251
           QKTSV IGLGLTEK+GGTDI AITS GQKISDGIYCLSGHKWFLS+PMSDAFIMLA+VEG
Sbjct: 181 QKTSVTIGLGLTEKQGGTDIGAITSLGQKISDGIYCLSGHKWFLSAPMSDAFIMLARVEG 240

Query: 252 RVGCFLVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVED 311
            VGCFLVPRLLEDGS NGLCYQRLKNKIGNRSNATVE+EFSN FGFLLGDLN  T PVED
Sbjct: 241 IVGCFLVPRLLEDGSSNGLCYQRLKNKIGNRSNATVEVEFSNAFGFLLGDLNAGTSPVED 300

Query: 312 MKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATA 371
           MKIL+YLD AI+S SGMR SLAEAIHYARRR+VSG ILIDQ +M R IAD+ALD+AAATA
Sbjct: 301 MKILMYLDCAIISTSGMRASLAEAIHYARRRYVSGNILIDQSIMNRVIADVALDVAAATA 360

Query: 372 LSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIA 431
           LSFRLAN+FDEAK RSE+AAYAR+MAP+TKYWCCK+APAVIAEAMECIGGSGY+EERSIA
Sbjct: 361 LSFRLANAFDEAKLRSEDAAYARVMAPVTKYWCCKIAPAVIAEAMECIGGSGYVEERSIA 420

Query: 432 RHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSI 491
           RHYRESPANSILLGSGNAMVLD+LNLLEKG+NLFEQ+FS LE+DLGSSGKKVI +L+DS+
Sbjct: 421 RHYRESPANSILLGSGNAMVLDLLNLLEKGSNLFEQVFSNLEKDLGSSGKKVIDLLQDSV 480

Query: 492 SLCKEDKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNA 551
           SLCKED+GLAR L E++A+A+SAAAL R G ++IADVFLE+RF  N HST+ +LH R N+
Sbjct: 481 SLCKEDRGLARLLIERMAIAASAAALCREGADNIADVFLESRFFGNGHSTYGLLHSRVNS 540

Query: 552 AHIIDSLYLD 561
            HIIDSLYLD
Sbjct: 541 THIIDSLYLD 550


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085618|ref|YP_002544148.1| acyl-CoA dehydrogenase protein [Agrobacterium radiobacter K84] Length = 552 Back     alignment and organism information
>gi|218509657|ref|ZP_03507535.1| acyl-CoA dehydrogenase protein [Rhizobium etli Brasil 5] Length = 552 Back     alignment and organism information
>gi|190891326|ref|YP_001977868.1| acyl-CoA dehydrogenase [Rhizobium etli CIAT 652] Length = 552 Back     alignment and organism information
>gi|241204127|ref|YP_002975223.1| acyl-CoA dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 552 Back     alignment and organism information
>gi|209548903|ref|YP_002280820.1| acyl-CoA dehydrogenase domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 552 Back     alignment and organism information
>gi|116251506|ref|YP_767344.1| acyl CoA-like DNA repair protein [Rhizobium leguminosarum bv. viciae 3841] Length = 552 Back     alignment and organism information
>gi|327190278|gb|EGE57378.1| acyl-CoA dehydrogenase protein [Rhizobium etli CNPAF512] Length = 552 Back     alignment and organism information
>gi|86357277|ref|YP_469169.1| acyl-CoA dehydrogenase protein [Rhizobium etli CFN 42] Length = 552 Back     alignment and organism information
>gi|150396160|ref|YP_001326627.1| acyl-CoA dehydrogenase domain-containing protein [Sinorhizobium medicae WSM419] Length = 550 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target562 acyl-CoA dehydrogenase protein [Candidatus Liberibacter
PRK11561538 PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provi 3e-94
COG1960393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolis 3e-41
cd00567327 cd00567, ACAD, Acyl-CoA dehydrogenase 2e-28
cd01153407 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases s 3e-24
PTZ00461410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provi 9e-14
PTZ00456622 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional 1e-12
pfam00441150 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-ter 1e-19
pfam08028134 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, C-ter 3e-05
cd01158373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenase 1e-19
KOG0139398 KOG0139, KOG0139, KOG0139, Short-chain acyl-CoA dehydro 6e-17
cd01160372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 8e-16
KOG0141421 KOG0141, KOG0141, KOG0141, Isovaleryl-CoA dehydrogenase 1e-14
KOG0137634 KOG0137, KOG0137, KOG0137, Very-long-chain acyl-CoA deh 7e-13
cd01151386 cd01151, GCD, Glutaryl-CoA dehydrogenase 8e-13
KOG0140408 KOG0140, KOG0140, KOG0140, Medium-chain acyl-CoA dehydr 2e-11
KOG0138432 KOG0138, KOG0138, KOG0138, Glutaryl-CoA dehydrogenase [ 6e-11
cd01156376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 5e-10
PLN02519404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 4e-09
cd01161409 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase 5e-09
PRK12341381 PRK12341, PRK12341, putative acyl-CoA dehydrogenase; Pr 6e-08
cd01157378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 2e-05
PRK03354380 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogenase; 1e-04
TIGR03207372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA deh 4e-04
pfam0277052 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, middl 0.002
cd01154418 cd01154, AidB, Proteins involved in DNA damage response 1e-101
>gnl|CDD|183199 PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|32143 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173838 cd00567, ACAD, Acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173842 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185635 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|144145 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|149227 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>gnl|CDD|35361 KOG0139, KOG0139, KOG0139, Short-chain acyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|35363 KOG0141, KOG0141, KOG0141, Isovaleryl-CoA dehydrogenase [Amino acid transport and metabolism, Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|35359 KOG0137, KOG0137, KOG0137, Very-long-chain acyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|35362 KOG0140, KOG0140, KOG0140, Medium-chain acyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|35360 KOG0138, KOG0138, KOG0138, Glutaryl-CoA dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|178134 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|183454 PRK12341, PRK12341, putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|179566 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|145755 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, middle domain Back     alignment and domain information
>gnl|CDD|173843 cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 562 acyl-CoA dehydrogenase protein [Candidatus Liberibacter
PRK11561538 isovaleryl CoA dehydrogenase; Provisional 100.0
cd01154418 AidB AidB. AidB is one of several genes involved in the 100.0
PRK13026 771 acyl-CoA dehydrogenase; Reviewed 100.0
PRK09463 761 fadE acyl-CoA dehydrogenase; Reviewed 100.0
cd01153407 ACAD_fadE5 Putative acyl-CoA dehydrogenase (ACAD). Mito 100.0
cd01155394 ACAD_FadE2 FadE2-like Acyl-CoA dehydrogenase (ACAD). Ac 100.0
cd01161409 VLCAD Very long chain acyl-CoA dehydrogenase (VLCAD). V 100.0
KOG0139398 consensus 100.0
TIGR03207372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase. 100.0
PRK03354380 crotonobetainyl-CoA dehydrogenase; Validated 100.0
cd01162375 IBD Isobutyryl-CoA dehydrogenase (IBD) catalyzes the al 100.0
cd01152380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenase (ACAD) 100.0
cd01157378 MCAD Medium chain acyl-CoA dehydrogenase (MCAD). MCADs 100.0
cd01151386 GCD Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-Co 100.0
cd01156376 IVD Isovaleryl-CoA dehydrogenase (IVD) is an is an acyl 100.0
cd01160372 LCAD Long chain acyl-CoA dehydrogenase (LCAD) is acyl-C 100.0
KOG0140408 consensus 100.0
PRK12341383 putative acyl-CoA dehydrogenase; Provisional 100.0
TIGR03204395 pimC_large pimeloyl-CoA dehydrogenase, large subunit. M 100.0
TIGR03203378 pimD_small pimeloyl-CoA dehydrogenase, small subunit. M 100.0
KOG0141421 consensus 100.0
cd01158373 SCAD/SBCAD Short chain acyl-CoA dehydrogenase (SCAD). S 100.0
COG1960393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 100.0
cd00567369 ACAD Acyl-CoA dehydrogenase (ACAD). Both mitochondrial 100.0
cd01163377 DszC Dibenzothiophene (DBT) desulfurization enzyme C (D 100.0
cd01159370 NcnH Naphthocyclinone hydroxylase (NcnH). Naphthocyclin 100.0
KOG0138432 consensus 100.0
KOG1469392 consensus 100.0
KOG0137634 consensus 100.0
cd01150610 AXO Peroxisomal acyl-CoA oxidases (AXO) catalyze the fi 100.0
KOG0135661 consensus 99.95
KOG0136 670 consensus 99.9
pfam00441150 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain 100.0
pfam08028134 Acyl-CoA_dh_2 Acyl-CoA dehydrogenase, C-terminal domain 99.92
pfam0277052 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain. Ce 99.45
pfam11794265 HpaB_N 4-hydroxyphenylacetate 3-hydroxylase N terminal. 95.76
COG2368493 Aromatic ring hydroxylase [Secondary metabolites biosyn 98.39
pfam02771113 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain 97.65
KOG0137634 consensus 95.77
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01154 AidB AidB Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenase (ACAD) Back     alignment and domain information
>cd01155 ACAD_FadE2 FadE2-like Acyl-CoA dehydrogenase (ACAD) Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase (VLCAD) Back     alignment and domain information
>KOG0139 consensus Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase (IBD) catalyzes the alpha, beta- dehydrogenation of short branched chain acyl-CoA intermediates in valine catabolism Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenase (ACAD) Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase (MCAD) Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase (GCD) Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase (IVD) is an is an acyl-CoA dehydrogenase, which catalyzes the third step in leucine catabolism, the conversion of isovaleryl-CoA (3-methylbutyryl-CoA) into 3-methylcrotonyl-CoA Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase (LCAD) is acyl-CoA dehydrogenases (ACAD), which is found in the mitochondria of eukaryotes and in some prokaryotes Back     alignment and domain information
>KOG0140 consensus Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>KOG0141 consensus Back     alignment and domain information
>cd01158 SCAD/SBCAD Short chain acyl-CoA dehydrogenase (SCAD) Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase (ACAD) Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C (DszC) Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase (NcnH) Back     alignment and domain information
>KOG0138 consensus Back     alignment and domain information
>KOG1469 consensus Back     alignment and domain information
>KOG0137 consensus Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidases (AXO) catalyze the first set in the peroxisomal fatty acid beta-oxidation, the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced Back     alignment and domain information
>KOG0135 consensus Back     alignment and domain information
>KOG0136 consensus Back     alignment and domain information
>pfam00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>pfam08028 Acyl-CoA_dh_2 Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>pfam02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain Back     alignment and domain information
>pfam11794 HpaB_N 4-hydroxyphenylacetate 3-hydroxylase N terminal Back     alignment and domain information
>COG2368 Aromatic ring hydroxylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain Back     alignment and domain information
>KOG0137 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target562 acyl-CoA dehydrogenase protein [Candidatus Liberibacter
3djl_A541 Crystal Structure Of Alkylation Response Protein E. 1e-134
2uxw_A607 Crystal Structure Of Human Very Long Chain Acyl-Coa 1e-77
3b96_A587 Structural Basis For Substrate Fatty-Acyl Chain Spe 1e-77
2z1q_A577 Crystal Structure Of Acyl Coa Dehydrogenase Length 3e-71
3owa_A597 Crystal Structure Of Acyl-Coa Dehydrogenase Complex 5e-64
1buc_A383 Three-Dimensional Structure Of Butyryl-Coa Dehydrog 1e-73
1ukw_A379 Crystal Structure Of Medium-Chain Acyl-Coa Dehydrog 7e-71
1jqi_A388 Crystal Structure Of Rat Short Chain Acyl-Coa Dehyd 8e-68
3pfd_A393 Crystal Structure Of An Acyl-Coa Dehydrogenase From 1e-67
2jif_A404 Structure Of Human Short-Branched Chain Acyl-Coa De 4e-67
2dvl_A372 Crystal Structure Of Project Tt0160 From Thermus Th 7e-67
1ivh_A394 Structure Of Human Isovaleryl-Coa Dehydrogenase At 7e-67
2vig_A391 Crystal Structure Of Human Short-Chain Acyl Coa Deh 2e-65
2pg0_A385 Crystal Structure Of Acyl-Coa Dehydrogenase From Ge 2e-65
1ege_A396 Structure Of T255e, E376g Mutant Of Human Medium Ch 2e-65
2a1t_A421 Structure Of The Human Mcad:etf E165betaa Complex L 6e-65
1udy_A396 Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaocta 6e-65
3mdd_A385 Crystal Structures Of Medium Chain Acyl-Coa Dehydro 2e-64
1egd_A396 Structure Of T255e, E376g Mutant Of Human Medium Ch 2e-64
1rx0_A393 Crystal Structure Of Isobutyryl-Coa Dehydrogenase C 4e-60
3mpi_A397 Structure Of The Glutaryl-Coenzyme A Dehydrogenase 5e-59
3r7k_A403 Crystal Structure Of A Probable Acyl Coa Dehydrogen 1e-56
1ws9_A387 Crystal Structure Of Project Id Tt0172 From Thermus 2e-55
3oib_A403 Crystal Structure Of A Putative Acyl-Coa Dehydrogen 1e-53
3gqt_A399 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 3e-51
3eom_A396 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehy 3e-51
3d6b_A395 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogena 4e-51
2ix6_A449 Short Chain Specific Acyl-Coa Oxidase From Arabidop 1e-41
3nf4_A387 Crystal Structure Of Acyl-Coa Dehydrogenase From My 5e-64
1siq_A392 The Crystal Structure And Mechanism Of Human Glutar 2e-49
1sir_A394 The Crystal Structure And Mechanism Of Human Glutar 3e-49
2r0m_A394 The Effect Of A Glu370asp Mutation In Glutaryl-Coa 2e-48
2eba_A385 Crystal Structure Of The Putative Glutaryl-Coa Dehy 4e-42
gi|206582016|pdb|3DJL|A Chain A, Crystal Structure Of Alkylation Response Protein E. Coli Aidb Length = 541 Back     alignment and structure
 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 187/514 (36%), Positives = 273/514 (53%), Gaps = 7/514 (1%)

Query: 20  DSLFALNQPPLFIGMNAYSSDSLLVALI-ANFPSVVHKELELLGEYVLSCTAQELARMAN 78
            +    NQP      N Y SD  L   +           L  +G+ + +  + EL R+AN
Sbjct: 4   QTHTVFNQPIPLNNSNLYLSDGALCEAVTREGAGWDSDFLASIGQQLGTAESLELGRLAN 63

Query: 79  YNTPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAA 138
            N P+L  Y   G R D V FHPAWH L++    + +H   W+       R  A   RAA
Sbjct: 64  VNPPELLRYDAQGRRLDDVRFHPAWHLLMQALCTNRVHNLAWEED----ARSGAFVARAA 119

Query: 139 RLYLMAQLEAGHLMSPSVTSASMVALMTT-PRVHKDWAPKIFSREYDPTNKAPMQKTSVA 197
           R  L AQ+EAG L   ++T A+   L+   P   +DW   + S  YD       QK  + 
Sbjct: 120 RFMLHAQVEAGSLCPITMTFAATPLLLQMLPAPFQDWTTPLLSDRYDSHLLPGGQKRGLL 179

Query: 198 IGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFL 257
           IG+G+TEK+GG+D+ + T++ +++ DG Y L GHKWF S P SDA ++LAQ  G + CF 
Sbjct: 180 IGMGMTEKQGGSDVMSNTTRAERLEDGSYRLVGHKWFFSVPQSDAHLVLAQTAGGLSCFF 239

Query: 258 VPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIY 317
           VPR L DG  N +  +RLK+K+GNRSNA+ E+EF +  G+LLG        +  M  +  
Sbjct: 240 VPRFLPDGQRNAIRLERLKDKLGNRSNASCEVEFQDAIGWLLGLEGEGIRLILKMGGMTR 299

Query: 318 LDSAIMSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLA 377
            D A+ S + MR + + AI++A +RHV G  LI QP+M+  ++ +AL +   TAL FRLA
Sbjct: 300 FDCALGSHAMMRRAFSLAIYHAHQRHVFGNPLIQQPLMRHVLSRMALQLEGQTALLFRLA 359

Query: 378 NSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRES 437
            ++D  ++ ++EA +AR+  P  K+  CK     +AEAME +GG GY EE  + R YRE 
Sbjct: 360 RAWDR-RADAKEALWARLFTPAAKFVICKRGMPFVAEAMEVLGGIGYCEESELPRLYREM 418

Query: 438 PANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKED 497
           P NSI  GSGN M LDVL +L K   +++ L     +  G        + R    L K  
Sbjct: 419 PVNSIWEGSGNIMCLDVLRVLNKQAGVYDLLSEAFVEVKGQDRYFDRAVRRLQQQLRKPA 478

Query: 498 KGLARFLTEKIALASSAAALYRAGMNDIADVFLE 531
           + L R +T ++ L    A + +     +A  + +
Sbjct: 479 EELGREITHQLFLLGCGAQMLKYASPPMAQAWCQ 512


>gi|146386728|pdb|2UXW|A Chain A, Crystal Structure Of Human Very Long Chain Acyl-Coa Dehydrogenase (Acadvl) Length = 607 Back     alignment and structure
>gi|167745034|pdb|3B96|A Chain A, Structural Basis For Substrate Fatty-Acyl Chain Specificity: Crystal Structure Of Human Very-Long-Chain Acyl-Coa Dehydrogenase Length = 587 Back     alignment and structure
>gi|188036192|pdb|2Z1Q|A Chain A, Crystal Structure Of Acyl Coa Dehydrogenase Length = 577 Back     alignment and structure
>gi|308388188|pdb|3OWA|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase Complexed With Fad From Bacillus Anthracis Length = 597 Back     alignment and structure
gi|1065243|pdb|1BUC|A Chain A, Three-Dimensional Structure Of Butyryl-Coa Dehydrogenase From Megasphaera Elsdenii Length = 383 Back     alignment and structure
>gi|56966249|pdb|1UKW|A Chain A, Crystal Structure Of Medium-Chain Acyl-Coa Dehydrogenase From Thermus Thermophilus Hb8 Length = 379 Back     alignment and structure
>gi|20150494|pdb|1JQI|A Chain A, Crystal Structure Of Rat Short Chain Acyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa Length = 388 Back     alignment and structure
>gi|311772310|pdb|3PFD|A Chain A, Crystal Structure Of An Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Reduced Flavin Adenine Dinucleotide Solved By Combined Iodide Ion Sad Mr Length = 393 Back     alignment and structure
>gi|145579859|pdb|2JIF|A Chain A, Structure Of Human Short-Branched Chain Acyl-Coa Dehydrogenase (Acadsb) Length = 404 Back     alignment and structure
gi|126030329|pdb|2DVL|A Chain A, Crystal Structure Of Project Tt0160 From Thermus Thermophilus Hb8 Length = 372 Back     alignment and structure
>gi|3212539|pdb|1IVH|A Chain A, Structure Of Human Isovaleryl-Coa Dehydrogenase At 2.6 Angstroms Resolution: Structural Basis For Substrate Specificity Length = 394 Back     alignment and structure
>gi|163931094|pdb|2VIG|A Chain A, Crystal Structure Of Human Short-Chain Acyl Coa Dehydrogenase Length = 391 Back     alignment and structure
>gi|149243125|pdb|2PG0|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Geobacillus Kaustophilus Length = 385 Back     alignment and structure
>gi|2392312|pdb|1EGE|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
gi|71042612|pdb|2A1T|A Chain A, Structure Of The Human Mcad:etf E165betaa Complex Length = 421 Back     alignment and structure
>gi|40889734|pdb|1UDY|A Chain A, Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaoctanoyl-Coa Length = 396 Back     alignment and structure
>gi|640350|pdb|3MDD|A Chain A, Crystal Structures Of Medium Chain Acyl-Coa Dehydrogenase From Pig Liver Mitochondria With And Without Substrate Length = 385 Back     alignment and structure
>gi|2392308|pdb|1EGD|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>gi|48425405|pdb|1RX0|A Chain A, Crystal Structure Of Isobutyryl-Coa Dehydrogenase Complexed With SubstrateLIGAND. Length = 393 Back     alignment and structure
>gi|303325028|pdb|3MPI|A Chain A, Structure Of The Glutaryl-Coenzyme A Dehydrogenase Glutaryl-Coa Complex Length = 397 Back     alignment and structure
>gi|328877386|pdb|3R7K|A Chain A, Crystal Structure Of A Probable Acyl Coa Dehydrogenase From Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 403 Back     alignment and structure
gi|82407403|pdb|1WS9|A Chain A, Crystal Structure Of Project Id Tt0172 From Thermus Thermophilus Hb8 Length = 387 Back     alignment and structure
>gi|305677907|pdb|3OIB|A Chain A, Crystal Structure Of A Putative Acyl-Coa Dehydrogenase From Mycobacterium Smegmatis, Iodide Soak Length = 403 Back     alignment and structure
>gi|228312334|pdb|3GQT|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei With Fragment (1,4-Dimethyl-1,2, 3,4-Tetrahydroquinoxalin-6-Yl)methylamine Length = 399 Back     alignment and structure
>gi|209870540|pdb|3EOM|A Chain A, 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 396 Back     alignment and structure
gi|189339699|pdb|3D6B|A Chain A, 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 395 Back     alignment and structure
>gi|114794826|pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 Length = 449 Back     alignment and structure
>gi|299689355|pdb|3NF4|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Flavin Adenine Dinucleotide Length = 387 Back     alignment and structure
>gi|55669740|pdb|1SIQ|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 392 Back     alignment and structure
>gi|55669741|pdb|1SIR|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 394 Back     alignment and structure
>gi|185177597|pdb|2R0M|A Chain A, The Effect Of A Glu370asp Mutation In Glutaryl-Coa Dehydrogenase On Proton Transfer To The Dienolate Intermediate Length = 394 Back     alignment and structure
gi|145579313|pdb|2EBA|A Chain A, Crystal Structure Of The Putative Glutaryl-Coa Dehydrogenase From Thermus Thermophilus Length = 385 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target562 acyl-CoA dehydrogenase protein [Candidatus Liberibacter
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavoprote 2e-77
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structural gen 6e-30
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seattle st 8e-28
2jif_A404 Short/branched chain specific acyl-COA dehydrogenase; m 3e-27
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSFA, na 4e-27
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken structura 6e-25
2pg0_A385 Acyl-COA dehydrogenase; GK1316, structural genomics, PS 1e-23
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus thermophil 1e-23
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase (flav 2e-22
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, structural 5e-13
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, str 6e-12
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, elec 4e-29
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA 1e-28
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreduc 4e-28
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomics cen 2e-25
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidics, sc 7e-25
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, ox 1e-23
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondrial; 1e-21
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSFA, na 2e-21
3hwc_A515 Chlorophenol-4-monooxygenase component 2; beta barrel, 7e-13
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, rike 2e-07
3owa_A597 Acyl-COA dehydrogenase; structural genomics, center for 8e-23
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxid 5e-18
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-C 1e-21
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA deh 4e-21
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatty aci 1e-19
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acyl-COA 9e-19
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase 7e-18
2z1q_A577 Acyl-COA dehydrogenase; FAD, structural genomics, NPPSF 4e-17
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, polymor 2e-12
2uxw_A607 VERY-long-chain specific acyl-COA dehydrogenase; altern 1e-16
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flav 1e-15
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase compone 6e-11
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl- 4e-10
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} Length = 541 Back     alignment and structure
 Score =  285 bits (729), Expect = 2e-77
 Identities = 187/512 (36%), Positives = 270/512 (52%), Gaps = 7/512 (1%)

Query: 25  LNQPPLFIGMNAYSSDSLLV-ALIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQ 83
            NQP      N Y SD  L  A+           L  +G+ + +  + EL R+AN N P+
Sbjct: 9   FNQPIPLNNSNLYLSDGALCEAVTREGAGWDSDFLASIGQQLGTAESLELGRLANVNPPE 68

Query: 84  LHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLM 143
           L  Y   G R D V FHPAWH L++    + +H   W+          A   RAAR  L 
Sbjct: 69  LLRYDAQGRRLDDVRFHPAWHLLMQALCTNRVHNLAWEEDARS----GAFVARAARFMLH 124

Query: 144 AQLEAGHLMSPSVTSAS-MVALMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGL 202
           AQ+EAG L   ++T A+  + L   P   +DW   + S  YD       QK  + IG+G+
Sbjct: 125 AQVEAGSLCPITMTFAATPLLLQMLPAPFQDWTTPLLSDRYDSHLLPGGQKRGLLIGMGM 184

Query: 203 TEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLL 262
           TEK+GG+D+ + T++ +++ DG Y L GHKWF S P SDA ++LAQ  G + CF VPR L
Sbjct: 185 TEKQGGSDVMSNTTRAERLEDGSYRLVGHKWFFSVPQSDAHLVLAQTAGGLSCFFVPRFL 244

Query: 263 EDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAI 322
            DG  N +  +RLK+K+GNRSNA+ E+EF +  G+LLG        +  M  +   D A+
Sbjct: 245 PDGQRNAIRLERLKDKLGNRSNASCEVEFQDAIGWLLGLEGEGIRLILKMGGMTRFDCAL 304

Query: 323 MSVSGMRVSLAEAIHYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDE 382
            S + MR + + AI++A +RHV G  LI QP+M+  ++ +AL +   TAL FRLA ++D 
Sbjct: 305 GSHAMMRRAFSLAIYHAHQRHVFGNPLIQQPLMRHVLSRMALQLEGQTALLFRLARAWDR 364

Query: 383 AKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSI 442
               ++EA +AR+  P  K+  CK     +AEAME +GG GY EE  + R YRE P NSI
Sbjct: 365 RA-DAKEALWARLFTPAAKFVICKRGMPFVAEAMEVLGGIGYCEESELPRLYREMPVNSI 423

Query: 443 LLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLAR 502
             GSGN M LDVL +L K   +++ L     +  G        + R    L K  + L R
Sbjct: 424 WEGSGNIMCLDVLRVLNKQAGVYDLLSEAFVEVKGQDRYFDRAVRRLQQQLRKPAEELGR 483

Query: 503 FLTEKIALASSAAALYRAGMNDIADVFLENRF 534
            +T ++ L    A + +     +A  + +   
Sbjct: 484 EITHQLFLLGCGAQMLKYASPPMAQAWCQVML 515


>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogenase; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, acetylation; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: FAD; 2.50A {Thermus thermophilus HB8} Length = 372 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus HTA426} Length = 385 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, structural genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus HB8} Length = 385 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase (flavoprotein); HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE; 2.10A {Rhodococcus SP} Length = 414 Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; HET: 1PS; 1.65A {Rhodococcus SP} Length = 394 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus HB8} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Length = 515 Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus HB8} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Length = 481 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, polymorphism, phosphoprotein, oxidoreductase, alternative splicing; HET: FAD; 2.80A {Homo sapiens} Length = 428 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; alternative splicing, fatty acid metabolism, transit peptide, disease mutation, lipid metabolism; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabolism, lipid metabolism; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase component; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Length = 422 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* Length = 439 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target562 acyl-CoA dehydrogenase protein [Candidatus Liberibacter
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavoprote 100.0
2z1q_A577 Acyl-COA dehydrogenase; FAD, structural genomics, NPPSF 100.0
3owa_A597 Acyl-COA dehydrogenase; structural genomics, center for 100.0
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, polymor 100.0
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA 100.0
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structural gen 100.0
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSFA, na 100.0
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seattle st 100.0
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus thermophil 100.0
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flav 100.0
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondrial; 100.0
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidics, sc 100.0
2jif_A404 Short/branched chain specific acyl-COA dehydrogenase; m 100.0
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, elec 100.0
2pg0_A385 Acyl-COA dehydrogenase; GK1316, structural genomics, PS 100.0
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken structura 100.0
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-C 100.0
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl- 100.0
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreduc 100.0
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSFA, na 100.0
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomics cen 100.0
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short 100.0
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase 100.0
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatty aci 100.0
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acyl-COA 100.0
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA deh 100.0
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase compone 100.0
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, structural 100.0
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, str 100.0
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomerase; A 100.0
2uxw_A607 VERY-long-chain specific acyl-COA dehydrogenase; altern 100.0
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, ox 100.0
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxid 100.0
3hwc_A515 Chlorophenol-4-monooxygenase component 2; beta barrel, 100.0
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, rike 99.98
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=860.96  Aligned_cols=532  Identities=35%  Similarity=0.541  Sum_probs=491.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCCCCCEE
Q ss_conf             62110116788858998001678899999720-42110789999998501899999986343698462017998521365
Q gi|254780299|r   19 SDSLFALNQPPLFIGMNAYSSDSLLVALIANF-PSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKV   97 (562)
Q Consensus        19 ~~~~~~~nq~~~~~g~n~~~~D~~l~~~~~~~-~~~~~~~l~~~g~~~~~~~~~~~~~~a~~~~P~l~~~d~~G~r~d~v   97 (562)
                      .+||+|||||||+.|+|+|.+|++|+++++++ +.+..++|.++|+.+|+.++.+|+++||+|||+|++||+||+|+|+|
T Consensus         3 ~~~~~~~n~~~~~~~~n~~~~D~~l~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~a~~~~P~l~~~d~~G~r~D~v   82 (541)
T 3djl_A            3 WQTHTVFNQPIPLNNSNLYLSDGALCEAVTREGAGWDSDFLASIGQQLGTAESLELGRLANVNPPELLRYDAQGRRLDDV   82 (541)
T ss_dssp             CCSCCCCSCCCCCCSCCTTTTCHHHHHHHHHTTCGGGHHHHHHHHHHHTSHHHHHHHHHHHHSCCEEEEECTTSCEEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCEE
T ss_conf             87744217999877987522488899999973575356999999999823899999987342898762418998878707


Q ss_pred             ECCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHH-CCHHHHHHHHH
Q ss_conf             66889999999999679620337766664447637999999999830144531221356778999985-08788987301
Q gi|254780299|r   98 EFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVALM-TTPRVHKDWAP  176 (562)
Q Consensus        98 ~~~p~~~~l~~~~~~~Gl~~~~~~~~~~~~~~~~~~~~~~a~~~l~~~~~~g~~cp~~mt~~a~~~L~-~~~e~~~~~lp  176 (562)
                      ++||+||++++.+++.||++++|+.++++    ++++.+++.+|++++.+.|+.||++||++++++|. ..+++...|.+
T Consensus        83 ~~~p~~~~l~~~~~~~G~~~~~~~~e~gg----~g~~~~~~~~~l~~~~~~g~~~p~~~~~~~~~~l~~~~~~~~~~~~~  158 (541)
T 3djl_A           83 RFHPAWHLLMQALCTNRVHNLAWEEDARS----GAFVARAARFMLHAQVEAGSLCPITMTFAATPLLLQMLPAPFQDWTT  158 (541)
T ss_dssp             ECCHHHHHHHHHHHHTTTTTGGGSTTCCT----THHHHHHHHHHHHHHHCSTTHHHHHHHHHHHHHHHHHCCGGGGGGHH
T ss_pred             EECHHHHHHHHHHHHCCCCCCCCCCCCCC----CCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHCC
T ss_conf             76889999999999779665768865578----65499999999999997524681657899999998418899998628


Q ss_pred             HHCCCCCCHHHCCCCCCCCCEEEEECCCCCCCCCHHHCCEEEEECCCCEEEECCEEEEEECCCCCEEEEEEECCCCCEEE
Q ss_conf             20010005442660015521235544588888786654302786489668984514686342115799970469961799
Q gi|254780299|r  177 KIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKISDGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCF  256 (562)
Q Consensus       177 ~l~s~~~~~~~~~~~~k~g~~~~~~lTEp~~GSDv~~~~T~A~~~gdg~y~LnG~Kwf~sa~~ad~~lVlArt~~Gls~F  256 (562)
                      +..+++|+++++|...|++++++|+||||++|||+++++|+|++++||.|+|||+|||+|++.+|+++|+|||++|+++|
T Consensus       159 ~~~~~~~~~~llp~~~~~~~~~~~~~TEp~aGSD~~~~~T~A~~~~dg~~~l~Gkk~f~sa~~ad~~lvlArt~~g~~~f  238 (541)
T 3djl_A          159 PLLSDRYDSHLLPGGQKRGLLIGMGMTEKQGGSDVMSNTTRAERLEDGSYRLVGHKWFFSVPQSDAHLVLAQTAGGLSCF  238 (541)
T ss_dssp             HHTCSCCCCCSSCGGGSSSCCEEEECCBTTBSSCGGGCCCEEEECTTSCEEEEEEEEEEECTTSSEEEEEEEETTEEEEE
T ss_pred             HHHHHHHHHHCCCCCHHCHHHHEEEECCCCCCCCHHHCCEEEEEECCCEEEECCEEEEEECCCCCEEEEEEEECCCCCEE
T ss_conf             98878877652882111617717642489878865429369999489579978379998063015799999726998756


Q ss_pred             EEECCCCCCCCCCEEEEEECCCCCCCCCCEEEEEECCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98775898840347886304755456577279998690753007776579999997301333579999999999999999
Q gi|254780299|r  257 LVPRLLEDGSPNGLCYQRLKNKIGNRSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAI  336 (562)
Q Consensus       257 lVp~~~pgg~~n~v~i~r~~~klG~r~~~t~ei~f~~~~~~llG~~g~G~~~i~~~l~~~Rl~~a~~~~G~ar~al~~A~  336 (562)
                      +||++.|+++.|+|++.++++|+|+|++++++++|++++++++|++|+|+++++.++|.+|+.+++.++|++++++++++
T Consensus       239 ~Vp~~~~d~~~~Gv~v~~~~~k~G~~~~~t~~~~f~~~~~~~lg~~g~G~~~~~~~l~~~R~~~a~~~~G~a~~al~~a~  318 (541)
T 3djl_A          239 FVPRFLPDGQRNAIRLERLKDKLGNRSNASCEVEFQDAIGWLLGLEGEGIRLILKMGGMTRFDCALGSHAMMRRAFSLAI  318 (541)
T ss_dssp             EEESBCTTSCBCSEEEEEECCCSSCTTSCEEEEEEEEEEEEEESSTTCHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCCCCCEEEECCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             67444667755862662032324776540330456554200047778722667777777766554333467888899999


Q ss_pred             HHHHHCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99840462224235388889999999999999999999999887201110367776556799999999999999995699
Q gi|254780299|r  337 HYARRRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAM  416 (562)
Q Consensus       337 ~yA~~R~~fG~~L~~~p~v~~~LAdm~~~~eaa~~l~~~~A~~~D~~~~~~~~~a~arl~t~iaK~~~~e~a~~v~~~Ai  416 (562)
                      +|+++|++||+||++||.||++|++|.+++++++++++++++.+|.+.. ..+..++++++|++|+++|+.+.+++++||
T Consensus       319 ~ya~~R~~fG~~l~~~p~v~~~La~m~~~~eaaral~~~aa~~~d~~~~-~~~~~~~~l~ts~aK~~~te~a~~v~~~a~  397 (541)
T 3djl_A          319 YHAHQRHVFGNPLIQQPLMRHVLSRMALQLEGQTALLFRLARAWDRRAD-AKEALWARLFTPAAKFVICKRGMPFVAEAM  397 (541)
T ss_dssp             HHHHHCEETTEEGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTS-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9998754279753456999999999999999999999999998545887-077899899999999999999999999999


Q ss_pred             HHHCCCCCCCCCHHHHHHHCCHHHHHCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCC
Q ss_conf             88521300045518898500122322046222789999998312603799999999964254517789999987305422
Q gi|254780299|r  417 ECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLLEKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKE  496 (562)
Q Consensus       417 qi~GG~Gy~ee~~leRl~RDA~v~~I~EGt~~I~aldv~r~l~r~~~~~~~l~~~l~~~~g~~~~~~~~~l~~~~~~~~~  496 (562)
                      |++||+||++|+|++|+|||+++++|||||||||++|++|.+.|.++..+.+++++....+.....+....+....+...
T Consensus       398 qv~GG~Gy~~e~~l~r~~RDar~~~I~eGT~eI~~l~i~R~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~  477 (541)
T 3djl_A          398 EVLGGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVLRVLNKQAGVYDLLSEAFVEVKGQDRYFDRAVRRLQQQLRKP  477 (541)
T ss_dssp             HHHGGGGGSTTSHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHCTTHHHHHHHHHHTTTTSCHHHHHHHHHHHHHTTSC
T ss_pred             HHHCCCCCCCCCHHHHHHHHCCCCCEECCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             97387624678889999975438807368899999999999604714799999999874066344699999999998766


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             137789999999999999999970857999999996400256554511434468899998551
Q gi|254780299|r  497 DKGLARFLTEKIALASSAAALYRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLY  559 (562)
Q Consensus       497 ~e~~AR~~~e~la~~~~aalL~r~a~~~va~af~~~Rl~~~~~~~~g~l~a~~d~~~~~~~~~  559 (562)
                      .+..+|+++++++++.++++|++|+...|+++|+..|+...++...   ... -...|+.|+.
T Consensus       478 ~e~~ar~~~~~~a~~~~aa~l~~~~~~~va~~~~~~~l~~~~~~~l---~~~-~~~~~l~ra~  536 (541)
T 3djl_A          478 AEELGREITHQLFLLGCGAQMLKYASPPMAQAWCQVMLDTRGGVRL---SEQ-IQNDLLLRAT  536 (541)
T ss_dssp             CGGGHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHCSSCCCCC---CHH-HHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCHHHHHHH---HHH-HHHHHHHHHC
T ss_conf             9999999999999999899999737899999999984212899999---988-8999998456



>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus HB8} Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure